Advanced Search (OLGA)

Gene: Dnmt3l (DNA methyltransferase 3 like) Rattus norvegicus

Analyze

Symbol:

Dnmt3l

Name:

DNA methyltransferase 3 like

RGD ID:

1303239

Description:

Predicted to enable enzyme activator activity and enzyme binding activity. Involved in response to ethanol. Predicted to be located in condensed nuclear chromosome and heterochromatin. Predicted to be part of ESC/E(Z) complex. Predicted to be active in cytoplasm and nucleus. Biomarker of choline deficiency disease. Orthologous to human DNMT3L (DNA methyltransferase 3 like); PARTICIPATES IN cysteine and methionine metabolic pathway; INTERACTS WITH alpha-Zearalanol; bisphenol A; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DNA (cytosine-5)-methyltransferase 3-like; DNA (cytosine-5-)-methyltransferase 3-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	10,614,591 - 10,628,989 (-)	NCBI		GRCr8
mRatBN7.2	20	10,614,933 - 10,629,337 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	10,614,934 - 10,629,516 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	11,314,285 - 11,328,650 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	10,675,187 - 10,689,553 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	11,147,204 - 11,161,604 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	11,344,513 - 11,359,090 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	11,344,514 - 11,359,090 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	13,514,653 - 13,529,169 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	10,958,957 - 10,973,422 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	10,959,183 - 10,973,649 (-)	NCBI
Celera	20	12,120,702 - 12,135,281 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dnmt3l	Rat	choline deficiency disease		IEP		9588267	mRNA:increased expression:liver:	RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dnmt3l	Rat	autistic disorder		ISO	RGD:1343645	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106\|PMID:30208311
Dnmt3l	Rat	autoimmune polyendocrine syndrome type 1		ISO	RGD:1343645	8554872	ClinVar Annotator: match by term: Polyglandular autoimmune syndrome, type 1	ClinVar	PMID:28492532
Dnmt3l	Rat	cataract 9 multiple types		ISO	RGD:1343645	8554872	ClinVar Annotator: match by term: Cataract 9 multiple types	ClinVar	PMID:28492532
Dnmt3l	Rat	developmental and epileptic encephalopathy 30		ISO	RGD:1343645	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy, 30	ClinVar	PMID:28492532\|PMID:8596935
Dnmt3l	Rat	homocystinuria		ISO	RGD:1343645	8554872	ClinVar Annotator: match by term: HYPERHOMOCYSTEINEMIA, THROMBOTIC, CBS-RELATED	ClinVar	PMID:10338090\|PMID:12124992\|PMID:28492532
Dnmt3l	Rat	Neurodevelopmental Disorders		ISO	RGD:1343645	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Dnmt3l	Rat	primary ciliary dyskinesia		ISO	RGD:1343645	8554872	ClinVar Annotator: match by term: Primary ciliary dyskinesia	ClinVar	PMID:28492532
Dnmt3l	Rat	progressive myoclonus epilepsy		ISO	RGD:1343645	8554872	ClinVar Annotator: match by term: Progressive myoclonic epilepsy	ClinVar	PMID:28492532\|PMID:8596935

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dnmt3l	Rat	1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene	multiple interactions	ISO	RGD:1615141	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Dnmt3l	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1615141	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of DNMT3L mRNA	CTD	PMID:22206623
Dnmt3l	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:1615141	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DNMT3L mRNA	CTD	PMID:17942748
Dnmt3l	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	RGD:1615141	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Dnmt3l	Rat	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	RGD:1615141	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Dnmt3l	Rat	2,3',4,4',5-Pentachlorobiphenyl	decreases expression	ISO	RGD:1615141	6480464	2,3',4,4',5-pentachlorobiphenyl results in decreased expression of DNMT3L mRNA	CTD	PMID:31388691
Dnmt3l	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1615141	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DNMT3L mRNA	CTD	PMID:17942748
Dnmt3l	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1615141	6480464	Tetrachlorodibenzodioxin affects the expression of DNMT3L mRNA	CTD	PMID:21570461
Dnmt3l	Rat	2,4,4'-trichlorobiphenyl	multiple interactions	ISO	RGD:1615141	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Dnmt3l	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:1615141	6480464	Fenretinide results in decreased expression of DNMT3L mRNA	CTD	PMID:28973697
Dnmt3l	Rat	4-nonylphenol	multiple interactions	ISO	RGD:1343645	6480464	[4-tert-octylphenol co-treated with 4-nonylphenol] results in decreased expression of DNMT3L mRNA; [4-tert-octylphenol co-treated with 4-nonylphenol] more ...	CTD	PMID:23626723
Dnmt3l	Rat	4-tert-Octylphenol	multiple interactions	ISO	RGD:1343645	6480464	[4-tert-octylphenol co-treated with 4-nonylphenol] results in decreased expression of DNMT3L mRNA; [4-tert-octylphenol co-treated with 4-nonylphenol] more ...	CTD	PMID:23626723
Dnmt3l	Rat	aflatoxin B1	decreases expression	ISO	RGD:1343645	6480464	Aflatoxin B1 results in decreased expression of DNMT3L mRNA	CTD	PMID:22100608
Dnmt3l	Rat	all-trans-retinoic acid	multiple interactions	ISO	RGD:1615141	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of DNMT3L mRNA	CTD	PMID:36189433
Dnmt3l	Rat	alpha-Zearalanol	increases expression	EXP		6480464	Zeranol results in increased expression of DNMT3L mRNA	CTD	PMID:35163327
Dnmt3l	Rat	arsane	multiple interactions	ISO	RGD:1615141	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of DNMT3L more ...	CTD	PMID:32045263
Dnmt3l	Rat	arsenic atom	multiple interactions	ISO	RGD:1615141	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of DNMT3L more ...	CTD	PMID:32045263
Dnmt3l	Rat	arsenite(3-)	increases expression	ISO	RGD:1615141	6480464	arsenite results in increased expression of DNMT3L mRNA	CTD	PMID:15894712
Dnmt3l	Rat	arsenite(3-)	multiple interactions	ISO	RGD:1615141	6480464	[arsenite co-treated with Benzo(a)pyrene] results in increased expression of DNMT3L mRNA	CTD	PMID:15894712
Dnmt3l	Rat	arsenous acid	multiple interactions	ISO	RGD:1343645	6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to DNMT3L protein]	CTD	PMID:26598702
Dnmt3l	Rat	benzo[a]pyrene	multiple interactions	ISO	RGD:1615141	6480464	[arsenite co-treated with Benzo(a)pyrene] results in increased expression of DNMT3L mRNA	CTD	PMID:15894712
Dnmt3l	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1343645	6480464	Benzo(a)pyrene affects the methylation of DNMT3L promoter	CTD	PMID:27901495
Dnmt3l	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1615141	6480464	Benzo(a)pyrene results in increased expression of DNMT3L mRNA	CTD	PMID:23735875
Dnmt3l	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1343645	6480464	Benzo(a)pyrene results in increased expression of DNMT3L mRNA	CTD	PMID:22316170
Dnmt3l	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1615141	6480464	Benzo(a)pyrene results in decreased expression of DNMT3L mRNA	CTD	PMID:15894712
Dnmt3l	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1615141	6480464	Diethylhexyl Phthalate results in increased expression of DNMT3L mRNA	CTD	PMID:34319233
Dnmt3l	Rat	bisphenol A	decreases expression	ISO	RGD:1615141	6480464	bisphenol A results in decreased expression of DNMT3L mRNA	CTD	PMID:22131059
Dnmt3l	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of DNMT3L mRNA	CTD	PMID:25181051
Dnmt3l	Rat	bisphenol A	multiple interactions	ISO	RGD:1615141	6480464	[bisphenol A co-treated with Stigmasterol] results in increased expression of DNMT3L mRNA; Fulvestrant inhibits the more ...	CTD	PMID:22131059\|PMID:30245210
Dnmt3l	Rat	buta-1,3-diene	increases expression	ISO	RGD:1615141	6480464	1,3-butadiene results in increased expression of DNMT3L mRNA	CTD	PMID:29038090
Dnmt3l	Rat	cadmium atom	multiple interactions	ISO	RGD:1343645	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of DNMT3L more ...	CTD	PMID:35301059
Dnmt3l	Rat	cadmium dichloride	decreases methylation	EXP		6480464	Cadmium Chloride results in decreased methylation of DNMT3L promoter	CTD	PMID:22457795
Dnmt3l	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1343645	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of DNMT3L more ...	CTD	PMID:35301059
Dnmt3l	Rat	cadmium dichloride	increases expression	ISO	RGD:1615141	6480464	Cadmium Chloride results in increased expression of DNMT3L mRNA; Cadmium Chloride results in increased expression more ...	CTD	PMID:27984135
Dnmt3l	Rat	cannabidiol	increases expression	ISO	RGD:1615141	6480464	Cannabidiol results in increased expression of DNMT3L mRNA	CTD	PMID:21542829
Dnmt3l	Rat	carbon nanotube	increases expression	ISO	RGD:1615141	6480464	Nanotubes, Carbon analog results in increased expression of DNMT3L mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681
Dnmt3l	Rat	chlorpyrifos	increases methylation	EXP		6480464	Chlorpyrifos results in increased methylation of DNMT3L gene	CTD	PMID:32905263
Dnmt3l	Rat	chlorpyrifos	increases expression	ISO	RGD:1615141	6480464	Chlorpyrifos results in increased expression of DNMT3L mRNA	CTD	PMID:37019170
Dnmt3l	Rat	cobalt dichloride	decreases expression	ISO	RGD:1343645	6480464	cobaltous chloride results in decreased expression of DNMT3L mRNA	CTD	PMID:20105288
Dnmt3l	Rat	copper(II) sulfate	affects expression	ISO	RGD:1343645	6480464	Copper Sulfate affects the expression of DNMT3L mRNA	CTD	PMID:19549813
Dnmt3l	Rat	cypermethrin	increases expression	EXP		6480464	cypermethrin results in increased expression of DNMT3L mRNA	CTD	PMID:35605701
Dnmt3l	Rat	diarsenic trioxide	multiple interactions	ISO	RGD:1343645	6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to DNMT3L protein]	CTD	PMID:26598702
Dnmt3l	Rat	dimethylselenide	multiple interactions	ISO	RGD:1343645	6480464	[[Hydroxyl Radical results in increased oxidation of dimethylselenide] which results in increased expression of DNMT3L-AS1 more ...	CTD	PMID:33656867
Dnmt3l	Rat	ethylparaben	decreases expression	ISO	RGD:1343645	6480464	ethyl-p-hydroxybenzoate results in decreased expression of DNMT3L mRNA	CTD	PMID:37690743
Dnmt3l	Rat	folic acid	multiple interactions	ISO	RGD:1615141	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of DNMT3L mRNA	CTD	PMID:22206623
Dnmt3l	Rat	fulvestrant	multiple interactions	ISO	RGD:1615141	6480464	fulvestrant inhibits the reaction [bisphenol A results in decreased expression of DNMT3L mRNA]	CTD	PMID:22131059
Dnmt3l	Rat	genistein	increases expression	ISO	RGD:1615141	6480464	Genistein results in increased expression of DNMT3L mRNA	CTD	PMID:32186404
Dnmt3l	Rat	hydrogen peroxide	affects expression	ISO	RGD:1343645	6480464	Hydrogen Peroxide affects the expression of DNMT3L mRNA	CTD	PMID:20044591
Dnmt3l	Rat	hydroxyl	multiple interactions	ISO	RGD:1343645	6480464	[[Hydroxyl Radical results in increased oxidation of dimethylselenide] which results in increased expression of DNMT3L-AS1 more ...	CTD	PMID:33656867
Dnmt3l	Rat	hypochlorous acid	increases expression	ISO	RGD:1615141	6480464	Hypochlorous Acid results in increased expression of DNMT3L mRNA	CTD	PMID:19376150
Dnmt3l	Rat	lead diacetate	increases methylation	EXP		6480464	lead acetate results in increased methylation of DNMT3L gene	CTD	PMID:29571894
Dnmt3l	Rat	lipopolysaccharide	affects expression	ISO	RGD:1615141	6480464	Lipopolysaccharides affects the expression of DNMT3L mRNA	CTD	PMID:30942577
Dnmt3l	Rat	lipopolysaccharide	increases expression	ISO	RGD:1343645	6480464	Lipopolysaccharides results in increased expression of DNMT3L mRNA	CTD	PMID:35811015
Dnmt3l	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1343645	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of DNMT3L mRNA	CTD	PMID:35811015
Dnmt3l	Rat	menadione	decreases expression	ISO	RGD:1615141	6480464	Vitamin K 3 results in decreased expression of DNMT3L mRNA	CTD	PMID:25270620
Dnmt3l	Rat	methylmercury chloride	affects expression	ISO	RGD:1615141	6480464	methylmercuric chloride affects the expression of DNMT3L mRNA	CTD	PMID:21613230
Dnmt3l	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:1615141	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of DNMT3L mRNA	CTD	PMID:36189433
Dnmt3l	Rat	N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal	multiple interactions	ISO	RGD:1615141	6480464	MYBPC3 protein affects the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of DNMT3L mRNA]	CTD	PMID:25566086
Dnmt3l	Rat	N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal	increases expression	ISO	RGD:1615141	6480464	benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of DNMT3L mRNA	CTD	PMID:25566086
Dnmt3l	Rat	ozone	multiple interactions	ISO	RGD:1343645	6480464	[[Ozone results in increased oxidation of dimethylselenide] which results in increased expression of DNMT3L-AS1 mRNA] more ...	CTD	PMID:33656867
Dnmt3l	Rat	p-tert-Amylphenol	multiple interactions	ISO	RGD:1343645	6480464	[4-tert-octylphenol co-treated with 4-nonylphenol] results in decreased expression of DNMT3L mRNA; [4-tert-octylphenol co-treated with 4-nonylphenol] more ...	CTD	PMID:23626723
Dnmt3l	Rat	paracetamol	increases expression	ISO	RGD:1343645	6480464	Acetaminophen results in increased expression of DNMT3L mRNA	CTD	PMID:29067470
Dnmt3l	Rat	PCB138	multiple interactions	ISO	RGD:1615141	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Dnmt3l	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	RGD:1615141	6480464	perfluorohexanesulfonic acid results in decreased expression of DNMT3L mRNA	CTD	PMID:37995155
Dnmt3l	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1343645	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of DNMT3L mRNA	CTD	PMID:35811015
Dnmt3l	Rat	sodium arsenite	decreases expression	ISO	RGD:1343645	6480464	sodium arsenite results in decreased expression of DNMT3L mRNA	CTD	PMID:29301061
Dnmt3l	Rat	sodium arsenite	multiple interactions	ISO	RGD:1615141	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of DNMT3L more ...	CTD	PMID:32045263
Dnmt3l	Rat	stigmasterol	multiple interactions	ISO	RGD:1615141	6480464	[bisphenol A co-treated with Stigmasterol] results in increased expression of DNMT3L mRNA; NR1H4 gene mutant more ...	CTD	PMID:30245210
Dnmt3l	Rat	succimer	multiple interactions	ISO	RGD:1615141	6480464	[Succimer binds to Magnetite Nanoparticles] which results in increased expression of DNMT3L mRNA; [Succimer co-treated more ...	CTD	PMID:21641980\|PMID:26378955
Dnmt3l	Rat	tebuconazole	decreases expression	ISO	RGD:1343645	6480464	tebuconazole results in decreased expression of DNMT3L mRNA	CTD	PMID:30458266
Dnmt3l	Rat	testosterone	multiple interactions	EXP		6480464	[Testosterone co-treated with vinclozolin] results in decreased expression of DNMT3L mRNA; [Testosterone co-treated with vinclozolin] more ...	CTD	PMID:20056826
Dnmt3l	Rat	titanium dioxide	increases expression	ISO	RGD:1615141	6480464	titanium dioxide results in increased expression of DNMT3L mRNA	CTD	PMID:23557971
Dnmt3l	Rat	titanium dioxide	decreases expression	ISO	RGD:1615141	6480464	titanium dioxide results in decreased expression of DNMT3L mRNA	CTD	PMID:35295148
Dnmt3l	Rat	troglitazone	decreases expression	ISO	RGD:1343645	6480464	troglitazone results in decreased expression of DNMT3L mRNA	CTD	PMID:25572481
Dnmt3l	Rat	trovafloxacin	decreases expression	ISO	RGD:1615141	6480464	trovafloxacin results in decreased expression of DNMT3L mRNA	CTD	PMID:35537566
Dnmt3l	Rat	uranium atom	affects expression	EXP		6480464	Uranium affects the expression of DNMT3L mRNA	CTD	PMID:29024790
Dnmt3l	Rat	urethane	decreases expression	ISO	RGD:1343645	6480464	Urethane results in decreased expression of DNMT3L mRNA	CTD	PMID:28818685
Dnmt3l	Rat	valproic acid	affects expression	ISO	RGD:1343645	6480464	Valproic Acid affects the expression of DNMT3L mRNA	CTD	PMID:25979313
Dnmt3l	Rat	valproic acid	increases methylation	ISO	RGD:1343645	6480464	Valproic Acid results in increased methylation of DNMT3L gene	CTD	PMID:29154799
Dnmt3l	Rat	vinclozolin	multiple interactions	EXP		6480464	[Testosterone co-treated with vinclozolin] results in decreased expression of DNMT3L mRNA; [Testosterone co-treated with vinclozolin] more ...	CTD	PMID:20056826
Dnmt3l	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of DNMT3L mRNA; vinclozolin results in decreased expression of DNMT3L more ...	CTD	PMID:20056826
Dnmt3l	Rat	wortmannin	multiple interactions	ISO	RGD:1343645	6480464	wortmannin inhibits the reaction [[4-tert-octylphenol co-treated with 4-nonylphenol] results in decreased expression of DNMT3L protein]	CTD	PMID:23626723

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dnmt3l	Rat	autosome genomic imprinting	acts_upstream_of_or_within	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	autosome genomic imprinting	acts_upstream_of_or_within	ISO	RGD:1615141	1624291	MGI:2447127 PMID:11934864	RGD	PMID:11934864
Dnmt3l	Rat	cell differentiation	involved_in	IEA	UniProtKB-KW:KW-0221	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dnmt3l	Rat	chorionic trophoblast cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	chorionic trophoblast cell differentiation	acts_upstream_of_or_within	ISO	RGD:1615141	1624291	MGI:2447127 PMID:16920095	RGD	PMID:16920095
Dnmt3l	Rat	DNA methylation-dependent constitutive heterochromatin formation	involved_in	ISS	UniProtKB:Q9CWR8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dnmt3l	Rat	DNA methylation-dependent constitutive heterochromatin formation	involved_in	ISO	RGD:1615141	1624291	PMID:24074865	RGD	PMID:24074865
Dnmt3l	Rat	DNA methylation-dependent constitutive heterochromatin formation	involved_in	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	epigenetic programing of female pronucleus	acts_upstream_of_or_within	ISO	RGD:1615141	1624291	MGI:2447127 PMID:16920095	RGD	PMID:16920095
Dnmt3l	Rat	epigenetic programing of female pronucleus	acts_upstream_of_or_within	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	genomic imprinting	involved_in	ISS	UniProtKB:Q9CWR8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dnmt3l	Rat	genomic imprinting	involved_in	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	genomic imprinting	acts_upstream_of_or_within	ISO	RGD:1615141	1624291	PMID:22723905	RGD	PMID:22723905
Dnmt3l	Rat	genomic imprinting	involved_in	ISO	RGD:1615141	1624291	PMID:15318244	RGD	PMID:15318244
Dnmt3l	Rat	male meiosis I	involved_in	ISS	UniProtKB:Q9CWR8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dnmt3l	Rat	male meiosis I	involved_in	ISO	RGD:1615141	1624291	PMID:15318244	RGD	PMID:15318244
Dnmt3l	Rat	male meiosis I	involved_in	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	methylation	acts_upstream_of_or_within	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	methylation	acts_upstream_of_or_within	ISO	RGD:1615141	1624291	MGI:2155766\|MGI:2447127 PMID:16920095, PMID:25503965	RGD	PMID:16920095\|PMID:25503965
Dnmt3l	Rat	negative regulation of DNA methylation-dependent heterochromatin formation	involved_in	ISO	RGD:1615141	1624291	PMID:24074865	RGD	PMID:24074865
Dnmt3l	Rat	negative regulation of DNA methylation-dependent heterochromatin formation	involved_in	ISS	UniProtKB:Q9CWR8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dnmt3l	Rat	negative regulation of DNA methylation-dependent heterochromatin formation	involved_in	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	negative regulation of DNA-templated transcription	involved_in	IBA	PANTHER:PTN002747444\|UniProtKB:Q9Y6K1	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dnmt3l	Rat	negative regulation of gene expression via chromosomal CpG island methylation	acts_upstream_of_or_within	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	negative regulation of gene expression via chromosomal CpG island methylation	acts_upstream_of_or_within	ISO	RGD:1615141	1624291	PMID:30834655	RGD	PMID:30834655
Dnmt3l	Rat	negative regulation of gene expression, epigenetic	involved_in	ISO	RGD:1343645	1624291	PMID:12202768	RGD	PMID:12202768
Dnmt3l	Rat	negative regulation of gene expression, epigenetic	involved_in	IEA	UniProtKB:Q9UJW3\|ensembl:ENSP00000486001	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	oocyte development	acts_upstream_of_or_within	ISO	RGD:1615141	1624291	MGI:2447127 PMID:11934864	RGD	PMID:11934864
Dnmt3l	Rat	placenta development	acts_upstream_of_or_within	ISO	RGD:1615141	1624291	MGI:2447127 PMID:16920095	RGD	PMID:16920095
Dnmt3l	Rat	placenta development	acts_upstream_of_or_within	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	post-embryonic development	acts_upstream_of_or_within	ISO	RGD:1615141	1624291	PMID:30834655	RGD	PMID:30834655
Dnmt3l	Rat	post-embryonic development	acts_upstream_of_or_within	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	response to ethanol		IEP		9588611		RGD
Dnmt3l	Rat	spermatogenesis	involved_in	ISO	RGD:1615141	1624291	PMID:15318244	RGD	PMID:15318244
Dnmt3l	Rat	spermatogenesis	involved_in	IEA	UniProtKB-KW:KW-0744	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dnmt3l	Rat	spermatogenesis	acts_upstream_of_or_within	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	spermatogenesis	acts_upstream_of_or_within	ISO	RGD:1615141	1624291	MGI:2155766\|MGI:2447127 PMID:11934864, PMID:25503965	RGD	PMID:11934864\|PMID:25503965
Dnmt3l	Rat	spermatogenesis	involved_in	ISS	UniProtKB:Q9CWR8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dnmt3l	Rat	stem cell differentiation	involved_in	ISO	RGD:1615141	1624291	PMID:24074865	RGD	PMID:24074865
Dnmt3l	Rat	stem cell differentiation	involved_in	ISS	UniProtKB:Q9CWR8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dnmt3l	Rat	stem cell differentiation	involved_in	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	transposable element silencing by heterochromatin formation	involved_in	ISS	UniProtKB:Q9CWR8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dnmt3l	Rat	transposable element silencing by heterochromatin formation	acts_upstream_of_or_within	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	transposable element silencing by heterochromatin formation	acts_upstream_of_or_within	ISO	RGD:1615141	1624291	MGI:2155766 PMID:25503965	RGD	PMID:25503965
Dnmt3l	Rat	transposable element silencing by heterochromatin formation	involved_in	ISO	RGD:1615141	1624291	PMID:15318244	RGD	PMID:15318244
Dnmt3l	Rat	transposable element silencing by piRNA-mediated DNA methylation	involved_in	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	transposable element silencing by piRNA-mediated DNA methylation	involved_in	ISO	RGD:1615141	1624291	UniProtKB:B1ASB6 PMID:32674113	RGD	PMID:32674113

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dnmt3l	Rat	catalytic complex	part_of	ISO	RGD:1343645	1624291	PMID:25383530, PMID:32083663	RGD	PMID:25383530\|PMID:32083663
Dnmt3l	Rat	catalytic complex	part_of	IEA	UniProtKB:Q9UJW3\|ensembl:ENSP00000486001	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	condensed nuclear chromosome	located_in	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	condensed nuclear chromosome	located_in	ISO	RGD:1615141	1624291	PMID:16543361	RGD	PMID:16543361
Dnmt3l	Rat	cytoplasm	located_in	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	cytoplasm	is_active_in	IBA	MGI:1261827\|MGI:1859287\|PANTHER:PTN002747444\|UniProtKB:Q9Y6K1	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dnmt3l	Rat	cytoplasm	located_in	ISO	RGD:1615141	1624291	PMID:16543361	RGD	PMID:16543361
Dnmt3l	Rat	ESC/E(Z) complex	part_of	ISO	RGD:1615141	1624291	PMID:24074865	RGD	PMID:24074865
Dnmt3l	Rat	ESC/E(Z) complex	located_in	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	ESC/E(Z) complex	located_in	ISS	UniProtKB:Q9CWR8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dnmt3l	Rat	heterochromatin	located_in	ISO	RGD:1615141	1624291	PMID:11934864	RGD	PMID:11934864
Dnmt3l	Rat	heterochromatin	located_in	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dnmt3l	Rat	nucleus	located_in	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	nucleus	located_in	ISO	RGD:1615141	1624291	PMID:27856912	RGD	PMID:27856912
Dnmt3l	Rat	nucleus	is_active_in	IBA	MGI:1261819\|MGI:1261827\|MGI:1859287\|MGI:2142008\|MGI:3649996\|PANTHER:PTN001497036\|RGD:1303336\|TAIR:locus:2089075\|UniProtKB:Q10SU5\|UniProtKB:Q6NUJ5\|UniProtKB:Q96N64\|UniProtKB:Q9M548\|UniProtKB:Q9UBC3\|UniProtKB:Q9Y6K1	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dnmt3l	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dnmt3l	Rat	DNA (cytosine-5-)-methyltransferase activity	NOT\|enables	ISO	RGD:1615141	1624291	PMID:11934864	RGD	PMID:11934864
Dnmt3l	Rat	enzyme activator activity	enables	ISO	RGD:1343645	1624291	PMID:16543361	RGD	PMID:16543361
Dnmt3l	Rat	enzyme activator activity	enables	ISO	RGD:1615141	1624291	PMID:16543361	RGD	PMID:16543361
Dnmt3l	Rat	enzyme activator activity	enables	IBA	MGI:1859287\|PANTHER:PTN001891074\|UniProtKB:Q9UJW3	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dnmt3l	Rat	enzyme activator activity	enables	IEA	UniProtKB:Q9UJW3\|ensembl:ENSP00000486001	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	enzyme activator activity	enables	IEA	UniProtKB:Q9CWR8\|ensembl:ENSMUSP00000121562	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	enzyme binding	enables	ISO	RGD:1343645	1624291	UniProtKB:Q13547 PMID:12202768	RGD	PMID:12202768
Dnmt3l	Rat	enzyme binding	enables	IEA	UniProtKB:Q9UJW3\|ensembl:ENSP00000486001	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnmt3l	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dnmt3l	Rat	protein binding	enables	ISO	RGD:1343645	1624291	UniProtKB:Q13547\|UniProtKB:Q17RL8\|UniProtKB:Q9UHA3\|UniProtKB:Q9Y6K1 PMID:12202768, PMID:16189514, PMID:17713477, PMID:25416956, PMID:32296183	RGD	PMID:12202768\|PMID:16189514\|PMID:17713477\|PMID:25416956\|PMID:32296183
Dnmt3l	Rat	protein binding	enables	ISO	RGD:1615141	1624291	PR:O88508\|PR:O88509\|UniProtKB:B1ASB6\|UniProtKB:O88508\|UniProtKB:O88508-1\|UniProtKB:O88509\|UniProtKB:Q15910\|UniProtKB:Q61188 PMID:11934864, PMID:16543361, PMID:17687327, PMID:17713477, PMID:17938196, PMID:24074865, PMID:32674113	RGD	PMID:11934864\|PMID:16543361\|PMID:17687327\|PMID:17713477\|PMID:17938196\|PMID:24074865\|PMID:32674113
Dnmt3l	Rat	protein binding	enables	ISO	RGD:1343645,UniProtKB:Q9UJW3-1	1624291	UniProtKB:Q9Y6K1 PMID:25383530	RGD	PMID:25383530
Dnmt3l	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Pathway Annotations Click to see Annotation Detail View

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dnmt3l	Rat	cysteine and methionine metabolic pathway		IEA		6907045		KEGG	rno:00270

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

autoimmune polyendocrine syndrome type 1 (ISO)

cataract 9 multiple types (ISO)

choline deficiency disease (IEP)

developmental and epileptic encephalopathy 30 (ISO)

homocystinuria (ISO)

Neurodevelopmental Disorders (ISO)

primary ciliary dyskinesia (ISO)

progressive myoclonus epilepsy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

4-hydroxyphenyl retinamide (ISO)

4-nonylphenol (ISO)

4-tert-Octylphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chlorpyrifos (EXP,ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cypermethrin (EXP)

diarsenic trioxide (ISO)

dimethylselenide (ISO)

ethylparaben (ISO)

folic acid (ISO)

fulvestrant (ISO)

genistein (ISO)

hydrogen peroxide (ISO)

hydroxyl (ISO)

hypochlorous acid (ISO)

lead diacetate (EXP)

lipopolysaccharide (ISO)

menadione (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

ozone (ISO)

p-tert-Amylphenol (ISO)

paracetamol (ISO)

PCB138 (ISO)

perfluorohexanesulfonic acid (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

stigmasterol (ISO)

succimer (ISO)

tebuconazole (ISO)

testosterone (EXP)

titanium dioxide (ISO)

troglitazone (ISO)

trovafloxacin (ISO)

uranium atom (EXP)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

wortmannin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

autosome genomic imprinting (IEA,ISO)

cell differentiation (IEA)

chorionic trophoblast cell differentiation (IEA,ISO)

DNA methylation-dependent constitutive heterochromatin formation (IEA,ISO,ISS)

epigenetic programing of female pronucleus (IEA,ISO)

genomic imprinting (IEA,ISO,ISS)

male meiosis I (IEA,ISO,ISS)

methylation (IEA,ISO)

negative regulation of DNA methylation-dependent heterochromatin formation (IEA,ISO,ISS)

negative regulation of DNA-templated transcription (IBA)

negative regulation of gene expression via chromosomal CpG island methylation (IEA,ISO)

negative regulation of gene expression, epigenetic (IEA,ISO)

oocyte development (ISO)

placenta development (IEA,ISO)

post-embryonic development (IEA,ISO)

response to ethanol (IEP)

spermatogenesis (IEA,ISO,ISS)

stem cell differentiation (IEA,ISO,ISS)

transposable element silencing by heterochromatin formation (IEA,ISO,ISS)

transposable element silencing by piRNA-mediated DNA methylation (IEA,ISO)

Cellular Component

catalytic complex (IEA,ISO)

condensed nuclear chromosome (IEA,ISO)

cytoplasm (IBA,IEA,ISO)

ESC/E(Z) complex (IEA,ISO,ISS)

heterochromatin (IEA,ISO)

nucleus (IBA,IEA,ISO)

Molecular Function

DNA (cytosine-5-)-methyltransferase activity (ISO)

enzyme activator activity (IBA,IEA,ISO)

enzyme binding (IEA,ISO)

metal ion binding (IEA)

protein binding (ISO)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

cysteine and methionine metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Effect of DNA Demethylation in Experimental Encapsulating Peritoneal Sclerosis.	Kim KH, etal., Ther Apher Dial. 2014 Sep 26. doi: 10.1111/1744-9987.12186.
3.	Gestational choline deficiency causes global and Igf2 gene DNA hypermethylation by up-regulation of Dnmt1 expression.	Kovacheva VP, etal., J Biol Chem. 2007 Oct 26;282(43):31777-88. Epub 2007 Aug 27.
4.	Identification of 11 pseudogenes in the DNA methyltransferase gene family in rodents and humans and implications for the functional loci.	Lees-Murdock DJ, etal., Genomics 2004 Jul;84(1):193-204.
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Effects of acute ethanol exposure on anxiety measures and epigenetic modifiers in the extended amygdala of adolescent rats.	Sakharkar AJ, etal., Int J Neuropsychopharmacol. 2014 Dec;17(12):2057-67. doi: 10.1017/S1461145714001047. Epub 2014 Jun 26.

Additional References at PubMed

PMID:11934864	PMID:12202768	PMID:15057822	PMID:15318244	PMID:16543361	PMID:16780588	PMID:16920095	PMID:18042343	PMID:24074865	PMID:25503965	PMID:27856912

Genomics

Comparative Map Data

Dnmt3l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	10,614,591 - 10,628,989 (-)	NCBI		GRCr8
mRatBN7.2	20	10,614,933 - 10,629,337 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	10,614,934 - 10,629,516 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	11,314,285 - 11,328,650 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	10,675,187 - 10,689,553 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	11,147,204 - 11,161,604 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	11,344,513 - 11,359,090 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	11,344,514 - 11,359,090 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	13,514,653 - 13,529,169 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	10,958,957 - 10,973,422 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	10,959,183 - 10,973,649 (-)	NCBI
Celera	20	12,120,702 - 12,135,281 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

DNMT3L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	21	44,246,339 - 44,261,897 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	21	44,246,339 - 44,262,216 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	21	45,666,222 - 45,681,780 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	21	44,490,651 - 44,506,527 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	21	44,490,650 - 44,506,527	NCBI
Celera	21	30,771,480 - 30,787,356 (-)	NCBI		Celera
Cytogenetic Map	21	q22.3	NCBI
HuRef	21	31,036,675 - 31,052,591 (-)	NCBI		HuRef
CHM1_1	21	45,226,863 - 45,242,733 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	21	42,600,400 - 42,615,957 (-)	NCBI		T2T-CHM13v2.0

Dnmt3l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	77,878,121 - 77,899,456 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	77,877,781 - 77,899,456 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	78,042,287 - 78,063,622 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	78,041,947 - 78,063,622 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	77,505,032 - 77,526,360 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	77,452,971 - 77,466,744 (+)	NCBI		MGSCv36	mm8
Celera	10	79,081,287 - 79,102,649 (+)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

Dnmt3l
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955407	41,177,582 - 41,186,965 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955407	41,177,582 - 41,186,965 (+)	NCBI	ChiLan1.0	ChiLan1.0

DNMT3L
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	22	40,255,079 - 40,269,622 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	21	35,105,200 - 35,119,723 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	21	30,503,194 - 30,520,237 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	21	43,798,778 - 43,814,283 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	21	43,798,778 - 43,814,283 (-)	Ensembl	panpan1.1		panPan2

DNMT3L
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	31	38,099,100 - 38,111,432 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	31	37,256,521 - 37,272,413 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	31	37,646,747 - 37,659,063 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	31	37,645,326 - 37,659,391 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	31	37,513,901 - 37,526,213 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	31	37,497,879 - 37,510,191 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	31	37,992,522 - 38,008,421 (-)	NCBI		UU_Cfam_GSD_1.0

Dnmt3l
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404971	37,307,350 - 37,324,745 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936500	143,078 - 160,212 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936500	143,078 - 160,318 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DNMT3L
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	207,119,051 - 207,132,538 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	207,119,025 - 207,141,990 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	216,998,088 - 217,011,839 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DNMT3L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	87,991,868 - 88,006,399 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	87,991,936 - 88,005,459 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	16,105,634 - 16,119,773 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dnmt3l
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624745	29,869,196 - 29,878,169 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624745	29,869,174 - 29,878,189 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dnmt3l
81 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	45
Count of miRNA genes:	39
Interacting mature miRNAs:	42
Transcripts:	ENSRNOT00000001610
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26123605	Rat
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8042410	29322208	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	4606607	17617956	Rat
631265	Iresp1	Immunoglobin response QTL1	8.3		blood anti-double stranded DNA antibody amount (VT:0004762)	serum anti-DNA antibody level (CMO:0001533)	20	9039719	13461775	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	4606607	17617956	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	6691706	17489458	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
1581577	Pur15	Proteinuria QTL 15	4.38	0.0002	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	20	8042410	17617956	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	3	44	53	53	61	32	25	32	6	164	75	42	45	54	29

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001003964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063279155	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC109383	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC135582	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BN000398	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001610 ⟹ ENSRNOP00000001610

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	10,614,934 - 10,629,516 (-)	Ensembl
Rnor_6.0 Ensembl	20	11,344,514 - 11,359,090 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110206 ⟹ ENSRNOP00000080143

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	10,614,934 - 10,629,275 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111099 ⟹ ENSRNOP00000092377

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	10,614,934 - 10,629,275 (-)	Ensembl

RefSeq Acc Id:

NM_001003964 ⟹ NP_001003964

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	10,614,591 - 10,628,989 (-)	NCBI
mRatBN7.2	20	10,614,933 - 10,629,337 (-)	NCBI
Rnor_6.0	20	11,344,514 - 11,359,090 (-)	NCBI
Rnor_5.0	20	13,514,653 - 13,529,169 (-)	NCBI
RGSC_v3.4	20	10,958,957 - 10,973,422 (-)	RGD
Celera	20	12,120,702 - 12,135,281 (-)	RGD

Sequence:

show sequence

CCCTCAACCCTACCATCCCAGGCCCTCATAGGCTCCATCCAGCATTACGTCCTCAATCTTACTT
ACGGGTTCTGAGGACCCTGCTGGCACGCCCGCCATCCCTTGGACGCAGACCCTTCTAGCAGATT
ACATCCATGGGTTCCCGGGAGACACCTTCTTCCTGCTCTAAGACCCATGAAACCTTGAACCTGG
AGACTCCGGAGAGCTCTAGCACTGACCCTGACAGTCCCCTGGAAGAGCAATGGCCGAAATCAGC
CCCAGATCTGAAAGAGGAAGACAGCATGGATATGGTACTGGAAGACTCCAAGGAGCCTCTAACC
CCTTCCTCACCGCCGACAGGCAGAGAGGTCATCAGGTACGAAGTCAACGTGAACCAGCGGAACA
TCGAAGACATCTGCCTCTGTTGCGGATCTCTCCAGGTGTACGCTCAGCACCCCTTGTTTGAGGG
GGGAATTTGTGCCCCGTGTAAGGACAAGTTCCTGGAGACCCTCTTCCTATACGACGAGGATGGA
CACCAGAGCTACTGTACCATCTGCTGCTCCGGGCATACCCTGTTCATCTGCGAGAGCCCCGACT
GTACCAGATGCTACTGTTTCGAGTGTGTGGATATCCTGGTGGGCCCCGGGACCTCGGAGCGCAT
CAATGCCATGGCCTGCTGGGTTTGCTTCCTGTGCCTGCCTTTCTCCCGGAGCGGACTGCTGCAG
AGGCGCAAGAAGTGGCGTCACCAGCTGAAGGCCTTCCATGACCGAGAGGGGGCAAGCCCTGTGG
AGATATACAAGACTGTGTCTGCATGGAAAAGACAGCCAGTGAGGGTGCTGAGTCTTTTTGGGAA
TATTGATAAAGAACTAAAGAGTTTGGGCTTTTTGGAAAGCAGTTCTGGTTCTGAGGGAGGAACG
CTGAAGTACGTGGAAGATGTCACCAATGTCGTGAGGAGAGAAGTGGAGAAATGGGGTCCCTTTG
ACTTGGTGTATGGCTCAACCCAGCCCCTAGGCTATTCTTGTGACCGCTGTCCTGGCTGGTACAT
GTTCCAGTTCCACCGGATCCTGCAGTATGCCCGGCCTCGCCAAGACAGCCAGCAGCCCTTCTTC
TGGATATTTGTGGACAATCTGCTGCTGACTGAAGATGACCAAGAGACAACTGTCCGCTTCCTTC
AGACAGAGGCTGTGACCCTCCAGGATGTCCGCGGCAGAGTCCTCCAGAATGCTATGAGGGTGTG
GAGCAACATTCCAGGGCTGAAGAGCAAGCACGCGGACCTGACCCCTAAGGAAGAGCAGTCTCTG
CAAACCCAAGTCAGAACCAGAAGCAAGCTGGCCGCCCAGAAAGTTGACTCCCTAGTGAAGTACT
GCCTTCTCCCCCTGAGAGAGTACTTCAAGTATTTTTCTCAGAACTCACTTCCTCTTTAGAAATG
AATCACCGTACGACGAAGAGTCTTCCCTAGAACCGTGGCAGCCTTCTTCCTGTGGCCTTTTCCC
TCTGCAGAGTTCCCTCCCGTTTGCTTGCTGGGCTTTGGGATTCTCTCCTGTTTGAGGCATCCAT
CTGAGATGCGAATGCCTCTGGGCAGCTCACTGTGGGGGTCCGGAGGCGCCCAACGCTCTGGACA
AGATCCCGATGGGGTAACCGGCCATGCTTCTTCCGAACAAAACTGTGTGTACCTGTTGTGAAGT
TTTTCAAATATATCATAGAATTGTT

hide sequence

RefSeq Acc Id:

XM_063279155 ⟹ XP_063135225

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	10,614,591 - 10,622,549 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001003964	(Get FASTA)	NCBI Sequence Viewer
	XP_063135225	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAE52320	(Get FASTA)	NCBI Sequence Viewer
	EDL97062	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000080143
GenBank Protein	Q1LZ50	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001003964 ⟸ NM_001003964

- UniProtKB:

Q1LZ50 (UniProtKB/Swiss-Prot), A0A8I6AHQ5 (UniProtKB/TrEMBL), A6JK46 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGSRETPSSCSKTHETLNLETPESSSTDPDSPLEEQWPKSAPDLKEEDSMDMVLEDSKEPLTPS
SPPTGREVIRYEVNVNQRNIEDICLCCGSLQVYAQHPLFEGGICAPCKDKFLETLFLYDEDGHQ
SYCTICCSGHTLFICESPDCTRCYCFECVDILVGPGTSERINAMACWVCFLCLPFSRSGLLQRR
KKWRHQLKAFHDREGASPVEIYKTVSAWKRQPVRVLSLFGNIDKELKSLGFLESSSGSEGGTLK
YVEDVTNVVRREVEKWGPFDLVYGSTQPLGYSCDRCPGWYMFQFHRILQYARPRQDSQQPFFWI
FVDNLLLTEDDQETTVRFLQTEAVTLQDVRGRVLQNAMRVWSNIPGLKSKHADLTPKEEQSLQT
QVRTRSKLAAQKVDSLVKYCLLPLREYFKYFSQNSLPL

hide sequence

Ensembl Acc Id:

ENSRNOP00000001610 ⟸ ENSRNOT00000001610

Ensembl Acc Id:

ENSRNOP00000092377 ⟸ ENSRNOT00000111099

Ensembl Acc Id:

ENSRNOP00000080143 ⟸ ENSRNOT00000110206

RefSeq Acc Id:	XP_063135225 ⟸ XM_063279155
- Peptide Label:	isoform X1
- UniProtKB:	F1LQE0 (UniProtKB/TrEMBL)

Protein Domains

ADD PHD-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q1LZ50-F1-model_v2	AlphaFold	Q1LZ50	1-422	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303239	AgrOrtholog
BioCyc Gene	G2FUF-4275	BioCyc
Ensembl Genes	ENSRNOG00000001212	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000110206	ENTREZGENE
Gene3D-CATH	3.40.50.150	UniProtKB/Swiss-Prot
InterPro	ADD	UniProtKB/Swiss-Prot
	DNMT3_ADD	UniProtKB/Swiss-Prot
	DNMT3_ADD_PHD	UniProtKB/Swiss-Prot
	SAM-dependent_MTases	UniProtKB/Swiss-Prot
KEGG Report	rno:309680	UniProtKB/Swiss-Prot
NCBI Gene	309680	ENTREZGENE
PANTHER	DNA CYTOSINE-5- -METHYLTRANSFERASE 3-RELATED	UniProtKB/Swiss-Prot
	PTHR23068:SF13	UniProtKB/Swiss-Prot
Pfam	ADD_DNMT3	UniProtKB/Swiss-Prot
	ADDz_Dnmt3b	UniProtKB/Swiss-Prot
PhenoGen	Dnmt3l	PhenoGen
PROSITE	ADD	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001212	RatGTEx
UniProt	A0A8I5ZPM6_RAT	UniProtKB/TrEMBL
	A0A8I6AHQ5	ENTREZGENE, UniProtKB/TrEMBL
	A6JK46	ENTREZGENE, UniProtKB/TrEMBL
	DNM3L_RAT	UniProtKB/Swiss-Prot
	F1LQE0	ENTREZGENE, UniProtKB/TrEMBL
	Q1LZ50	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-29	Dnmt3l	DNA methyltransferase 3 like	Dnmt3l	DNA (cytosine-5-)-methyltransferase 3-like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Dnmt3l	DNA (cytosine-5-)-methyltransferase 3-like			Symbol and Name status set to approved	1299863	APPROVED
2005-07-14	Dnmt3l	DNA (cytosine-5-)-methyltransferase 3-like			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_product	appears to be a pseudogene	1304004

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)