Advanced Search (OLGA)

Gene: Rilpl2 (Rab interacting lysosomal protein-like 2) Rattus norvegicus

Analyze

Symbol:

Rilpl2

Name:

Rab interacting lysosomal protein-like 2

RGD ID:

1303140

Description:

Predicted to enable dynein light intermediate chain binding activity; identical protein binding activity; and small GTPase binding activity. Predicted to be involved in cilium assembly; epithelial cell morphogenesis; and protein transport from ciliary membrane to plasma membrane. Predicted to be located in centrosome; cilium; and cytosol. Predicted to be active in ciliary basal body and cytoplasm. Orthologous to human RILPL2 (Rab interacting lysosomal protein like 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; benzo[a]pyrene; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC94142; rab-interacting lysosomal-like protein 2; RILP-like protein 2; similar to cDNA sequence BC003324

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	37,786,877 - 37,798,412 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	37,786,825 - 37,798,412 (+)	Ensembl				GRCr8
mRatBN7.2	12	32,125,908 - 32,137,426 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,125,886 - 32,137,418 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	33,304,729 - 33,316,215 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	33,916,060 - 33,927,543 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	32,967,928 - 32,979,413 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	37,544,918 - 37,556,453 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	37,544,918 - 37,556,453 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	39,415,025 - 39,426,666 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	33,238,328 - 33,250,549 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	33,815,933 - 33,826,268 (+)	NCBI		Celera
RGSC_v3.1	12	33,101,715 - 33,113,937 (+)	NCBI
Cytogenetic Map	12	q15	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

short chain acyl-CoA dehydrogenase deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

actinomycin D (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

clofibrate (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

doxorubicin (ISO)

entinostat (ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

leflunomide (ISO)

Nutlin-3 (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phytoestrogen (ISO)

progesterone (ISO)

quercetin (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

succimer (ISO)

titanium dioxide (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

tris(2-butoxyethyl) phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cilium assembly (IBA)

epithelial cell morphogenesis (IEA,ISO,ISS)

protein transport (IEA)

protein transport from ciliary membrane to plasma membrane (IEA,ISO,ISS)

Cellular Component

cell projection (IEA)

centrosome (IEA,ISO,ISS)

ciliary basal body (IBA)

cilium (IEA,ISO,ISS)

cytoplasm (IBA,IEA)

cytoskeleton (IEA)

cytosol (IEA,ISO)

membrane (IEA)

Molecular Function

dynein light intermediate chain binding (IBA)

identical protein binding (IEA,ISO)

protein binding (ISO)

protein dimerization activity (IEA)

small GTPase binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:16189514	PMID:19812310	PMID:23264467	PMID:23376485

Genomics

Comparative Map Data

Rilpl2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	37,786,877 - 37,798,412 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	37,786,825 - 37,798,412 (+)	Ensembl				GRCr8
mRatBN7.2	12	32,125,908 - 32,137,426 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,125,886 - 32,137,418 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	33,304,729 - 33,316,215 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	33,916,060 - 33,927,543 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	32,967,928 - 32,979,413 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	37,544,918 - 37,556,453 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	37,544,918 - 37,556,453 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	39,415,025 - 39,426,666 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	33,238,328 - 33,250,549 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	33,815,933 - 33,826,268 (+)	NCBI		Celera
RGSC_v3.1	12	33,101,715 - 33,113,937 (+)	NCBI
Cytogenetic Map	12	q15	NCBI

RILPL2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	123,409,306 - 123,436,684 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	123,409,714 - 123,436,684 (-)	Ensembl			hg38	GRCh38
GRCh37	12	123,899,586 - 123,921,231 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	122,465,889 - 122,487,217 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	12	123,492,620 - 123,513,952 (-)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	120,861,083 - 120,882,433 (-)	NCBI		HuRef
CHM1_1	12	123,714,676 - 123,736,013 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	123,405,896 - 123,433,259 (-)	NCBI		T2T-CHM13v2.0

Rilpl2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	124,601,328 - 124,616,298 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	124,601,328 - 124,616,429 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	124,463,265 - 124,478,235 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	124,463,265 - 124,478,366 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	124,913,274 - 124,928,244 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	124,723,883 - 124,738,853 (-)	NCBI		MGSCv36	mm8
Celera	5	121,536,695 - 121,551,551 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	63.6	NCBI

Rilpl2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	5,470,537 - 5,485,353 (+)	Ensembl
ChiLan1.0	NW_004955482	5,470,965 - 5,482,600 (+)	NCBI	ChiLan1.0	ChiLan1.0

RILPL2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	131,502,891 - 131,524,438 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	131,499,268 - 131,520,815 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	121,013,042 - 121,034,931 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	125,241,775 - 125,263,693 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	125,241,775 - 125,263,690 (-)	Ensembl			panPan2	panpan1.1

RILPL2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	6,145,571 - 6,168,750 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	6,145,937 - 6,168,625 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	6,308,125 - 6,328,893 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	6,395,577 - 6,416,359 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	6,395,738 - 6,425,114 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	6,329,024 - 6,349,793 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	6,422,041 - 6,442,854 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	6,374,617 - 6,395,392 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rilpl2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	158,137,619 - 158,161,156 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936558	1,318,553 - 1,333,140 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936558	1,318,282 - 1,341,799 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RILPL2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	29,477,281 - 29,523,166 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	29,478,135 - 29,522,923 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	31,187,509 - 31,211,475 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RILPL2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	118,748,165 - 118,769,540 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	118,747,886 - 118,769,301 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	126,513,244 - 126,534,491 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rilpl2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	23,313,743 - 23,322,323 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624747	23,313,287 - 23,321,964 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Rilpl2
63 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	168
Count of miRNA genes:	119
Interacting mature miRNAs:	141
Transcripts:	ENSRNOT00000001403
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	37764145	51558799	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	29775522	42298555	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	33700432	51558799	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	34243475	43352593	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat

Markers in Region

D12Rat107

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	37,795,838 - 37,796,040 (+)	Marker Load Pipeline
mRatBN7.2	12	32,134,852 - 32,135,053 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	37,553,880 - 37,554,080	NCBI	Rnor6.0
Rnor_5.0	12	39,424,093 - 39,424,293	UniSTS	Rnor5.0
RGSC_v3.4	12	33,247,979 - 33,248,179	UniSTS	RGSC3.4
RGSC_v3.4	12	33,247,978 - 33,248,179	RGD	RGSC3.4
Celera	12	33,824,681 - 33,824,881	UniSTS
RGSC_v3.1	12	33,111,366 - 33,111,567	RGD
SHRSP x BN Map	12	42.1799	UniSTS
SHRSP x BN Map	12	42.1799	RGD
Cytogenetic Map	12	q15	UniSTS

RH142826

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	32,137,843 - 32,138,016 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	37,556,641 - 37,556,813	NCBI	Rnor6.0
Rnor_5.0	12	40,433,342 - 40,433,514	UniSTS	Rnor5.0
Rnor_5.0	12	39,426,854 - 39,427,026	UniSTS	Rnor5.0
RGSC_v3.4	12	33,250,967 - 33,251,139	UniSTS	RGSC3.4
RH 3.4 Map	12	555.3	UniSTS
Cytogenetic Map	12	q15	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001004205	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079132	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001403 ⟹ ENSRNOP00000001403

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	37,786,825 - 37,798,412 (+)	Ensembl
mRatBN7.2 Ensembl	12	32,125,886 - 32,137,418 (+)	Ensembl
Rnor_6.0 Ensembl	12	37,544,918 - 37,556,453 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098295 ⟹ ENSRNOP00000094174

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	32,125,886 - 32,134,206 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108742 ⟹ ENSRNOP00000095878

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	37,786,825 - 37,795,631 (+)	Ensembl
mRatBN7.2 Ensembl	12	32,125,886 - 32,134,208 (+)	Ensembl

RefSeq Acc Id:

NM_001004205 ⟹ NP_001004205

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	37,786,877 - 37,798,412 (+)	NCBI
mRatBN7.2	12	32,125,908 - 32,137,426 (+)	NCBI
Rnor_6.0	12	37,544,918 - 37,556,453 (+)	NCBI
Rnor_5.0	12	39,415,025 - 39,426,666 (+)	NCBI
RGSC_v3.4	12	33,238,328 - 33,250,549 (+)	RGD
Celera	12	33,815,933 - 33,826,268 (+)	RGD

Sequence:

show sequence

CGGACTACCAGGCCTTGGGTGCTCCTCGGTGCCCCTTCCTCTCTGCTTTGCTTCCCACAGTCCC
CTGTGCGTGTCCCTCACTTTTGGCGCACGGCTGTGTAGCTGCGCGCGGCTTTCCATGGTTCGGT
GGTACCCGCTACTCAGCGCCACCCCCCAAGGGCCACACAGACTGCTCACGGCGTGGACTCGGCC
CAGAGAAAAGTTTCCCTGACCCAGAGCCCGTGGACGCGTAGGTGACAGCAGCCCTGAAGGTCGC
AGAAGTCCGGGGTACCATGGAGGAGCCCCCAGTACGGGAAGAGGAGGACGGCGAGGAAGACGAG
GGCGCCCTGGCCAAGAGCCCCCTGCAGCTGACCACCGAAGACGTGTACGACATCTCCTATGTGG
TGGGCCGCGAGCTGATGGCCCTGGGCAGCGACCCCCGCGTCACCCGGCTGCAGTTCAAGATCGT
ACGTGTGATGGAGATGCTGGAGGCGCTGGTGAATGAGGGCAGCCTGGCGGTCGAGGAGCTGAGG
ATGGAGAGGGACAACCTCAAGCAGGAGGTGGAGGGGCTGCGGAGAGCCGGTGTGTCCGGATCCG
AGGTGAACTTGGGACCGGACAAGATGGTAGTTGATCTGACAGACCCCAACCGGCCCCGCTTTAC
CCTGCAAGAGCTGAGGGACGTTCTGCAGGAACGCAACAAGCTCAAGTCGCAGCTGCTGCTGGTG
CAGGAGGAACTGCAGTGCTACAGGAGTGGTCTCCTTCCACCCAGAGAAACTCCAGGAGGAAGAA
GAGAGAAAGACGCTATGGTTACCATGGGCAACGGCGAGAAGGAGGAGAGGACCATTATGAAGAA
GCTGTTCTCTTTCCGGTCAGGGAAGCACACCTAGATTGAAGGCCATTGCCAAGATGGCGACCCT
CTCGACTTGAGAAGATAATTGCCAATATGTCTTCTGGAACCATCTTTCTGTGCTTTGGAGCTTT
GCCCTCAGAGCAAAGTCAAAGGAAGATGCTCTCATGGCTCACCTGCTCCCCGGGGACAGAACTG
GATAGGCAGTAAGCTTTGGCCAGGACAAGTGAGGCATGATCAGGAACTTGAGAAAGCAAAGGAA
CACTGAGCGTGGCCTCCACTCATGGACAGAGGCCTCTGGCCCGCAGATTGTTCCTGCCTCAGCG
GTAATCCGGTCAGAGCAAGATGGAAAAGTAGGAAAGTATGGAATCGCTTTTACTGATATTTGGT
GAATACTTGATTTCTCTCACTCAACTTTCTTTATATGACTTTTGTATTAAAATGAAAAGACCTT
TAGAGTTTCAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001004205	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79132	(Get FASTA)	NCBI Sequence Viewer
	EDM13585	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001403
	ENSRNOP00000001403.4
GenBank Protein	Q6AYA0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001004205 ⟸ NM_001004205
- UniProtKB:	Q6AYA0 (UniProtKB/Swiss-Prot), A6J0Z6 (UniProtKB/TrEMBL), A0A8I6AQ16 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEEPPVREEEDGEEDEGALAKSPLQLTTEDVYDISYVVGRELMALGSDPRVTRLQFKIVRVMEM LEALVNEGSLAVEELRMERDNLKQEVEGLRRAGVSGSEVNLGPDKMVVDLTDPNRPRFTLQELR DVLQERNKLKSQLLLVQEELQCYRSGLLPPRETPGGRREKDAMVTMGNGEKEERTIMKKLFSFR SGKHT hide sequence

Ensembl Acc Id:

ENSRNOP00000001403 ⟸ ENSRNOT00000001403

Ensembl Acc Id:

ENSRNOP00000094174 ⟸ ENSRNOT00000098295

Ensembl Acc Id:

ENSRNOP00000095878 ⟸ ENSRNOT00000108742

Protein Domains

RH1 RH2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AYA0-F1-model_v2	AlphaFold	Q6AYA0	1-197	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698612

Promoter ID:

EPDNEW_R9137

Type:

initiation region

Name:

Rilpl2_1

Description:

Rab interacting lysosomal protein-like 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	37,544,912 - 37,544,972	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303140	AgrOrtholog
BioCyc Gene	G2FUF-19355	BioCyc
Ensembl Genes	ENSRNOG00000001061	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000001403	ENTREZGENE
	ENSRNOT00000001403.5	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.58.1770	UniProtKB/Swiss-Prot
	6.10.230.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7127390	IMAGE-MGC_LOAD
InterPro	DZIP_RILPL	UniProtKB/Swiss-Prot
	RH1	UniProtKB/Swiss-Prot
	RH2	UniProtKB/Swiss-Prot
	RILP_dimer	UniProtKB/Swiss-Prot
KEGG Report	rno:288652	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94142	IMAGE-MGC_LOAD
NCBI Gene	288652	ENTREZGENE
PANTHER	RILP-LIKE PROTEIN 2	UniProtKB/Swiss-Prot
	ZINC FINGER PROTEIN DZIP1	UniProtKB/Swiss-Prot
Pfam	RH1	UniProtKB/Swiss-Prot
	RILP	UniProtKB/Swiss-Prot
PhenoGen	Rilpl2	PhenoGen
PROSITE	RH1	UniProtKB/Swiss-Prot
	RH2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001061	RatGTEx
Superfamily-SCOP	RILP dimerisation region	UniProtKB/Swiss-Prot
UniProt	A0A8I6AMJ6_RAT	UniProtKB/TrEMBL
	A0A8I6AQ16	ENTREZGENE, UniProtKB/TrEMBL
	A6J0Z6	ENTREZGENE, UniProtKB/TrEMBL
	Q6AYA0	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Rilpl2	Rab interacting lysosomal protein-like 2	MGC94142	similar to cDNA sequence BC003324	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-09-30	MGC94142				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar