EDN1 (endothelin 1) - Rat Genome Database

Name: EDN1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: EDN1 (endothelin 1) Canis lupus familiaris

Analyze

Symbol:

EDN1

Name:

endothelin 1

RGD ID:

12377803

Description:

ENCODES a protein that exhibits endothelin A receptor binding (ortholog); endothelin B receptor binding (ortholog); INVOLVED IN adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (ortholog); artery smooth muscle contraction (ortholog); blood vessel morphogenesis (ortholog); PARTICIPATES IN endothelin signaling pathway; hypoxia inducible factor pathway; inflammatory response pathway; ASSOCIATED WITH acute kidney failure (ortholog); Acute Lung Injury (ortholog); adult respiratory distress syndrome (ortholog); FOUND IN basal part of cell (ortholog); extracellular space (ortholog); rough endoplasmic reticulum lumen (ortholog); INTERACTS WITH fenfluramine; lead(II) chloride; serotonin

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

endothelin-1; ET-1; gene for endothelin; PPET1; preproendothelin-1

RGD Orthologs

Human

Mouse

Rat

Chinchilla

Bonobo

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EDN1 (endothelin 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Edn1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Edn1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Edn1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EDN1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Edn1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EDN1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EDN1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Edn1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

CanFam3.1 - Dog CanFam3.1 Assembly

Position:

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	11,808,892 - 11,815,383 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	11,808,892 - 11,815,383 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	11,760,401 - 11,766,891 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	11,907,692 - 11,914,182 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	11,907,494 - 11,914,179 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	11,736,723 - 11,743,212 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	11,786,346 - 11,792,841 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	13,110,983 - 13,117,475 (+)	NCBI		UU_Cfam_GSD_1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute kidney failure (ISO)

Acute Lung Injury (ISO)

adult respiratory distress syndrome (ISO)

Albuminuria (ISO)

angle-closure glaucoma (ISO)

anterolateral myocardial infarction (ISO)

aspiration pneumonia (ISO)

asthma (ISO)

atherosclerosis (ISO)

atrial fibrillation (ISO)

Auriculocondylar Syndrome (ISO)

Auriculocondylar Syndrome 3 (ISO)

autosomal dominant polycystic kidney disease (ISO)

Behcet's disease (ISO)

Bradycardia (ISO)

brain ischemia (ISO)

bronchiolitis obliterans (ISO)

bronchopulmonary dysplasia (ISO)

Cardiac Arrhythmias (ISO)

Cardiac Fibrosis (ISO)

Cardiomegaly (ISO)

cardiomyopathy (ISO)

Cardiovascular Abnormalities (ISO)

cardiovascular system disease (ISO)

cartilage disease (ISO)

cerebrovascular disease (ISO)

Chronic Bronchitis (ISO)

chronic obstructive pulmonary disease (ISO)

chronic rhinitis (ISO)

Chronic Tubulointerstitial Nephropathy (ISO)

congenital heart disease (ISO)

congestive heart failure (ISO)

coronary artery disease (ISO)

coronary stenosis (ISO)

Craniofacial Abnormalities (ISO)

cystic fibrosis (ISO)

Diabetic Nephropathies (ISO)

diabetic retinopathy (ISO)

Diaphragmatic Hernia (ISO)

dilated cardiomyopathy (ISO)

Dyspnea (ISO)

end stage renal disease (ISO)

Endotoxemia (ISO)

exfoliation syndrome (ISO)

Experimental Arthritis (ISO)

Experimental Diabetes Mellitus (ISO)

Experimental Liver Cirrhosis (ISO)

focal segmental glomerulosclerosis (ISO)

gastrointestinal system disease (ISO)

genetic disease (ISO)

heart disease (ISO)

hepatopulmonary syndrome (ISO)

hepatorenal syndrome (ISO)

Hyperalgesia (ISO)

Hypercapnia (ISO)

Hypercholesterolemia (ISO)

Hyperoxia (ISO)

hypertension (ISO)

hypertrophic cardiomyopathy (ISO)

Hypertrophy (ISO)

hypogonadism (ISO)

Hypotension (ISO)

impotence (ISO)

Inflammation (ISO)

intermediate coronary syndrome (ISO)

intracranial aneurysm (ISO)

kidney disease (ISO)

kidney failure (ISO)

Left Ventricular Hypertrophy (ISO)

Lewy body dementia (ISO)

liver cirrhosis (ISO)

low tension glaucoma (ISO)

major depressive disorder (ISO)

membranoproliferative glomerulonephritis (ISO)

metabolic acidosis (ISO)

middle cerebral artery infarction (ISO)

multiple sclerosis (ISO)

myocardial infarction (ISO)

Myocardial Ischemia (ISO)

Myocardial Reperfusion Injury (ISO)

Neoplasm Metastasis (ISO)

Neoplastic Cell Transformation (ISO)

neovascular glaucoma (ISO)

neovascular inflammatory vitreoretinopathy (ISO)

nephritis (ISO)

nephrosis (ISO)

nephrotic syndrome (ISO)

obesity (ISO)

obstructive sleep apnea (ISO)

optic nerve disease (ISO)

Optic Nerve Injuries (ISO)

Oral Ulcer (ISO)

ovarian carcinoma (ISO)

overactive bladder syndrome (ISO)

Pain (ISO)

Parkinson's disease (ISO)

peptic ulcer disease (ISO)

pneumonia (ISO)

Pneumoperitoneum (ISO)

portal hypertension (ISO)

pre-eclampsia (ISO)

Pregnancy-Induced Hypertension (ISO)

Premature Birth (ISO)

Presbycusis (ISO)

primary open angle glaucoma (ISO)

pulmonary embolism (ISO)

pulmonary fibrosis (ISO)

pulmonary hypertension (ISO)

Question Mark Ears, Isolated (ISO)

renal artery disease (ISO)

Reperfusion Injury (ISO)

retinal degeneration (ISO)

retinal detachment (ISO)

retinitis pigmentosa (ISO)

rheumatoid arthritis (ISO)

Sepsis (ISO)

Slow Coronary Flow (ISO)

Stroke (ISO)

Subarachnoid Hemorrhage (ISO)

systemic scleroderma (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (ISO)

uremia (ISO)

ureteral obstruction (ISO)

Urinary Retention (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

fenfluramine (EXP)

lead(II) chloride (EXP)

serotonin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (IEA,ISO)

artery smooth muscle contraction (IEA,ISO)

axon extension (IEA)

axonogenesis involved in innervation (IEA)

blood vessel diameter maintenance (IEA)

blood vessel morphogenesis (IEA,ISO)

body fluid secretion (IEA,ISO)

branching involved in blood vessel morphogenesis (IEA,ISO)

calcium ion transmembrane transport (IEA)

calcium-mediated signaling (IEA)

canonical Wnt signaling pathway (IEA)

cardiac neural crest cell migration involved in outflow tract morphogenesis (IEA)

cartilage development (IEA,ISO)

cell surface receptor signaling pathway (IEA)

cell-cell signaling (IEA)

cellular response to calcium ion (ISO)

cellular response to fatty acid (ISO)

cellular response to follicle-stimulating hormone stimulus (IEA)

cellular response to glucocorticoid stimulus (ISO)

cellular response to human chorionic gonadotropin stimulus (IEA)

cellular response to hydrogen peroxide (IEA)

cellular response to hypoxia (ISO)

cellular response to interleukin-1 (ISO)

cellular response to luteinizing hormone stimulus (IEA)

cellular response to mineralocorticoid stimulus (ISO)

cellular response to organic substance (IEA)

cellular response to peptide hormone stimulus (ISO)

cellular response to transforming growth factor beta stimulus (ISO)

cellular response to tumor necrosis factor (ISO)

cellular response to type II interferon (ISO)

cellular response to xenobiotic stimulus (ISO)

dorsal/ventral pattern formation (IEA,ISO)

embryonic heart tube development (IEA)

endothelin receptor signaling pathway (IEA,ISS)

endothelin receptor signaling pathway involved in heart process (IEA)

epithelial fluid transport (ISO)

ERK1 and ERK2 cascade (IEA)

G protein-coupled receptor signaling pathway (IEA)

gene expression (IEA)

heart development (IEA,ISO)

histamine secretion (ISO)

I-kappaB kinase/NF-kappaB signaling (IEA)

in utero embryonic development (IEA,ISO)

inositol phosphate-mediated signaling (IEA)

intracellular calcium ion homeostasis (IBA,IEA)

intracellular signal transduction (ISO)

MAPK cascade (IEA)

maternal process involved in parturition (ISO)

meiotic cell cycle process involved in oocyte maturation (IEA)

membrane depolarization (ISO)

middle ear morphogenesis (IEA,ISO)

mitochondrion organization (IEA)

negative regulation of gene expression (ISO)

negative regulation of hormone secretion (ISO)

negative regulation of nitric-oxide synthase biosynthetic process (IEA)

negative regulation of protein metabolic process (IEA)

negative regulation of smooth muscle cell apoptotic process (ISO)

negative regulation of transcription by RNA polymerase II (IEA)

neural crest cell development (IEA,ISO)

neural crest cell differentiation (IEA)

neural crest cell fate commitment (IEA)

neuron projection development (IEA)

neutrophil chemotaxis (ISO)

nitric oxide transport (IEA)

noradrenergic neuron differentiation (IEA)

peptide hormone secretion (IEA)

pharyngeal arch artery morphogenesis (IEA)

phosphatidylinositol 3-kinase signaling (IEA)

phospholipase D-activating G protein-coupled receptor signaling pathway (IEA,ISO)

positive regulation of cardiac muscle hypertrophy (IEA)

positive regulation of cation channel activity (IEA)

positive regulation of cell growth involved in cardiac muscle cell development (IEA)

positive regulation of cell migration (IEA)

positive regulation of cell population proliferation (IEA,ISO)

positive regulation of cell size (IEA)

positive regulation of chemokine-mediated signaling pathway (IEA,ISO)

positive regulation of cytosolic calcium ion concentration (IEA,ISO)

positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway (IEA,ISO)

positive regulation of DNA-binding transcription factor activity (IEA)

positive regulation of heart rate (IEA)

positive regulation of hormone secretion (IEA)

positive regulation of JUN kinase activity (IEA)

positive regulation of MAP kinase activity (IEA)

positive regulation of mitotic nuclear division (IEA)

positive regulation of neutrophil chemotaxis (ISO)

positive regulation of NIK/NF-kappaB signaling (ISO)

positive regulation of odontogenesis (ISO)

positive regulation of prostaglandin secretion (ISO)

positive regulation of prostaglandin-endoperoxide synthase activity (IBA,IEA)

positive regulation of renal sodium excretion (IEA,ISO)

positive regulation of sarcomere organization (IEA)

positive regulation of signaling receptor activity (IEA,ISO)

positive regulation of smooth muscle cell proliferation (IEA)

positive regulation of smooth muscle contraction (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

positive regulation of urine volume (IEA,ISO)

positive regulation of vascular associated smooth muscle cell proliferation (ISO)

prostaglandin biosynthetic process (IEA)

protein kinase A signaling (IEA)

protein kinase C deactivation (IEA)

protein kinase C-activating G protein-coupled receptor signaling pathway (IEA,ISO)

protein phosphorylation (IEA)

regulation of blood pressure (IEA,ISO)

regulation of glucose transmembrane transport (IEA,ISO)

regulation of pH (IEA,ISO)

regulation of systemic arterial blood pressure by endothelin (IBA,IEA)

regulation of vasoconstriction (IEA)

renal sodium ion absorption (IEA)

respiratory gaseous exchange by respiratory system (IEA,ISO)

response to activity (ISO)

response to amino acid (ISO)

response to amphetamine (IEA)

response to dexamethasone (ISO)

response to hypoxia (IEA,ISO)

response to leptin (ISO)

response to lipopolysaccharide (ISO)

response to muscle stretch (ISO)

response to nicotine (ISO)

response to ozone (ISO)

response to prostaglandin F (ISO)

response to salt (ISO)

response to testosterone (ISO)

response to transforming growth factor beta (ISO)

response to xenobiotic stimulus (ISO)

rhythmic excitation (IEA,ISO)

semaphorin-plexin signaling pathway involved in axon guidance (IEA)

skeletal system development (IEA,ISO)

smooth muscle contraction (IEA,ISO)

superoxide anion generation (ISO)

sympathetic neuron axon guidance (IEA)

thyroid gland development (IEA)

transcription by RNA polymerase II (IEA)

vasoconstriction (IEA,ISO)

vein smooth muscle contraction (IBA,IEA)

Cellular Component

basal part of cell (ISO)

cytoplasm (IEA)

extracellular region (IEA)

extracellular space (IBA,IEA,ISO)

rough endoplasmic reticulum lumen (ISO)

Weibel-Palade body (ISO)

Molecular Function

cytokine activity (IEA)

endothelin A receptor binding (IBA,IEA,ISO)

endothelin B receptor binding (IBA,IEA,ISO)

hormone activity (IBA,IEA)

protein binding (ISO)

signaling receptor binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

endothelin signaling pathway (ISO)

hypoxia inducible factor pathway (ISO)

inflammatory response pathway (ISO)

References

Additional References at PubMed

PMID:2657658	PMID:15838277	PMID:15838278	PMID:15838286	PMID:15838288	PMID:15838324	PMID:16327228	PMID:16627363	PMID:16951040	PMID:17338155	PMID:17993509	PMID:18788466
PMID:19585255	PMID:20207425	PMID:20210880	PMID:20497708	PMID:24447631	PMID:24496516	PMID:25816929	PMID:25920760	PMID:26426813

Genomics

Comparative Map Data

EDN1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	11,808,892 - 11,815,383 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	11,808,892 - 11,815,383 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	11,760,401 - 11,766,891 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	11,907,692 - 11,914,182 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	11,907,494 - 11,914,179 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	11,736,723 - 11,743,212 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	11,786,346 - 11,792,841 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	13,110,983 - 13,117,475 (+)	NCBI		UU_Cfam_GSD_1.0

EDN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	12,230,516 - 12,297,194 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	6	12,290,361 - 12,297,194 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	12,290,594 - 12,297,427 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	12,398,515 - 12,405,413 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	12,398,644 - 12,404,761	NCBI
Celera	6	13,518,582 - 13,525,484 (+)	NCBI		Celera
Cytogenetic Map	6	p24.1	NCBI
HuRef	6	12,222,160 - 12,229,052 (+)	NCBI		HuRef
CHM1_1	6	12,292,671 - 12,299,570 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	12,098,871 - 12,165,580 (+)	NCBI		T2T-CHM13v2.0

Edn1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	42,454,952 - 42,461,466 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	42,454,952 - 42,461,466 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	42,301,476 - 42,307,990 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	42,301,476 - 42,307,990 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	42,396,639 - 42,403,358 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	42,312,448 - 42,318,962 (+)	NCBI		MGSCv36	mm8
Celera	13	43,379,939 - 43,386,658 (+)	NCBI		Celera
Cytogenetic Map	13	A4	NCBI
cM Map	13	20.82	NCBI

Edn1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	22,454,924 - 22,460,812 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	22,454,420 - 22,460,885 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	22,330,779 - 22,336,694 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	17	23,934,458 - 23,940,375 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	17	22,266,095 - 22,271,993 (-)	NCBI	Rnor_WKY
Rnor_6.0	17	22,136,814 - 22,143,745 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	22,137,324 - 22,143,324 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	24,117,499 - 24,124,188 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	28,303,886 - 28,309,775 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	28,306,726 - 28,312,616 (-)	NCBI
Celera	17	22,134,975 - 22,140,901 (-)	NCBI		Celera
Cytogenetic Map	17	p13	NCBI

Edn1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955465	2,287,798 - 2,314,753 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955465	2,287,906 - 2,314,945 (-)	NCBI	ChiLan1.0	ChiLan1.0

EDN1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	22,843,513 - 22,941,706 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	12,076,312 - 12,142,861 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	12,405,538 - 12,503,545 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	12,462,718 - 12,503,545 (+)	Ensembl	panpan1.1		panPan2

Edn1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	12,616,525 - 12,623,475 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936534	885,287 - 891,772 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936534	885,489 - 892,292 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EDN1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	8,751,695 - 8,758,348 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	8,752,018 - 8,758,354 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	9,120,519 - 9,159,252 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	7	p1.3-p1.2	NCBI

EDN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	59,854,186 - 59,861,319 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	59,853,699 - 59,861,198 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	12,341,006 - 12,348,096 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Edn1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624756	13,842,164 - 13,849,029 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624756	13,842,482 - 13,849,003 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in EDN1
121 total Variants

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	reproductive system	respiratory system	adipose tissue
High
Medium							3				5	3
Low	5	3	12	4	5	4	3	4	7		5	3
Below cutoff		2	10	2	1	2		2	5	8

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001002956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AAEX04000035	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB115087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF333433	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAHUQ010000349	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAQRD010000081	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAUVH010000369	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	REHQ01000035	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X14610	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSCAFT00000015551 ⟹ ENSCAFP00000014389

RefSeq Status:

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1 Ensembl	35	11,808,892 - 11,815,383 (+)	Ensembl

RefSeq Acc Id:

ENSCAFT00845037679 ⟹ ENSCAFP00845029523

RefSeq Status:

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
ROS_Cfam_1.0 Ensembl	35	11,907,494 - 11,914,179 (+)	Ensembl

RefSeq Acc Id:

NM_001002956 ⟹ NP_001002956

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1	35	11,808,892 - 11,815,383 (+)	NCBI
Dog10K_Boxer_Tasha	35	11,760,401 - 11,766,891 (+)	NCBI
ROS_Cfam_1.0	35	11,907,692 - 11,914,182 (+)	NCBI
UMICH_Zoey_3.1	35	11,736,723 - 11,743,212 (+)	NCBI
UNSW_CanFamBas_1.0	35	11,786,346 - 11,792,841 (+)	NCBI
UU_Cfam_GSD_1.0	35	13,110,983 - 13,117,475 (+)	NCBI

Sequence:

show sequence

GCAAGGCTCACTCGATCTGAACAACCAGAAGCTATTATTATTTTATTTTTTATTTTTTATTTTT
TCGTTTTCAACCTTTTAGGTTCGGTTGGCAGGAGAGGACTTTGATCCATCCCCACTCCTCTCTT
TCTCTCTCTGTCACTCTCTCTCTCTTTTTTTTTTTTCTCCAAAATGGATTATTTCCCCATGATT
TTTTCTCTGCTGTTTGTGGCTTTCCAAGGAGCTCCAGAAGCAGCGGTCCTGGGTGCGGAGCTCA
GCACAGGCCCGGACAGCAGGGGGGAGAAGCCTGCTCCCAGTGCACCCTGGCGGCCCCGCCGATC
CAAGCGCTGCTCCTGCTCTTCCCTGATGGATAAAGAGTGTGTCTACTTCTGCCACCTTGACATC
ATCTGGGTCAACACTCCTGAGCACATTGTTCCGTATGGACTTGGAAGCCCTTCTAGGTCTAAGC
GATCTTTAAAGGATTTATTTATCACAAAGGCAACAGACCACAGGAAGAGATGCCAGTGTGCTAG
CCAAAAAGACAAGAAGTGCTGGACTTTTTGCCAAGCGGGAAAAGAACTCAGGGAGCAAGACAGT
ATGGAGAAGGGCTGGAATGGCCATAAGAAAGGAAAAGACTGTTCTGAGCTTGGAGAAAAGTCCA
AGCAGCAGCAGCTGGTGGCAGGAAGAAAAATAAGAAGGTTGGACGCCATCAGCAACAGCATCAA
AACAGCTTTCCGTGTTGCAAAGCTGAAAGCAGAGCTCTACAGAGAGAACAAAGTGACCCATAAT
CGAACACACTGATGACTGGTCACCTTGACTGGGCCTGTGGCCCGCAAGCCTTCTCCTCTGTGGA
GGGAACCCTGCAGCTAATTCTGCACTCTCTCCCCATGGCTGAGATCAGAGCAAAAGCATCCTCC
CTGCTTAGACTGTTTCTTGTTCCAGACTGGCAACGGGCCAGTGCCCTTGCTCTAAACATTCCAG
GGAAGGTTAAGGAGTCCCCCAATCCATCTTCATTTGCTTCCATCAATGATAACTGCTTTAGTCT
CTCCTCGCTTGGGGTGACAATGGACCACTTGGAAAGCAGAGAGACACAGTGACTTGTGAATTAG
GATGTCATCCTCTGGGGGAGAAGAGATTCCACACAGGGTGGAATTTCTGAAGAGAGTCCGAAGG
GAGTGTTTGTGTCTCACTCAGGTGCCTGGCACATTTCAGGGAGAAACTCCAAAGTCCACGCAAA
GGTTTTCTAAGGAATGCACGAATTGAAAACACATTCGAAGGACATTCAAGTAAAAAAAAAAAAA
AAAAAGTAAAAGACTTTTTTTTTTTTAATTCACAAAATGCAAAACTAAAAGAAACTGTTACTAC
TGTAAATCAGGATGGGTTTGATGAATCTGAGTCTACCTCACCTCTATTGCACTCTGGTAGAAGT
ACTTCCCCACCGTTAATTATTGCCTACCCCGGCTCTGTCCCCTCTTGCCATCCCCTCCCCCAAA
ACCCCCATAGTAAATCTTGGCCTCATAGATGTCTAGTCTAACATGCCAGTAGTAGATGTAACAT
TTTCATGGTAATCTACTAGCTCTGATCCATAAGGAAAAAGATCCTTGAATCTGGAGGTTCCCTT
ACCTTGATCTTTGGAAACACAACGGTATAGGGTTGTTCATAAAAGACATTGAAAAGTAAACATT
TGGTTATGCTTTAAAGCAGTAAAGTTATTGTCCTTTATGTAACTGGCTAATGGAAGAGGTTGGA
TTAAATTTCAATGTACTTATTTTTTTATAGATATTTATATTCTAAACAATTTATTCCTTATATT
TACCATGTTAAATATACATTTGGGCAGGCCATATTGGTCTATGTATTTTTTTAAAATGTAATTT
CTGAATGAAATTGAGAAAATGCTTTGTTTTGCCTGTCAAGGTAATAACTTTAGAAAATAAATAT
TTTTTCCCTACTGTAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001002956	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK01932	(Get FASTA)	NCBI Sequence Viewer
	BAD02920	(Get FASTA)	NCBI Sequence Viewer
	P13206	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001002956 ⟸ NM_001002956
- Peptide Label:	precursor
- UniProtKB:	Q9BDC1 (UniProtKB/Swiss-Prot), P13206 (UniProtKB/Swiss-Prot), A0A8C0R017 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDYFPMIFSLLFVAFQGAPEAAVLGAELSTGPDSRGEKPAPSAPWRPRRSKRCSCSSLMDKECV YFCHLDIIWVNTPEHIVPYGLGSPSRSKRSLKDLFITKATDHRKRCQCASQKDKKCWTFCQAGK ELREQDSMEKGWNGHKKGKDCSELGEKSKQQQLVAGRKIRRLDAISNSIKTAFRVAKLKAELYR ENKVTHNRTH hide sequence

RefSeq Acc Id:

ENSCAFP00000014389 ⟸ ENSCAFT00000015551

RefSeq Acc Id:

ENSCAFP00845029523 ⟸ ENSCAFT00845037679

Protein Domains

Endothelin-like toxin

Additional Information

External Database Links

Database	Acc Id	Source(s)
Ensembl Genes	ENSCAFG00000009794	Ensembl, UniProtKB/Swiss-Prot
	ENSCAFG00030006988	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSCAFG00040017186	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSCAFG00845021350	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSCAFP00000014389	UniProtKB/Swiss-Prot
	ENSCAFP00030011253.1	UniProtKB/Swiss-Prot
	ENSCAFP00030011279.1	UniProtKB/TrEMBL
	ENSCAFP00040027638.1	UniProtKB/Swiss-Prot
	ENSCAFP00040027677.1	UniProtKB/TrEMBL
	ENSCAFP00845029523	ENTREZGENE
	ENSCAFP00845029523.1	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSCAFT00000015551	UniProtKB/Swiss-Prot
	ENSCAFT00030012876.1	UniProtKB/Swiss-Prot
	ENSCAFT00030012909.1	UniProtKB/TrEMBL
	ENSCAFT00040031779.1	UniProtKB/Swiss-Prot
	ENSCAFT00040031823.1	UniProtKB/TrEMBL
	ENSCAFT00845037679	ENTREZGENE
	ENSCAFT00845037679.1	UniProtKB/Swiss-Prot
InterPro	Endothelin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Endothelin_toxin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Endothln-like_toxin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	cfa:403424	UniProtKB/Swiss-Prot
NCBI Gene	EDN1	ENTREZGENE
PANTHER	ENDOTHELIN-1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR13874	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Endothelin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	ENDOTHELIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ENDOTHELIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	END	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8C0MG80_CANLF	UniProtKB/TrEMBL
	A0A8C0R017	ENTREZGENE
	A0A8C0SWL4_CANLF	UniProtKB/TrEMBL
	EDN1_CANLF	UniProtKB/Swiss-Prot, ENTREZGENE
	Q9BDC1	ENTREZGENE
UniProt Secondary	Q765Z3	UniProtKB/Swiss-Prot
	Q9BDC1	UniProtKB/Swiss-Prot
VGNC ID	VGNC:40199	ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - PID (archival)