Ppic (peptidylprolyl isomerase C)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ppic (peptidylprolyl isomerase C) Rattus norvegicus

Analyze

Symbol:

Ppic

Name:

peptidylprolyl isomerase C

RGD ID:

1303221

Description:

Predicted to enable cyclosporin A binding activity and peptidyl-prolyl cis-trans isomerase activity. Predicted to be involved in protein folding. Predicted to be active in cytoplasm and intracellular membrane-bounded organelle. Orthologous to human PPIC (peptidylprolyl isomerase C); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC93799; peptidyl-prolyl cis-trans isomerase C

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PPIC (peptidylprolyl isomerase C)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ppic (peptidylprolyl isomerase C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ppic (peptidylprolyl isomerase C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PPIC (peptidylprolyl isomerase C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PPIC (peptidylprolyl isomerase C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ppic (peptidylprolyl isomerase C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PPIC (peptidylprolyl isomerase C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PPIC (peptidylprolyl isomerase C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ppic (peptidylprolyl isomerase C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SUGT1 (SGT1 homolog, MIS12 kinetochore complex assembly cochaperone)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	PPIC (peptidylprolyl isomerase C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ppic (peptidylprolyl isomerase C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CPR5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG2852	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	CPR2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	cyn-5	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	ppic	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	18	46,842,410 - 46,855,016 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	46,842,409 - 46,855,017 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	48,900,407 - 48,912,990 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	49,604,751 - 49,617,347 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	47,406,327 - 47,418,910 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	48,372,039 - 48,384,645 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	48,372,041 - 48,384,645 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	47,585,434 - 47,598,040 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	48,886,548 - 48,899,154 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	48,924,172 - 48,936,777 (-)	NCBI
Celera	18	45,024,826 - 45,037,432 (-)	NCBI		Celera
Cytogenetic Map	18	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Congenital Lower Urinary Tract Obstruction (ISO)

familial adenomatous polyposis 1 (ISO)

genetic disease (ISO)

Hereditary Neoplastic Syndromes (ISO)

Neurodevelopmental Disorders (ISO)

Stomach Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

Aroclor 1254 (ISO)

atrazine (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

calcitriol (ISO)

cannabidiol (ISO)

chlorpyrifos (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cytarabine (ISO)

dexamethasone (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

flutamide (EXP)

folic acid (ISO)

furan (EXP)

glycidol (EXP)

indole-3-methanol (EXP)

indometacin (ISO)

isobutanol (ISO)

ivermectin (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

menadione (ISO)

mercury dibromide (ISO)

methamphetamine (ISO)

oxaliplatin (EXP)

ozone (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

PhIP (EXP)

pirinixic acid (ISO)

prothioconazole (ISO)

rotenone (EXP,ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

temozolomide (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

thioacetamide (EXP)

topotecan (EXP)

trichostatin A (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein folding (IBA)

Cellular Component

cytoplasm (IBA)

intracellular membrane-bounded organelle (IBA)

Molecular Function

cyclosporin A binding (IBA,ISO,TAS)

peptidyl-prolyl cis-trans isomerase activity (IBA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Native recombinant cyclophilins A, B, and C degrade DNA independently of peptidylprolyl cis-trans-isomerase activity. Potential roles of cyclophilins in apoptosis.	Montague JW, etal., J Biol Chem 1997 Mar 7;272(10):6677-84.
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Cyclophilin C-associated protein and cyclophilin C mRNA are upregulated in penumbral neurons and microglia after focal cerebral ischemia.	Shimizu T, etal., J Cereb Blood Flow Metab 2005 Jan 12;.
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:1652374	PMID:20676357	PMID:23376485	PMID:23533145

Genomics

Comparative Map Data

Ppic
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	18	46,842,410 - 46,855,016 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	46,842,409 - 46,855,017 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	48,900,407 - 48,912,990 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	49,604,751 - 49,617,347 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	47,406,327 - 47,418,910 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	48,372,039 - 48,384,645 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	48,372,041 - 48,384,645 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	47,585,434 - 47,598,040 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	48,886,548 - 48,899,154 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	48,924,172 - 48,936,777 (-)	NCBI
Celera	18	45,024,826 - 45,037,432 (-)	NCBI		Celera
Cytogenetic Map	18	q11	NCBI

PPIC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	123,023,250 - 123,036,725 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	123,023,250 - 123,036,725 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	122,358,945 - 122,372,420 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	122,386,977 - 122,400,324 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	122,386,976 - 122,400,324	NCBI
Celera	5	118,313,549 - 118,326,899 (-)	NCBI		Celera
Cytogenetic Map	5	q23.2	NCBI
HuRef	5	117,547,085 - 117,560,441 (-)	NCBI		HuRef
CHM1_1	5	121,791,686 - 121,805,032 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	123,539,800 - 123,553,272 (-)	NCBI		T2T-CHM13v2.0

Ppic
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	53,539,413 - 53,551,079 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	53,539,404 - 53,551,187 (-)	Ensembl		GRCm39 Ensembl
GRCm38	18	53,406,341 - 53,418,007 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	53,406,332 - 53,418,115 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	53,565,995 - 53,577,661 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	53,531,710 - 53,543,376 (-)	NCBI		MGSCv36	mm8
Celera	18	54,714,243 - 54,725,974 (-)	NCBI		Celera
Cytogenetic Map	18	D1	NCBI
cM Map	18	29.03	NCBI

Ppic
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955521	1,138,779 - 1,143,356 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955521	1,138,779 - 1,143,345 (-)	NCBI	ChiLan1.0	ChiLan1.0

PPIC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	5	116,464,247 - 116,477,625 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	118,415,061 - 118,428,438 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	124,195,133 - 124,208,527 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	124,195,133 - 124,208,527 (-)	Ensembl	panpan1.1		panPan2

PPIC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	12,882,676 - 12,893,337 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	12,883,113 - 12,889,427 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	11,664,158 - 11,676,350 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	13,588,849 - 13,601,068 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	13,589,286 - 13,601,063 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	12,328,586 - 12,340,940 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	12,147,497 - 12,159,701 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	12,777,661 - 12,790,143 (-)	NCBI		UU_Cfam_GSD_1.0

Ppic
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	135,327,310 - 135,349,748 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936575	3,408,547 - 3,431,021 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936575	3,408,568 - 3,430,974 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPIC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	126,531,365 - 126,547,753 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	126,531,356 - 126,547,775 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	131,748,541 - 131,764,135 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PPIC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	26,079,473 - 26,095,595 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	26,075,893 - 26,095,604 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	52,032,395 - 52,048,741 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppic
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624774	18,991,646 - 19,002,556 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624774	18,991,651 - 19,002,503 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ppic
97 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	86
Count of miRNA genes:	69
Interacting mature miRNAs:	80
Transcripts:	ENSRNOT00000023485
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944299	52293055	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	22066242	52293055	Rat
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26548082	46969551	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26548082	46969551	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26548082	46969551	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26548082	46969551	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26548082	46969551	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26548082	46969551	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26548082	46969551	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	29792965	74792965	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	29792965	74792965	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	29792965	74792965	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	29792965	74792965	Rat
738005	Anxrr11	Anxiety related response QTL 11	3.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	18	30039813	75039813	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31271681	60377755	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31359408	59796643	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	61698465	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31359408	70263868	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31359408	83218561	Rat
6903347	Bp350	Blood pressure QTL 350	4.4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359530	59796478	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31393320	77209694	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	35870723	80870723	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	38192455	83192455	Rat
1598826	Anxrr20	Anxiety related response QTL 20	3.04		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	18	41432971	83828827	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	43345022	83828827	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	46640675	83828827	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	46640675	83828827	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	46640675	83828827	Rat
1331806	Bp229	Blood pressure QTL 229	4.36484		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718763	57867167	Rat
1331736	Bp227	Blood pressure QTL 227	2.791		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	46718763	59796643	Rat
1331780	Bp238	Blood pressure QTL 238	3.269		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718763	59796643	Rat
6903345	Bp349	Blood pressure QTL 349	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
6903349	Bp351	Blood pressure QTL 351	3.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
6903351	Bp352	Blood pressure QTL 352	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High										4
Medium	3	39	26	24	7	24	4	4	56	31	33	11	4
Low		4	31	17	12	17	4	7	18		8		4
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001004215	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC105831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000301	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000023485 ⟹ ENSRNOP00000023485

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	46,842,409 - 46,855,017 (-)	Ensembl
Rnor_6.0 Ensembl	18	48,372,041 - 48,384,645 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000112899 ⟹ ENSRNOP00000079353

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	46,842,420 - 46,854,999 (-)	Ensembl

RefSeq Acc Id:

NM_001004215 ⟹ NP_001004215

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	18	46,842,410 - 46,855,016 (-)	NCBI
Rnor_6.0	18	48,372,039 - 48,384,645 (-)	NCBI
Rnor_5.0	18	47,585,434 - 47,598,040 (-)	NCBI
RGSC_v3.4	18	48,886,548 - 48,899,154 (-)	RGD
Celera	18	45,024,826 - 45,037,432 (-)	RGD

Sequence:

show sequence

GGCGCAGGCGGCCAAGAGTCCTGCCACAGTCCGGGAGCTTAAGGTTGCGCCCGAGCCACTGTCG
CCGTTCCATCGTGCACCATGAGCCGGGGTCCTCGTCTGCTGCTGCCCGCGGTGCTCTTCCTGGG
GCTTGGAGGCCTCGTGTCTTCTTCGGGGTCATCGGGCGTCCGAAAGCGAGGTCCCTTGGTGACG
GACAAGGTCTTCTTTGATGTGAGGATCGGAGACAAAGATGTGGGTAGAATTGTGATTGGCCTCT
TTGGAAAAGTTGTACCCCGGACGGTAGAAAACTTCGTGACTCTGGCAACAGGAGAGAAAGGCTA
CGGGTACAAGGGAAGCATATTCCACCGTGTCATCAAGGACTTCATGATTCAAGGAGGGGACTTC
ACGGCTAGAGACGGCACTGGAGGTATGAGCATTTATGGTGAGACATTTCCTGATGAGAACTTCA
AACTGAAACACTATGGCATTGGGTGGGTCAGCATGGCCAATGCTGGACCAGACACCAATGGTTC
CCAATTCTTCATCACCTTGACCAAGCCCGCCTGGCTGGATGGCAAACATGTGGTATTTGGAAAA
GTTCTGGATGGGATGACTGTGGTACATTCCATAGAACTTCAAGCAACGGATGACCATGACCGCC
CACTTACCGACTGCACCATTGTCAACAGCGGCAAGATAGATGTGAAAACACCCTTTGTGGTTGA
GGTCCCTGACTGGTGACAGAAGTGGAGGAAAACAGGGAATGCACTGGCTGGTCCATGTGCTCAT
CTGCTATCCACCAGCTGTCTTTTGACTCTTTAGTTACTTAAAGTTGTAGTTAAAAAAAATTTTT
TTCTCTTTTAATTTCCCAGTCTAGATTGCAATGAAGATTTAAAAATCAACCACACAACCAGATG
TCTCAACAAACACCTGTCATCCCAGTATTTGGGAGGTGCAGGCAGGAGGATCAGAAGTTCAAGG
CCAGCCTTGGCTACATAGTGAGTTTGGGGCTAGCCTTGTCTATGTGGAACCCTGTTCAAAAAAG
CATACCAACAACAATAAAAACCAACTCCTGCTTAGGTACTTTAATTGAATGACATATCCTTCTC
TTCTAGTGGTGCTATTTTCAAATCAGAAACCTTCTCATTGGCTATTTGTTTTTACAAACATGGT
CTTTTAGTCTCACATGGTTTCTTGTGATCTCCATTTGGGTGATCAGAGGGTTTGTTTGAGGAAG
GTGGACTATAATAAGGCTTAGCATTTTCTGTTCAAATAATTCTTGTCGGGTAAAGGGAAACTGG
AGTAGTATCAAATGTTGTGTATCACCAGCATTTTGGGGCTTTGATGTTCTTTATATTAAATACT
TTTTAAATGAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001004215	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78949	(Get FASTA)	NCBI Sequence Viewer
	EDM14461	(Get FASTA)	NCBI Sequence Viewer
	EDM14462	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001004215 ⟸ NM_001004215
- Peptide Label:	precursor
- UniProtKB:	Q6AYQ9 (UniProtKB/TrEMBL), A0A8I5ZN96 (UniProtKB/TrEMBL), F7FHM1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSRGPRLLLPAVLFLGLGGLVSSSGSSGVRKRGPLVTDKVFFDVRIGDKDVGRIVIGLFGKVVP RTVENFVTLATGEKGYGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYG IGWVSMANAGPDTNGSQFFITLTKPAWLDGKHVVFGKVLDGMTVVHSIELQATDDHDRPLTDCT IVNSGKIDVKTPFVVEVPDW hide sequence

RefSeq Acc Id:

ENSRNOP00000023485 ⟸ ENSRNOT00000023485

RefSeq Acc Id:

ENSRNOP00000079353 ⟸ ENSRNOT00000112899

Protein Domains

PPIase cyclophilin-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AYQ9-F1-model_v2	AlphaFold	Q6AYQ9	1-212	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303221	AgrOrtholog
BioCyc Gene	G2FUF-7505	BioCyc
Ensembl Genes	ENSRNOG00000017416	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000023485.4	UniProtKB/TrEMBL
	ENSRNOP00000079353	ENTREZGENE
	ENSRNOP00000079353.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023485.5	UniProtKB/TrEMBL
	ENSRNOT00000112899	ENTREZGENE
	ENSRNOT00000112899.1	UniProtKB/TrEMBL
Gene3D-CATH	2.40.100.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7109986	IMAGE-MGC_LOAD
InterPro	Cyclophilin-like_dom	UniProtKB/TrEMBL
	Pep-Pro_Isoase_cyclophilin_CS	UniProtKB/TrEMBL
	PPIase_cyclophilin	UniProtKB/TrEMBL
KEGG Report	rno:291463	UniProtKB/TrEMBL
MGC_CLONE	MGC:93799	IMAGE-MGC_LOAD
NCBI Gene	291463	ENTREZGENE
PANTHER	PEPTIDYL-PROLYL CIS-TRANS ISOMERASE	UniProtKB/TrEMBL
	PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C	UniProtKB/TrEMBL
Pfam	Pro_isomerase	UniProtKB/TrEMBL
PhenoGen	Ppic	PhenoGen
PRINTS	CSAPPISMRASE	UniProtKB/TrEMBL
PROSITE	CSA_PPIASE_1	UniProtKB/TrEMBL
	CSA_PPIASE_2	UniProtKB/TrEMBL
Superfamily-SCOP	SSF50891	UniProtKB/TrEMBL
UniProt	A0A8I5ZN96	ENTREZGENE, UniProtKB/TrEMBL
	A6IX31_RAT	UniProtKB/TrEMBL
	F7FHM1	ENTREZGENE, UniProtKB/TrEMBL
	Q6AYQ9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Ppic	peptidylprolyl isomerase C			Symbol and Name status set to approved	1299863	APPROVED
2005-07-14	Ppic	peptidylprolyl isomerase C			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD