Chia (chitinase, acidic) - Rat Genome Database

Name: Chia
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Chia (chitinase, acidic) Rattus norvegicus

Analyze

Symbol:

Chia

Name:

chitinase, acidic

RGD ID:

1303058

Description:

Enables chitinase activity. Involved in chitin catabolic process. Located in extracellular region. Biomarker of cryptococcosis and silicosis. Human ortholog(s) of this gene implicated in asthma. Orthologous to human CHIA (chitinase acidic); PARTICIPATES IN amino sugar metabolic pathway; nucleotide sugar metabolic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

acidic mammalian chitinase; AMCase; eosinophil chemotactic cytokine; MGC112572; small acid mammalian chitinase

RGD Orthologs

Human

Mouse

Bonobo

Dog

Squirrel

Pig

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CHIA (chitinase acidic)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Chia1 (chitinase, acidic 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100977638 (chitinase acidic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CHIA (chitinase acidic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Chia (chitinase acidic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CHIA (chitinase acidic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CHI3L1 (chitinase 3 like 1)	HGNC	OrthoDB
Homo sapiens (human):	CHIT1 (chitinase 1)	HGNC	OrthoDB
Homo sapiens (human):	CHI3L2 (chitinase 3 like 2)	HGNC	OrthoDB
Homo sapiens (human):	POLB (DNA polymerase beta)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CHIA (chitinase acidic)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Chia1 (chitinase, acidic 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	chia.3 (chitinase, acidic.3)	Alliance	DIOPT (InParanoid\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	chia.6 (chitinase, acidic.6)	Alliance	DIOPT (InParanoid\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	chia.2 (chitinase, acidic.2)	Alliance	DIOPT (InParanoid\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	chia.4 (chitinase, acidic.4)	Alliance	DIOPT (InParanoid\|OrthoInspector\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CTS2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Cht7	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cht-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Cht4	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Cht8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Cht12	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Cht2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Cht5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Cht9	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Cht10	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	chia	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	XB5763442 [provisional:chia]	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	193,614,374 - 193,656,532 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	193,614,114 - 193,656,533 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	201,208,839 - 201,251,864 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	199,099,942 - 199,127,223 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	193,916,914 - 193,944,195 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	208,750,348 - 208,797,388 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	208,749,996 - 208,797,402 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	228,203,126 - 228,221,354 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	2	228,174,304 - 228,176,046 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	201,385,584 - 201,431,777 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	201,348,343 - 201,394,531 (+)	NCBI
Celera	2	186,305,695 - 186,342,272 (+)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

asthma (ISO)

autistic disorder (ISO)

cryptococcosis (IEP)

genetic disease (ISO)

Inflammation (ISO)

Nasal Polyps (ISO)

Perennial Allergic Rhinitis (ISO)

silicosis (IEP)

sinusitis (ISO)

Spontaneous Abortions (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP)

buta-1,3-diene (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chrysene (ISO)

Cuprizon (EXP)

diarsenic trioxide (ISO)

Diisodecyl phthalate (ISO)

dioxygen (ISO)

emodin (ISO)

genistein (ISO)

metacetamol (ISO)

ozone (ISO)

paracetamol (ISO)

quartz (EXP)

sulforaphane (ISO)

testosterone (ISO)

tetraphene (ISO)

titanium dioxide (EXP,ISO)

tremolite asbestos (ISO)

trimellitic anhydride (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

carbohydrate metabolic process (IEA)

chitin catabolic process (IBA,IDA,IEA,ISO,ISS)

immune system process (IEA)

polysaccharide catabolic process (IEA)

positive regulation of chemokine production (ISO,ISS)

production of molecular mediator involved in inflammatory response (ISO,ISS)

Cellular Component

cytoplasm (IEA,ISO,ISS)

extracellular region (IBA,IDA,IEA)

extracellular space (ISO,ISS)

membrane (IEA)

Molecular Function

chitin binding (IBA,IEA,ISO)

chitinase activity (IBA,IDA,IEA,ISO,ISS)

kinase binding (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

amino sugar metabolic pathway (IEA)

nucleotide sugar metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Polymorphisms and haplotypes of acid mammalian chitinase are associated with bronchial asthma.	Bierbaum S, etal., Am J Respir Crit Care Med. 2005 Dec 15;172(12):1505-9. Epub 2005 Sep 22.
2.	Identification of a novel acidic mammalian chitinase distinct from chitotriosidase.	Boot RG, etal., J Biol Chem. 2001 Mar 2;276(9):6770-8. Epub 2000 Nov 20.
3.	Cloning of a rat lung fibrogenic factor.	Chen XH, etal., Gene. 2006 Dec 15;384:9-17. Epub 2006 Jul 29.
4.	Increased expression of acidic mammalian chitinase and chitotriosidase in the nasal mucosa of patients with allergic rhinitis.	Cho WS, etal., Laryngoscope. 2010 May;120(5):870-5.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Identification of differentially expressed genes in rat silicosis model by suppression subtractive hybridization analysis.	Jin Z, etal., Acta Biochim Biophys Sin (Shanghai). 2008 Aug;40(8):740-6.
7.	Chitin stimulates expression of acidic mammalian chitinase and eotaxin-3 by human sinonasal epithelial cells in vitro.	Lalaker A, etal., Am J Rhinol Allergy. 2009 Jan-Feb;23(1):8-14.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	Increased expression of acidic mammalian chitinase in chronic rhinosinusitis with nasal polyps.	Ramanathan M Jr, etal., Am J Rhinol. 2006 May-Jun;20(3):330-5.
11.	Chitin induces accumulation in tissue of innate immune cells associated with allergy.	Reese TA, etal., Nature. 2007 May 3;447(7140):92-6. Epub 2007 Apr 22.
12.	GOA pipeline	RGD automated data pipeline
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Pulmonary cryptococcosis induces chitinase in the rat.	Vicencio AG, etal., Respir Res. 2008 May 15;9:40.
15.	Polymorphisms of chitinases are not associated with asthma.	Wu AC, etal., J Allergy Clin Immunol. 2010 Mar;125(3):754-7, 757.e1-757.e2.
16.	Inhibition of acidic mammalian chitinase by RNA interference suppresses ovalbumin-sensitized allergic asthma.	Yang CJ, etal., Hum Gene Ther. 2009 Dec;20(12):1597-606.
17.	Acidic mammalian chitinase in asthmatic Th2 inflammation and IL-13 pathway activation.	Zhu Z, etal., Science. 2004 Jun 11;304(5677):1678-82.
18.	Transcript signatures in experimental asthma: identification of STAT6-dependent and -independent pathways.	Zimmermann N, etal., J Immunol. 2004 Feb 1;172(3):1815-24.

Additional References at PubMed

PMID:12477932	PMID:18824549	PMID:19435888	PMID:24155872

Genomics

Comparative Map Data

Chia
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	193,614,374 - 193,656,532 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	193,614,114 - 193,656,533 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	201,208,839 - 201,251,864 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	199,099,942 - 199,127,223 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	193,916,914 - 193,944,195 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	208,750,348 - 208,797,388 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	208,749,996 - 208,797,402 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	228,203,126 - 228,221,354 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	2	228,174,304 - 228,176,046 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	201,385,584 - 201,431,777 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	201,348,343 - 201,394,531 (+)	NCBI
Celera	2	186,305,695 - 186,342,272 (+)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

CHIA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	111,290,851 - 111,320,563 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	111,290,851 - 111,320,566 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	111,833,473 - 111,863,185 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	111,635,007 - 111,664,708 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	110,080,467 - 110,110,137 (+)	NCBI		Celera
Cytogenetic Map	1	p13.2	NCBI
HuRef	1	109,704,997 - 109,734,617 (+)	NCBI		HuRef
CHM1_1	1	111,948,560 - 111,978,245 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	111,305,627 - 111,335,252 (+)	NCBI		T2T-CHM13v2.0

Chia1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	106,020,698 - 106,039,434 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	106,020,545 - 106,039,436 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	106,113,382 - 106,132,118 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	106,113,229 - 106,132,120 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	105,916,300 - 105,935,036 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	106,241,438 - 106,260,174 (+)	NCBI		MGSCv36	mm8
Celera	3	108,305,877 - 108,324,340 (+)	NCBI		Celera
Cytogenetic Map	3	F2.2	NCBI

LOC100977638
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	114,872,554 - 114,902,094 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	113,935,888 - 113,965,541 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	126,381,724 - 126,411,365 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	126,381,724 - 126,391,909 (-)	Ensembl	panpan1.1		panPan2

CHIA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	40,754,906 - 40,766,779 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	40,754,993 - 40,766,891 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	43,532,998 - 43,544,872 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	41,086,947 - 41,098,823 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	41,087,036 - 41,098,641 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	40,808,020 - 40,819,890 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	40,778,134 - 40,789,997 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	41,213,439 - 41,225,313 (-)	NCBI		UU_Cfam_GSD_1.0

Chia
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	17,495,274 - 17,507,271 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004939091	1,190 - 12,272 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004939091	1,194 - 12,273 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CHIA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	109,035,326 - 109,046,499 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	109,035,323 - 109,046,499 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	119,410,881 - 119,422,056 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Variants

Variants in Chia
284 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	15
Count of miRNA genes:	15
Interacting mature miRNAs:	15
Transcripts:	ENSRNOT00000041562
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	184114274	202447032	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	185876309	219753474	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	185876309	219753474	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	189599258	218414891	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	189599258	226936289	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	190613715	226808892	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat

Markers in Region

BI288346

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	193,656,272 - 193,656,484 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	208,797,129 - 208,797,340	NCBI	Rnor6.0
Rnor_5.0	2	228,221,095 - 228,221,306	UniSTS	Rnor5.0
RGSC_v3.4	2	201,431,519 - 201,431,730	UniSTS	RGSC3.4
Celera	2	186,342,013 - 186,342,224	UniSTS
RH 3.4 Map	2	1369.2	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	reproductive system	respiratory system	appendage
High
Medium	4								4	11
Low		6		6				10	5
Below cutoff		6	2	4	2	5	6	50	14		5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_207586	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY486074	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000077	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KC529649	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000041562 ⟹ ENSRNOP00000044947

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	193,614,374 - 193,656,533 (+)	Ensembl
Rnor_6.0 Ensembl	2	208,750,356 - 208,797,388 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000086321 ⟹ ENSRNOP00000073705

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	193,614,114 - 193,656,533 (+)	Ensembl
Rnor_6.0 Ensembl	2	208,749,996 - 208,797,402 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000100196 ⟹ ENSRNOP00000077248

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	193,615,370 - 193,656,533 (+)	Ensembl

RefSeq Acc Id:

NM_207586 ⟹ NP_997469

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	193,614,374 - 193,656,532 (+)	NCBI
Rnor_6.0	2	208,750,348 - 208,797,388 (+)	NCBI
Rnor_5.0	2	228,174,304 - 228,176,046 (+)	NCBI
Rnor_5.0	2	228,203,126 - 228,221,354 (+)	NCBI
RGSC_v3.4	2	201,385,584 - 201,431,777 (+)	RGD
Celera	2	186,305,695 - 186,342,272 (+)	NCBI

Sequence:

show sequence

GCGGGGGCAGTACTGAAGACAACATGGCCAAGCTCATTCTTGTCACAGGTCTGGTTCTTCTGCT
GAATGTTCAGCTGGGGTCTGCCTACAATCTGGTATGCTACTTCACCAACTGGGCCCAGTATCGG
CCAGGCCTGGGGAGTTTCAAGCCTGATGACATTAATCCCTGCCTGTGTACTCACCTGATCTATG
CCTTTGCTGGGATGCAGAACAATCAAATCACCACCATAGAATGGAATGATGTTACTCTCTATAA
AGCTTTCAATGACTTGAAAAACAGGAACAGCAAACTGAAAACTCTCCTGGCAATTGGAGGTTGG
AACTTTGGAACTGCTCCTTTCACCACCATGGTTTCCACTTCTCAGAACCGCCAGACCTTTATTA
CCTCAGTCATCAAATTCCTGCGACAGTATGGGTTTGATGGACTGGACCTGGACTGGGAATACCC
AGGTTCACGTGGGAGCCCTCCTCAGGACAAGCATCTCTTCACTGTCCTGGTGAAGGAACTACGT
GAAGCTTTTGAGCAGGAGGCTATTGAGAGCAACAGGCCCAGATTGATGGTTACTGCTGCTGTAG
CTGCTGGCATTTCCAACATCCAGGCTGGCTACGAGATCCCTGAACTTTCTCAGTACCTGGATTT
CATCCACGTCATGACATATGACCTCCATGGCTCCTGGGATGGCTACACTGGGGAGAACAGTCCT
CTTTACAAACTCCCTACTGAGACTGGCAGCAATGCCTACCTCAATGTGGATTATGTCATGAATT
ACTGGAAGGATAATGGAGCCCCAGCTGAGAAGCTCATTGTTGGATTTCCAGAGTATGGACACAC
CTACATCCTAAGCAACCCTTCTGATACTGGAATTGGTGCCCCTACCTCTGGTAATGGCCCTGCT
GGGCCCTATACCAGGCAGGCTGGGTTCTGGGCCTACTATGAGATTTGTACCTTTCTGAGAAATG
GAGCCACTCAGGACTGGGATGCCCCCCAGGAAGTTCCCTATGCCTACAAGGGCAATGAGTGGGT
TGGCTATGATAATATCAAGAGCTTCAGTGTCAAGGCTCAGTGGCTTAAGCAGAACAACTTTGGT
GGTGCCATGATCTGGGCCATTGACCTTGATGACTTCACTGGCTCTTTCTGTGACCAGGGAAAAT
TCCCTCTGACTTCTACTTTGAATAAAGCCCTTGATATACCCACAGCAGGTTGCACAGCCCCTGA
CTTACCTTCTGAACCAGTAACTACTCCTCCAGGAAGTGGGAGTGGTGGTGGAAGCTCTGGTGGA
GGTTCTGAAGGCAGTGGATTCTGTGCTGGCAAAGCAGATGGCCTCTACCCTGTGGCAGATGACA
GAAATGCTTTCTGGCACTGCATCAATGGAATCACATATCAGCAGCATTGTCAGGCAGGGTTAGT
TTTTGATACCAGCTGTAATTGCTGCAACTGGCCATGAAACTAATGTTCTTCACGAAATTTCTGC
CTTCTCCCTTAATCCTCACCAAAGGTAGCTTGCTTCCATTTAAAGTTATGCAATAAAATTGATA
GC

hide sequence

Protein Sequences


Protein RefSeqs	NP_997469	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98642	(Get FASTA)	NCBI Sequence Viewer
	AAR28968	(Get FASTA)	NCBI Sequence Viewer
	AGK24663	(Get FASTA)	NCBI Sequence Viewer
	Q6RY07	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_997469 ⟸ NM_207586
- Peptide Label:	precursor
- UniProtKB:	Q6RY07 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAKLILVTGLVLLLNVQLGSAYNLVCYFTNWAQYRPGLGSFKPDDINPCLCTHLIYAFAGMQNN QITTIEWNDVTLYKAFNDLKNRNSKLKTLLAIGGWNFGTAPFTTMVSTSQNRQTFITSVIKFLR QYGFDGLDLDWEYPGSRGSPPQDKHLFTVLVKELREAFEQEAIESNRPRLMVTAAVAAGISNIQ AGYEIPELSQYLDFIHVMTYDLHGSWDGYTGENSPLYKLPTETGSNAYLNVDYVMNYWKDNGAP AEKLIVGFPEYGHTYILSNPSDTGIGAPTSGNGPAGPYTRQAGFWAYYEICTFLRNGATQDWDA PQEVPYAYKGNEWVGYDNIKSFSVKAQWLKQNNFGGAMIWAIDLDDFTGSFCDQGKFPLTSTLN KALDIPTAGCTAPDLPSEPVTTPPGSGSGGGSSGGGSEGSGFCAGKADGLYPVADDRNAFWHCI NGITYQQHCQAGLVFDTSCNCCNWP hide sequence

RefSeq Acc Id:

ENSRNOP00000044947 ⟸ ENSRNOT00000041562

RefSeq Acc Id:

ENSRNOP00000073705 ⟸ ENSRNOT00000086321

RefSeq Acc Id:

ENSRNOP00000077248 ⟸ ENSRNOT00000100196

Protein Domains

Chitin-binding type-2 GH18

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6RY07-F1-model_v2	AlphaFold	Q6RY07	1-473	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691661

Promoter ID:

EPDNEW_R2176

Type:

single initiation site

Name:

Chia_1

Description:

chitinase, acidic

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	208,750,356 - 208,750,416	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303058	AgrOrtholog
BioCyc Gene	G2FUF-51711	BioCyc
Ensembl Genes	ENSRNOG00000033162	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000044947.5	UniProtKB/TrEMBL
	ENSRNOP00000073705	ENTREZGENE
	ENSRNOP00000073705.2	UniProtKB/TrEMBL
	ENSRNOP00000077248.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000041562.5	UniProtKB/TrEMBL
	ENSRNOT00000086321	ENTREZGENE
	ENSRNOT00000086321.2	UniProtKB/TrEMBL
	ENSRNOT00000100196.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1250.10	UniProtKB/TrEMBL
	3.10.50.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Chitin binding domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glycosidases	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7100637	IMAGE-MGC_LOAD
InterPro	4_helix_cytokine-like_core	UniProtKB/TrEMBL
	Chitin-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Chitin-bd_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Chitinase_II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Chitinase_insertion_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyco_hydro18_cat	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyco_hydro_18_chit_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glycoside_hydrolase_SF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GM_colony-stim-fac	UniProtKB/TrEMBL
KEGG Report	rno:113901	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112572	IMAGE-MGC_LOAD
NCBI Gene	113901	ENTREZGENE
PANTHER	ACIDIC MAMMALIAN CHITINASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CHITINASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GRANULOCYTE-MACROPHAGE COLONY-STIMULATING FACTOR	UniProtKB/TrEMBL
	PTHR10059	UniProtKB/TrEMBL
Pfam	CBM_14	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyco_hydro_18	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GM_CSF	UniProtKB/TrEMBL
PhenoGen	Chia	PhenoGen
PRINTS	GMCSFACTOR	UniProtKB/TrEMBL
PROSITE	CHIT_BIND_II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CHITINASE_18	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GH18_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GM_CSF	UniProtKB/TrEMBL
SMART	ChtBD2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CSF2	UniProtKB/TrEMBL
	Glyco_18	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47266	UniProtKB/TrEMBL
	SSF51445	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF54556	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF57625	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K676_RAT	UniProtKB/TrEMBL
	A0A8I5Y1C5_RAT	UniProtKB/TrEMBL
	CHIA_RAT	UniProtKB/Swiss-Prot
	F1LPK5_RAT	UniProtKB/TrEMBL
	Q4G094_RAT	UniProtKB/TrEMBL
	Q6RY07	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Chia	chitinase, acidic			Symbol and Name status set to approved	1299863	APPROVED
2005-09-30	Chia				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)