Advanced Search (OLGA)

Gene: Nup35 (nucleoporin 35) Rattus norvegicus

Analyze

Symbol:

Nup35

Name:

nucleoporin 35

RGD ID:

1303069

Description:

Predicted to enable identical protein binding activity and phospholipid binding activity. Predicted to be a structural constituent of nuclear pore. Predicted to be involved in NLS-bearing protein import into nucleus and nuclear pore organization. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Located in nuclear lamina. Orthologous to human NUP35 (nucleoporin 35); PARTICIPATES IN RNA transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

35 kDa nucleoporin; MGC93680; mitotic phosphoprotein 44; nuclear pore complex protein Nup53; nucleoporin Nup35; nucleoporin NUP53

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NUP35 (nucleoporin 35)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Nup35 (nucleoporin 35)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nup35 (nucleoporin 35)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NUP35 (nucleoporin 35)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NUP35 (nucleoporin 35)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nup35 (nucleoporin 35)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NUP35 (nucleoporin 35)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NUP35 (nucleoporin 35)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nup35 (nucleoporin 35)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NUP35 (nucleoporin 35)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nup35 (nucleoporin 35)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nup35 (nucleoporin 35)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NUP53	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	npp-19	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Nup35	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nup35	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	85,965,907 - 85,991,659 (+)	NCBI		GRCr8
mRatBN7.2	3	65,555,203 - 65,594,488 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	65,558,968 - 65,585,130 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	68,911,643 - 68,937,209 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	77,495,202 - 77,520,768 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	75,258,930 - 75,284,498 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	67,866,784 - 67,896,828 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	67,870,111 - 67,896,153 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	74,423,181 - 74,453,173 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	63,493,936 - 63,519,689 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	63,390,307 - 63,416,059 (+)	NCBI
Celera	3	65,005,138 - 65,030,546 (+)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amenorrhea (ISO)

intestinal pseudo-obstruction (ISS)

pneumoconiosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3,4-methylenedioxymethamphetamine (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

atrazine (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clofibrate (ISO)

coumarin (ISO)

coumestrol (ISO)

dicrotophos (ISO)

dioxygen (ISO)

enzyme inhibitor (ISO)

ethyl methanesulfonate (ISO)

finasteride (EXP)

flutamide (EXP)

FR900359 (ISO)

gentamycin (EXP)

ivermectin (ISO)

ketamine (EXP)

methimazole (EXP)

methyl methanesulfonate (ISO)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

phenobarbital (ISO)

pinosylvin (ISO)

propiconazole (ISO)

quercetin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

Soman (EXP)

tamoxifen (ISO)

testosterone (ISO)

thioacetamide (EXP)

topotecan (EXP)

trans-pinosylvin (ISO)

triadimefon (EXP)

tungsten (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to leukemia inhibitory factor (ISO)

mRNA transport (IEA)

NLS-bearing protein import into nucleus (IBA)

nuclear pore organization (IBA)

nucleocytoplasmic transport (IEA)

protein transport (IEA)

Cellular Component

intracellular membrane-bounded organelle (ISO)

membrane (IEA)

nuclear envelope (ISO)

nuclear lamina (IDA)

nuclear membrane (IEA,ISO)

nuclear pore (IEA)

nuclear pore central transport channel (IBA)

nuclear pore nuclear basket (IBA)

nucleoplasm (ISO)

nucleus (IEA)

plasma membrane (ISO)

Molecular Function

identical protein binding (ISO)

nucleic acid binding (IEA)

phospholipid binding (IBA)

protein binding (ISO)

structural constituent of nuclear pore (IBA,IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

RNA transport pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Vertebrate Nup53 interacts with the nuclear lamina and is required for the assembly of a Nup93-containing complex.	Hawryluk-Gara LA, etal., Mol Biol Cell. 2005 May;16(5):2382-94. Epub 2005 Feb 9.
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
7.	Detection of two chromatin proteins which bind specifically to the 5'-flanking region of the rat prolactin gene.	White BA, etal., Mol Cell Biol 1985 Nov;5(11):2967-74.

Additional References at PubMed

PMID:15489334	PMID:16962612	PMID:20439489

Genomics

Comparative Map Data

Nup35
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	85,965,907 - 85,991,659 (+)	NCBI		GRCr8
mRatBN7.2	3	65,555,203 - 65,594,488 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	65,558,968 - 65,585,130 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	68,911,643 - 68,937,209 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	77,495,202 - 77,520,768 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	75,258,930 - 75,284,498 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	67,866,784 - 67,896,828 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	67,870,111 - 67,896,153 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	74,423,181 - 74,453,173 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	63,493,936 - 63,519,689 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	63,390,307 - 63,416,059 (+)	NCBI
Celera	3	65,005,138 - 65,030,546 (+)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

NUP35
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	183,117,514 - 183,161,680 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	183,117,513 - 183,161,680 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	183,982,242 - 184,026,408 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	183,697,328 - 183,734,653 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	183,814,588 - 183,851,913	NCBI
Celera	2	177,585,188 - 177,622,496 (+)	NCBI		Celera
Cytogenetic Map	2	q32.1	NCBI
HuRef	2	175,847,884 - 175,885,184 (+)	NCBI		HuRef
CHM1_1	2	183,994,950 - 184,032,286 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	183,606,527 - 183,650,714 (+)	NCBI		T2T-CHM13v2.0

Nup35
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	80,469,156 - 80,490,415 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	80,447,580 - 80,489,250 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	80,638,812 - 80,660,071 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	80,617,236 - 80,658,906 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	80,478,969 - 80,500,228 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	80,439,653 - 80,459,741 (+)	NCBI		MGSCv36	mm8
Celera	2	82,305,823 - 82,328,399 (+)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	48.31	NCBI

Nup35
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	14,379,962 - 14,412,956 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	14,381,591 - 14,415,394 (-)	NCBI	ChiLan1.0	ChiLan1.0

NUP35
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	85,782,337 - 85,820,385 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	85,797,422 - 85,835,363 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	70,395,325 - 70,433,142 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	188,202,929 - 188,239,978 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	188,195,380 - 188,239,978 (+)	Ensembl	panpan1.1		panPan2

NUP35
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	26,128,838 - 26,168,664 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	26,135,065 - 26,168,298 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	26,026,128 - 26,065,943 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	26,282,606 - 26,322,421 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	26,288,098 - 26,322,417 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	26,408,804 - 26,448,593 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	26,339,648 - 26,380,106 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	26,481,996 - 26,521,810 (+)	NCBI		UU_Cfam_GSD_1.0

Nup35
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	143,121,946 - 143,173,150 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	11,681,099 - 11,726,739 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936509	11,681,038 - 11,798,620 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NUP35
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	88,587,785 - 88,622,022 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	88,587,753 - 88,616,310 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	98,214,333 - 98,218,027 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NUP35
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	68,648,503 - 68,685,143 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	68,648,151 - 68,685,379 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	130,870,292 - 130,906,965 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nup35
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624844	4,824,344 - 4,854,808 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624844	4,824,240 - 4,854,814 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nup35
373 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	97
Count of miRNA genes:	65
Interacting mature miRNAs:	82
Transcripts:	ENSRNOT00000012628
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	61134348	89115068	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
12879868	Am6	Aortic mass QTL 6		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	31426403	70668733	Rat
11565451	Bw177	Body weight QTL 177		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	3	31426403	70668733	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
11565452	Kidm57	Kidney mass QTL 57		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	31426403	70668733	Rat
12879866	Cm94	Cardiac mass QTL 94		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	31426403	70668733	Rat
12879867	Cm95	Cardiac mass QTL 95		0.047	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	31426403	70668733	Rat
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
2301400	Cm68	Cardiac mass QTL 68		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	31426403	70668733	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat

Markers in Region

RH129293

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	65,584,376 - 65,584,586 (+)	MAPPER	mRatBN7.2
mRatBN7.2	8	73,495,102 - 73,495,313 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	67,896,073 - 67,896,282	NCBI	Rnor6.0
Rnor_6.0	8	79,434,689 - 79,434,899	NCBI	Rnor6.0
Rnor_5.0	3	74,452,418 - 74,452,627	UniSTS	Rnor5.0
RGSC_v3.4	3	63,519,302 - 63,519,511	UniSTS	RGSC3.4
RGSC_v3.4	8	77,363,860 - 77,364,070	UniSTS	RGSC3.4
Celera	3	65,030,159 - 65,030,368	UniSTS
Cytogenetic Map	8	q24	UniSTS
Cytogenetic Map	3	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001004229	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC078914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012628 ⟹ ENSRNOP00000012628

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	65,561,586 - 65,585,130 (+)	Ensembl
Rnor_6.0 Ensembl	3	67,870,111 - 67,896,153 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113802 ⟹ ENSRNOP00000095061

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	65,558,968 - 65,585,130 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117333 ⟹ ENSRNOP00000086299

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	65,559,915 - 65,585,130 (+)	Ensembl

RefSeq Acc Id:

NM_001004229 ⟹ NP_001004229

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,965,907 - 85,991,659 (+)	NCBI
mRatBN7.2	3	65,559,010 - 65,584,764 (+)	NCBI
Rnor_6.0	3	67,870,568 - 67,896,460 (+)	NCBI
Rnor_5.0	3	74,423,181 - 74,453,173 (+)	NCBI
RGSC_v3.4	3	63,493,936 - 63,519,689 (+)	RGD
Celera	3	65,005,138 - 65,030,546 (+)	RGD

Sequence:

show sequence

CCTTGCTGGAGTGGTGGCGGCCGTTGCGATGGCAGCGTTTGCGGTGGATCCCCAGGCGCCCACG
CTGGGATCTGAACCGATGATGTTGGGTTCACCTACATCTCCAAAGCCAGGCGCTAATGCCCAGT
TCTTACCTGGATTTTTAATGGGGGACCTACCAGCTCCAGTGACTCCACAACCTCGATCAATTAG
CGGCCCTTCAGTAGGAGTAATGGAAATGAGGTCACCTTTACTTGCAGGGGGCTCACCACCACAG
CCAGTTGTACCTGCTCATAAAGATAAAAGTGGGGCTCCACCTGTTAGAAGTATCTATGATGACA
TTTCCAGCCCAGGACTTGGATCAACACCTCTGCCTTCAAGAAGACAGGCAAACATTTCCGTGTT
GCAGAGTCCTCTTGTTGGAGTTACAACTCCTGTGACTGGGCAAAGCATGTTTAGTCCAGCAAAT
ATTGGTCAACCACGAAAGACGACACTGTCTCCTGCCCAACTGGATCCTTTTTATACTCAAGGAG
ATTCTCTGACTTCAGAAGATCACCTAGATGACACCTGGGTGACTGTGTTTGGGTTTCCACAAGC
ATCTGCTTCTTATATATTATTACAGTTTGCACAATACGGGAATATCTTAAAGCACGTGATGTCT
AACACAGGCAACTGGATGCATATTCGTTACCAGTCTAAACTGCAAGCCCGGAAAGCCTTAAGCA
AAGATGGGAGAATATTTGGAGAATCCATCATGATTGGCGTCAAGCCGTGTATAGATAAAAATGT
CATGGAAAACAGTGACAGAGGAGTCTTGTCATCTCCATCTCTAGCCTTTACACCACCGATTAGG
ACCTTAGGCACTCCAACACAGCCTGGAAGCACTCCTAGGGTTTCTACCATGAGGCCTCTTGCCA
CAGCATACAAGGCCTCCACTAGTGACTATCAGGTTATTTCTGACCGACAAACACCAAAAAAAGA
TGAAAGTCTTGTGTCCAGAGCAATGGAGTACATGTTCGGTTGGTAGTGCAGTGAGAGCTGGACT
GAGCATTAGCAGAGGACTGCCAGTTTCCTTGGGTTAGTTGTATAACCATGTAACCATGCTGGCA
GGGTTGGGTAGCTATCTCAGATACATCTTTACAGTCCTTTGTTTAAGGAGACAGCTCATTTGTA
ACTTGCACTTTAAAAGATGGCCATGATACACCTGAAGAGAAGCCGTCCAGATGGCACTCTGTGC
TCTGTGATACAGTGCATGCTTAGTGCCGTGTCCTCGGCGTCTACTGCGGTAATTAAATGATTGA
GCTTGAAGTGAGTCTCATTGGCTTTCATGGGAAGATGGATGAATTCCACAGAGCAACAGCTGCT
TTACCAAGACACAGTGATTATGATTAGCAGTTTGAATTATGGTCTTAATTTAGATAGTATTTAA
TATCTTTGTATATGTCTTGTGGATTGTCATCTTTTATGTTCTTTTTAAAAACCATCTACCACTA
ATGTTTCCTAATAAACTTTGTCAATTTTTATGTGCTGAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001004229	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78914	(Get FASTA)	NCBI Sequence Viewer
	EDL79286	(Get FASTA)	NCBI Sequence Viewer
	EDL79287	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012628.5
	ENSRNOP00000086299.1
	ENSRNOP00000095061
	ENSRNOP00000095061.1
GenBank Protein	Q68FY1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001004229 ⟸ NM_001004229

- UniProtKB:

Q68FY1 (UniProtKB/Swiss-Prot), A0A8L2Q6A2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAFAVDPQAPTLGSEPMMLGSPTSPKPGANAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEM
RSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLPSRRQANISVLQSPLVGVTT
PVTGQSMFSPANIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDTWVTVFGFPQASASYILLQF
AQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKNVMENSDRGVL
SSPSLAFTPPIRTLGTPTQPGSTPRVSTMRPLATAYKASTSDYQVISDRQTPKKDESLVSRAME
YMFGW

hide sequence

Ensembl Acc Id:

ENSRNOP00000012628 ⟸ ENSRNOT00000012628

Ensembl Acc Id:

ENSRNOP00000086299 ⟸ ENSRNOT00000117333

Ensembl Acc Id:

ENSRNOP00000095061 ⟸ ENSRNOT00000113802

Protein Domains

RRM Nup35-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q68FY1-F1-model_v2	AlphaFold	Q68FY1	1-325	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692174

Promoter ID:

EPDNEW_R2698

Type:

initiation region

Name:

Nup35_1

Description:

nucleoporin 35

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	67,870,553 - 67,870,613	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303069	AgrOrtholog
BioCyc Gene	G2FUF-49221	BioCyc
Ensembl Genes	ENSRNOG00000009290	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000012628.6	UniProtKB/TrEMBL
	ENSRNOT00000113802	ENTREZGENE
	ENSRNOT00000113802.1	UniProtKB/Swiss-Prot
	ENSRNOT00000117333.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.70.330	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7126643	IMAGE-MGC_LOAD
InterPro	Nucleoporin_NUP53	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Nucleotide-bd_a/b_plait_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RBD_domain_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RRM_NUP35_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:295692	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93680	IMAGE-MGC_LOAD
NCBI Gene	295692	ENTREZGENE
PANTHER	NUCLEOPORIN NUP35	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR21527	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Nup35_RRM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Nup35	PhenoGen
PIRSF	Nucleoporin_NUP53	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	RRM_NUP35	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009290	RatGTEx
Superfamily-SCOP	SSF54928	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6A1Y4_RAT	UniProtKB/TrEMBL
	A0A8L2Q6A2	ENTREZGENE, UniProtKB/TrEMBL
	A6HMN5_RAT	UniProtKB/TrEMBL
	A6HMN6_RAT	UniProtKB/TrEMBL
	NUP35_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-11-17	Nup35	nucleoporin 35			Name updated	1299863	APPROVED
2005-02-14	Nup35	mitotic phosphoprotein 44			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)