Dxo (decapping exoribonuclease) - Rat Genome Database

Name: Dxo
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Dxo (decapping exoribonuclease) Rattus norvegicus

Analyze

Symbol:

Dxo

Name:

decapping exoribonuclease

RGD ID:

1303267

Description:

Predicted to enable several functions, including 5'-3' exonuclease activity; hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides; and magnesium ion binding activity. Predicted to be involved in NAD-cap decapping; RNA destabilization; and nuclear mRNA surveillance. Predicted to be located in nucleoplasm and plasma membrane. Predicted to be active in cytosol and nucleus. Orthologous to human DXO (decapping exoribonuclease); PARTICIPATES IN 3'-end pre-mRNA processing pathway; RNA polymerase II transcription termination pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

5'-3' exoribonuclease DXO; decapping and exoribonuclease protein; deNADding enzyme DXO; DOM-3 homolog Z; DOM-3 homolog Z (C. elegans); Dom3z; MGC95256; NAD-capped RNA hydrolase DXO

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DXO (decapping exoribonuclease)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Dxo (decapping exoribonuclease)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dxo (decapping exoribonuclease)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DXO (decapping exoribonuclease)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DXO (decapping exoribonuclease)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dxo (decapping exoribonuclease)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DXO (decapping exoribonuclease)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DXO (decapping exoribonuclease)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dxo (decapping exoribonuclease)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DXO (decapping exoribonuclease)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dxo (decapping exoribonuclease)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dxo (decapping exoribonuclease)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9125	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	RAI1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	cuff	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	dom-3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dxo	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	3,997,953 - 4,000,115 (-)	NCBI		GRCr8
mRatBN7.2	20	3,993,322 - 3,995,484 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,993,327 - 3,995,494 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,693,280 - 4,695,364 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	4,055,028 - 4,057,112 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,592,209 - 4,594,293 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	4,517,307 - 4,519,391 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	4,517,307 - 4,519,389 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	6,597,106 - 6,599,190 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	4,093,718 - 4,095,802 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	4,093,893 - 4,096,049 (-)	NCBI
Celera	20	4,035,291 - 4,037,375 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

proteasome-associated autoinflammatory syndrome 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

Benoxacor (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cobalt dichloride (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

folic acid (ISO)

fulvestrant (ISO)

glyphosate (ISO)

isoprenaline (ISO)

lead(0) (ISO)

methotrexate (ISO)

N-nitrosodiethylamine (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (ISO)

selenium atom (ISO)

sunitinib (ISO)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

tunicamycin (ISO)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

mRNA catabolic process (ISO,ISS)

NAD-cap decapping (IBA,ISO,ISS)

nuclear mRNA surveillance (ISO,ISS)

nuclear-transcribed mRNA catabolic process (IBA)

RNA destabilization (ISO,ISS)

Cellular Component

cytosol (IBA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO,ISS)

plasma membrane (IEA,ISO)

Molecular Function

5'-3' exonuclease activity (ISO,ISS)

magnesium ion binding (ISO,ISS)

metal ion binding (IEA)

mRNA 5'-diphosphatase activity (IBA,ISO,ISS)

mRNA binding (ISO,ISS)

nuclease activity (IEA)

nucleotide binding (IEA)

protein binding (ISO)

RNA binding (IEA)

RNA NAD+-cap (NAD+-forming) hydrolase activity (ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

3'-end pre-mRNA processing pathway (ISO)

RNA polymerase II transcription termination pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Pre-mRNA 3'-end processing complex assembly and function.	Chan S, etal., Wiley Interdiscip Rev RNA. 2011 May-Jun;2(3):321-35. doi: 10.1002/wrna.54. Epub 2010 Oct 18.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15060004	PMID:15489334	PMID:23523372	PMID:28283058	PMID:29601584	PMID:30180947	PMID:31101919

Genomics

Comparative Map Data

Dxo
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	3,997,953 - 4,000,115 (-)	NCBI		GRCr8
mRatBN7.2	20	3,993,322 - 3,995,484 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,993,327 - 3,995,494 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,693,280 - 4,695,364 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	4,055,028 - 4,057,112 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,592,209 - 4,594,293 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	4,517,307 - 4,519,391 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	4,517,307 - 4,519,389 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	6,597,106 - 6,599,190 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	4,093,718 - 4,095,802 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	4,093,893 - 4,096,049 (-)	NCBI
Celera	20	4,035,291 - 4,037,375 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

DXO
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	31,969,815 - 31,972,138 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	31,969,810 - 31,972,290 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	31,937,592 - 31,939,915 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	32,045,567 - 32,048,011 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	32,045,566 - 32,048,011	NCBI
Celera	6	33,537,350 - 33,539,794 (-)	NCBI		Celera
Cytogenetic Map	6	p21.33	NCBI
HuRef	6	31,724,525 - 31,726,969 (-)	NCBI		HuRef
CHM1_1	6	31,939,669 - 31,942,113 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	31,823,020 - 31,825,343 (-)	NCBI		T2T-CHM13v2.0

Dxo
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	35,055,998 - 35,058,162 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	35,055,995 - 35,058,209 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	34,836,996 - 34,839,187 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	34,837,019 - 34,839,233 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	34,973,964 - 34,976,131 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	34,445,139 - 34,447,289 (+)	NCBI		MGSCv36	mm8
Celera	17	37,932,348 - 37,934,515 (+)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	18.39	NCBI

Dxo
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	481,554 - 484,989 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	482,866 - 484,989 (-)	NCBI	ChiLan1.0	ChiLan1.0

DXO
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	46,446,379 - 46,448,629 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	42,407,867 - 42,410,121 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	31,630,523 - 31,632,363 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	32,517,086 - 32,519,566 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	32,517,086 - 32,519,566 (-)	Ensembl	panpan1.1		panPan2

DXO
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	1,424,584 - 1,426,275 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	1,424,591 - 1,426,452 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	1,559,785 - 1,562,016 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	1,566,885 - 1,568,996 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	1,566,892 - 1,568,726 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	1,424,344 - 1,426,575 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	1,492,527 - 1,494,758 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	1,559,127 - 1,561,358 (-)	NCBI		UU_Cfam_GSD_1.0

Dxo
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	35,982,182 - 35,984,452 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936727	1,576,886 - 1,579,154 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936727	1,576,823 - 1,579,158 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DXO
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	24,056,525 - 24,059,997 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	24,057,670 - 24,060,108 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	27,752,093 - 27,754,531 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DXO
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	40,049,679 - 40,052,114 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	40,050,257 - 40,052,050 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	31,886,210 - 31,888,644 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dxo
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	24,281,101 - 24,287,647 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624754	24,281,099 - 24,283,403 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dxo
2 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	158
Count of miRNA genes:	118
Interacting mature miRNAs:	130
Transcripts:	ENSRNOT00000000483
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61472	Aia1	Adjuvant induced arthritis QTL 1	18	0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	2646395	4597031	Rat
2306850	Pia40	Pristane induced arthritis QTL 40		0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1527959	5304575	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26123605	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
61448	Ciaa1	CIA Autoantibody QTL 1	30	0.001	blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	20	2646395	4597031	Rat
1331772	Cdexp2	CD45RC expression in CD8 T cells QTL 2	5.7		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	20	3621649	10078919	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
1300152	Bp195	Blood pressure QTL 195	3.46		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	3621649	9243559	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
737973	Pia21	Pristane induced arthritis QTL 21	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	4606812	Rat

Markers in Region

RH128323

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	3,993,011 - 3,993,203 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,519,515 - 4,519,706	NCBI	Rnor6.0
Rnor_5.0	20	6,599,314 - 6,599,505	UniSTS	Rnor5.0
RGSC_v3.4	20	4,093,403 - 4,093,594	UniSTS	RGSC3.4
Celera	20	4,037,499 - 4,037,690	UniSTS
RH 3.4 Map	20	52.5	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_212497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098809	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC082083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX883045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000483 ⟹ ENSRNOP00000000483

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	3,993,327 - 3,995,494 (-)	Ensembl
Rnor_6.0 Ensembl	20	4,517,307 - 4,519,389 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096572 ⟹ ENSRNOP00000092315

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	3,993,327 - 3,995,109 (-)	Ensembl

RefSeq Acc Id:

NM_212497 ⟹ NP_997662

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	3,997,953 - 4,000,037 (-)	NCBI
mRatBN7.2	20	3,993,327 - 3,995,411 (-)	NCBI
Rnor_6.0	20	4,517,307 - 4,519,391 (+)	NCBI
Rnor_5.0	20	6,597,106 - 6,599,190 (+)	NCBI
RGSC_v3.4	20	4,093,718 - 4,095,802 (-)	RGD
Celera	20	4,035,291 - 4,037,375 (+)	RGD

Sequence:

show sequence

CCTCCGGCCCTGAGGGCGGATGGTTGCGTCATCAGGAGCAACAACTCTACGTTTGCATCCCTGT
CCGGCTTCTGAGGTGCTGCCCTGATGCTATAGCCTCGGGGAGGTGGAGCTTTGAGGACCCCATG
GAGCCCAGAGGGACCAAGAGAAAAGCTGAGAAGACAGAGGTGGCAAAGACTTGGAACAAATTAC
CGCGGTCGCTACCCTCACTGCGCACACAGCCTTCTCTGTACTCCGGACCCTTCCCTTTCTACCG
GCGCCCTTCCGAACTGGGCTGCTTCTCCCTGGACGCACAGCGCCAGTACCACGGAGATGCCCGA
GCCCTCCGCTACTACAGCCCACCACCCATCAACGGCCCAGGCCCAGACTTTGACCTCAGAGATG
GATACCCTGACCGATACCAGCCCCGGGATGAGGAGGTCCGAGAGAGGTTGGACCATTTGCTGCG
CTGGGTCCTGGAACACCGAAACCAGCTGGAGGGGGGTCCAGGCTGGCTGGCAGGGGCCACAGTG
ACATGGCGAGGGCACCTGACAAAATTGCTGACCACACCGTATGAGAGGCAAGAGGGCTGGCAGC
TGGCAGCCTCCCGGTTCCAAGGGACACTGTATCTAAGTGAGGTGGAGACCCCGGCTGCTCGGGC
CCAGAGGCTTGCAAGGCCCCCCCTCCTCCGGGAGCTCATGTACATGGGCTACAAGTTTGAGCAG
TACATGTGTGCAGACAAACCTGGAGGCTCCCCAGACCCTTCTGGGGAAGTTAACACCAACGTGG
CCTTCTGCTCTGTGCTACGCAGCCGCCTGGGGAACCACCCTCTCCTATTCTCCGGGGAGGTAGA
CTGCCTAAACCCCCAGGCCCCTTGCACCCAGCCTCCCTCCTGCTACGTGGAGCTCAAGACGTCC
AAGGAGATGCACAGCCCTGGCCAGTGGAGGAGCTTCTACAGGCACAAGCTGCTGAAATGGTGGG
CTCAGTCGTTCCTCCCGGGGGTCCCGTATGTTGTTGCCGGCTTCCGGAACCCAGAAGGTTTCGT
CTGTTCCTTAAAGACCTTTCCTACCATGGAGATGTTTGAAAATGTCAGGAATGACCAAGAAGGC
TGGAATCCCTCCGTGTGCATGAACTTCTGTGCTGCCTTCCTTAGCTTTGCCCAGAGCACAGTCG
TCCAGGACGATCCCAGGCTTGTCCACCTCTTCTCCTGGGAGCCTGGTGGCCCTGTCACTGTGTC
TGTCCATCGGGATGCACCCTATGCCTTCCTGCCCTCCTGGTATGTGGAAGCTATGACCCAAGAC
CTCCCGTCACTCTCAAAGACTCCCTCCCCCAAGGACTGAGGACACAAATCTGGGTTCCGTGCAG
ACAATAAAGTCGTGTTTCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039098809 ⟹ XP_038954737

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	3,998,437 - 4,000,115 (-)	NCBI
mRatBN7.2	20	3,993,811 - 3,995,484 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_997662	(Get FASTA)	NCBI Sequence Viewer
	XP_038954737	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH82083	(Get FASTA)	NCBI Sequence Viewer
	CAE83969	(Get FASTA)	NCBI Sequence Viewer
	EDL83433	(Get FASTA)	NCBI Sequence Viewer
	EDL83434	(Get FASTA)	NCBI Sequence Viewer
	EDL83435	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000483.2
	ENSRNOP00000092315.1
	ENSRNOP00055011622
	ENSRNOP00060005558
	ENSRNOP00065036641
GenBank Protein	Q6MG77	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_997662 ⟸ NM_212497

- UniProtKB:

Q6MG77 (UniProtKB/Swiss-Prot), A6KTK3 (UniProtKB/TrEMBL), A6KTK4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEPRGTKRKAEKTEVAKTWNKLPRSLPSLRTQPSLYSGPFPFYRRPSELGCFSLDAQRQYHGDA
RALRYYSPPPINGPGPDFDLRDGYPDRYQPRDEEVRERLDHLLRWVLEHRNQLEGGPGWLAGAT
VTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPAARAQRLARPPLLRELMYMGYKFE
QYMCADKPGGSPDPSGEVNTNVAFCSVLRSRLGNHPLLFSGEVDCLNPQAPCTQPPSCYVELKT
SKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPYVVAGFRNPEGFVCSLKTFPTMEMFENVRNDQE
GWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHRDAPYAFLPSWYVEAMTQ
DLPSLSKTPSPKD

hide sequence

Ensembl Acc Id:

ENSRNOP00000000483 ⟸ ENSRNOT00000000483

RefSeq Acc Id:	XP_038954737 ⟸ XM_039098809
- Peptide Label:	isoform X1
- UniProtKB:	A6KTK5 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000092315 ⟸ ENSRNOT00000096572

Protein Domains

RAI1-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6MG77-F1-model_v2	AlphaFold	Q6MG77	1-397	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701353

Promoter ID:

EPDNEW_R11876

Type:

initiation region

Name:

Dxo_1

Description:

decapping exoribonuclease

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	4,517,245 - 4,517,305	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303267	AgrOrtholog
BioCyc Gene	G2FUF-4599	BioCyc
Ensembl Genes	ENSRNOG00000000422	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055008620	UniProtKB/Swiss-Prot
	ENSRNOG00060004355	UniProtKB/Swiss-Prot
	ENSRNOG00065025955	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000000483.5	UniProtKB/Swiss-Prot
	ENSRNOT00000096572.1	UniProtKB/TrEMBL
	ENSRNOT00055014551	UniProtKB/Swiss-Prot
	ENSRNOT00060007326	UniProtKB/Swiss-Prot
	ENSRNOT00065044745	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7133445	IMAGE-MGC_LOAD
InterPro	RAI1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAI1-like_fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:361799	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:95256	IMAGE-MGC_LOAD
NCBI Gene	361799	ENTREZGENE
PANTHER	DECAPPING AND EXORIBONUCLEASE PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR12395	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	RAI1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Dxo	PhenoGen
RatGTEx	ENSRNOG00000000422	RatGTEx
	ENSRNOG00055008620	RatGTEx
	ENSRNOG00060004355	RatGTEx
	ENSRNOG00065025955	RatGTEx
UniProt	A0A8I6AGB1_RAT	UniProtKB/TrEMBL
	A6KTK3	ENTREZGENE, UniProtKB/TrEMBL
	A6KTK4	ENTREZGENE, UniProtKB/TrEMBL
	A6KTK5	ENTREZGENE, UniProtKB/TrEMBL
	DXO_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-09-18	Dxo	decapping exoribonuclease	Dom3z	DOM-3 homolog Z (C. elegans)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Dom3z	DOM-3 homolog Z (C. elegans)		DOM-3 homolog Z	Name updated	1299863	APPROVED
2005-09-30	Dom3z				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations