IL4 (interleukin 4) - Rat Genome Database

Name: IL4
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: IL4 (interleukin 4) Canis lupus familiaris

Analyze

Symbol:

IL4

Name:

interleukin 4

RGD ID:

12235618

Description:

ENCODES a protein that exhibits cytokine activity (inferred); cytokine receptor binding (inferred); growth factor activity (inferred); INVOLVED IN activated T cell proliferation (ortholog); B cell activation (ortholog); B cell costimulation (ortholog); PARTICIPATES IN Fc epsilon receptor mediated signaling pathway; interleukin-12 signaling pathway; interleukin-4 signaling pathway; ASSOCIATED WITH Acute Experimental Pancreatitis (ortholog); Acute Hepatitis (ortholog); Acute Lung Injury (ortholog); FOUND IN external side of plasma membrane (ortholog); extracellular space (ortholog); INTERACTS WITH cannabidiol; luteolin

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

B-cell stimulatory factor 1; BSF-1; IL-4; interleukin-4; lymphocyte stimulatory factor 1

RGD Orthologs

Human

Mouse

Rat

Chinchilla

Bonobo

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IL4 (interleukin 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB
Mus musculus (house mouse):	Il4 (interleukin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Il4 (interleukin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Il4 (interleukin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IL4 (interleukin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IL4 (interleukin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IL4 (interleukin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Il4 (interleukin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

CanFam3.1 - Dog CanFam3.1 Assembly

Position:

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	20,972,693 - 20,981,539 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	20,972,690 - 20,981,534 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	19,774,149 - 19,783,205 (+)	NCBI
ROS_Cfam_1.0	11	21,758,633 - 21,767,487 (+)	NCBI
ROS_Cfam_1.0 Ensembl	11	21,758,630 - 21,767,482 (+)	Ensembl
UMICH_Zoey_3.1	11	20,477,129 - 20,485,985 (+)	NCBI
UNSW_CanFamBas_1.0	11	20,324,686 - 20,333,537 (+)	NCBI
UU_Cfam_GSD_1.0	11	20,967,178 - 20,976,037 (+)	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Acute Experimental Pancreatitis (ISO)

Acute Hepatitis (ISO)

Acute Lung Injury (ISO)

adult T-cell leukemia/lymphoma (ISO)

allergic contact dermatitis (ISO)

allergic disease (ISO)

allergic rhinitis (ISO)

alopecia universalis (ISO)

Alzheimer's disease (ISO)

Anaphylaxis (ISO)

anogenital venereal wart (ISO)

anti-basement membrane glomerulonephritis (ISO)

aspirin-induced respiratory disease (ISO)

asthma (ISO)

atopic dermatitis (ISO)

autistic disorder (ISO)

autoimmune disease (ISO)

autoimmune hepatitis (ISO)

autoimmune thrombocytopenic purpura (ISO)

autoimmune thyroiditis (ISO)

Behcet's disease (ISO)

biliary tract benign neoplasm (ISO)

Bovine Tuberculosis (ISO)

Brain Injuries (ISO)

bronchiolitis obliterans (ISO)

cardiomyopathy (ISO)

carotid stenosis (ISO)

Chemical and Drug Induced Liver Injury (ISO)

cholestasis (ISO)

Chromosome Breakage (ISO)

Chronic Hepatitis B (ISO)

Chronic Hepatitis C (ISO)

cognitive disorder (ISO)

colitis (ISO)

common cold (ISO)

contact dermatitis (ISO)

COVID-19 (ISO)

cutaneous leishmaniasis (ISO)

cystic echinococcosis (ISO)

cystitis (ISO)

dermatitis (ISO)

dermatomyositis (ISO)

drug allergy (ISO)

Drug Eruptions (ISO)

Edema (ISO)

Experimental Arthritis (ISO)

Experimental Autoimmune Encephalomyelitis (ISO)

Experimental Autoimmune Uveoretinitis (ISO)

Experimental Diabetes Mellitus (ISO)

Experimental Liver Cirrhosis (ISO)

familial adenomatous polyposis 1 (ISO)

Fibrosis (ISO)

Gaucher's disease (ISO)

Granuloma (ISO)

Graves' disease (ISO)

Hand Osteoarthritis (ISO)

Hemorrhagic Shock (ISO)

hepatitis B (ISO)

hepatitis C (ISO)

Hereditary Neoplastic Syndromes (ISO)

herpes zoster (ISO)

high grade glioma (ISO)

Human Influenza (ISO)

hypothyroidism (ISO)

Immediate Hypersensitivity (ISO)

irritant dermatitis (ISO)

Kawasaki disease (ISO)

Knee Osteoarthritis (ISO)

leishmaniasis (ISO)

Lung Reperfusion Injury (ISO)

malignant mesothelioma (ISO)

Meningococcal Infections (ISO)

middle cerebral artery infarction (ISO)

multiple sclerosis (ISO)

Nematode Infections (ISO)

nephritis (ISO)

nephrotic syndrome (ISO)

Neurodevelopmental Disorders (ISO)

non-alcoholic fatty liver disease (ISO)

Otitis Media with Effusion (ISO)

pancreatic cancer (ISO)

pancreatic ductal carcinoma (ISO)

pelvic inflammatory disease (ISO)

Perennial Allergic Rhinitis (ISO)

pleural disease (ISO)

pneumoconiosis (ISO)

pneumonia (ISO)

polymyositis (ISO)

Premature Birth (ISO)

primary biliary cholangitis (ISO)

primary cutaneous T-cell non-Hodgkin lymphoma (ISO)

psoriasis (ISO)

pulmonary fibrosis (ISO)

pulmonary hypertension (ISO)

pulmonary tuberculosis (ISO)

respiratory allergy (ISO)

Respiratory Sounds (ISO)

Respiratory Tract Infections (ISO)

rhinitis (ISO)

Rhinosinusitis (ISO)

Seasonal Allergic Rhinitis (ISO)

Sepsis (ISO)

Spinal Cord Injuries (ISO)

Staphylococcal Infections (ISO)

systemic lupus erythematosus (ISO)

systemic scleroderma (ISO)

temporal arteritis (ISO)

toxocariasis (ISO)

trypanosomiasis (ISO)

vitiligo (ISO)

Weight Loss (ISO)

Xerostomia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

cannabidiol (EXP)

luteolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activated T cell proliferation (ISO)

activation of Janus kinase activity (IBA)

B cell activation (IEA,ISO)

B cell costimulation (IBA,ISO)

B cell proliferation (ISO)

cellular response to mercury ion (ISO)

cholesterol metabolic process (ISO)

defense response to protozoan (ISO)

dendritic cell differentiation (ISO)

extrinsic apoptotic signaling pathway (ISO)

extrinsic apoptotic signaling pathway in absence of ligand (IBA,ISO)

female pregnancy (ISO)

immune response (IEA)

innate immune response in mucosa (IBA)

isotype switching to IgE isotypes (ISO)

isotype switching to IgG isotypes (ISO)

macrophage activation (ISO)

MHC class II biosynthetic process (ISO)

microglial cell activation (IBA,ISO)

myeloid dendritic cell differentiation (IBA)

negative regulation of acute inflammatory response (IBA,ISO)

negative regulation of apoptotic process (ISS)

negative regulation of cellular response to transforming growth factor beta stimulus (ISO)

negative regulation of chronic inflammatory response (IBA,ISO)

negative regulation of complement-dependent cytotoxicity (IBA)

negative regulation of DNA-templated transcription (ISO)

negative regulation of endothelial cell apoptotic process (IBA)

negative regulation of epithelial cell migration (IBA)

negative regulation of extrinsic apoptotic signaling pathway (IBA,ISO)

negative regulation of inflammatory response (ISO)

negative regulation of macrophage activation (IBA,ISO)

negative regulation of nitric oxide biosynthetic process (ISO)

negative regulation of osteoclast differentiation (ISO,ISS)

negative regulation of T cell activation (ISO)

negative regulation of T-helper 17 cell differentiation (IBA,ISO)

negative regulation of transcription by RNA polymerase II (ISO)

negative regulation of tumor necrosis factor production (ISO)

negative regulation of white fat cell proliferation (ISO)

neuroinflammatory response (ISO)

peptidyl-tyrosine phosphorylation (ISO)

positive regulation of activated T cell proliferation (ISO)

positive regulation of amyloid-beta clearance (IBA)

positive regulation of ATP biosynthetic process (ISO)

positive regulation of B cell activation (ISO)

positive regulation of B cell proliferation (ISO,ISS)

positive regulation of cell migration (ISO)

positive regulation of cell population proliferation (IBA,ISO)

positive regulation of cellular respiration (ISO)

positive regulation of chemokine production (ISO)

positive regulation of cold-induced thermogenesis (ISO)

positive regulation of defense response to virus by host (IBA,ISO)

positive regulation of DNA-binding transcription factor activity (ISO)

positive regulation of DNA-templated transcription (IBA,ISO)

positive regulation of eosinophil chemotaxis (IBA,ISO)

positive regulation of establishment of endothelial barrier (ISO)

positive regulation of gene expression (ISO)

positive regulation of immunoglobulin production (ISO)

positive regulation of interleukin-10 production (IBA,ISO)

positive regulation of interleukin-13 production (IBA)

positive regulation of isotype switching to IgE isotypes (IBA,ISO,ISS)

positive regulation of isotype switching to IgG isotypes (IBA,ISO,ISS)

positive regulation of macroautophagy (IBA,ISS)

positive regulation of mast cell degranulation (IBA,ISO)

positive regulation of MHC class II biosynthetic process (IBA,ISO,ISS)

positive regulation of mononuclear cell migration (IBA,ISO)

positive regulation of myoblast fusion (IBA,ISO)

positive regulation of peptidyl-tyrosine phosphorylation (ISO)

positive regulation of protein phosphorylation (ISO)

positive regulation of reactive oxygen species biosynthetic process (ISO)

positive regulation of receptor signaling pathway via JAK-STAT (ISO)

positive regulation of receptor-mediated endocytosis (IBA)

positive regulation of T cell differentiation (IBA)

positive regulation of T cell proliferation (ISO,ISS)

positive regulation of T-helper 2 cell cytokine production (ISO)

positive regulation of transcription by RNA polymerase II (ISO,ISS)

positive regulation of tyrosine phosphorylation of STAT protein (IBA,ISO)

regulation of immune response (ISO,ISS)

regulation of inflammatory response (ISO)

regulation of phosphorylation (ISS)

regulation of protein export from nucleus (ISO)

regulation of proton transport (ISO)

response to cytokine (ISO)

response to ethanol (ISO)

response to nutrient (ISO)

response to organic cyclic compound (ISO)

response to xenobiotic stimulus (ISO)

retina development in camera-type eye (ISO)

T cell activation (ISO)

T cell proliferation (ISO)

T-helper 1 cell lineage commitment (ISO)

T-helper 2 cell differentiation (IBA,ISO)

transcription by RNA polymerase II (ISO)

tyrosine phosphorylation of STAT protein (ISO)

Cellular Component

external side of plasma membrane (ISO)

extracellular region (IEA)

extracellular space (IBA,IEA,ISO,ISS)

Molecular Function

cytokine activity (IBA,IEA)

cytokine receptor binding (IEA)

growth factor activity (IEA)

interleukin-4 receptor binding (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Fc epsilon receptor mediated signaling pathway (ISO)

interleukin-12 signaling pathway (ISO)

interleukin-4 signaling pathway (ISO)

Notch signaling pathway (ISO)

References

Additional References at PubMed

PMID:9887351	PMID:10487243	PMID:11730929	PMID:11741347	PMID:18789870	PMID:20187917	PMID:20188584	PMID:21511273	PMID:21991344	PMID:23605681	PMID:33582406

Genomics

Comparative Map Data

IL4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	20,972,693 - 20,981,539 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	20,972,690 - 20,981,534 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	19,774,149 - 19,783,205 (+)	NCBI
ROS_Cfam_1.0	11	21,758,633 - 21,767,487 (+)	NCBI
ROS_Cfam_1.0 Ensembl	11	21,758,630 - 21,767,482 (+)	Ensembl
UMICH_Zoey_3.1	11	20,477,129 - 20,485,985 (+)	NCBI
UNSW_CanFamBas_1.0	11	20,324,686 - 20,333,537 (+)	NCBI
UU_Cfam_GSD_1.0	11	20,967,178 - 20,976,037 (+)	NCBI

IL4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	132,673,989 - 132,682,678 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	5	132,673,986 - 132,682,678 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	132,009,681 - 132,018,370 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	132,037,272 - 132,046,267 (+)	NCBI	NCBI36		hg18	NCBI36
Build 34	5	132,037,271 - 132,046,267	NCBI
Celera	5	128,139,502 - 128,148,524 (+)	NCBI
Cytogenetic Map	5	q31.1	NCBI
HuRef	5	127,201,979 - 127,210,672 (+)	NCBI		HuRef
CHM1_1	5	131,442,973 - 131,451,670 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	133,193,788 - 133,202,478 (+)	NCBI

Il4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	53,503,287 - 53,509,492 (-)	NCBI	GRCm39		mm39
GRCm39 Ensembl	11	53,493,809 - 53,509,496 (-)	Ensembl
GRCm38	11	53,612,460 - 53,618,665 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	53,602,982 - 53,618,669 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	53,425,962 - 53,432,167 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	11	53,455,891 - 53,462,088 (-)	NCBI			mm8
Celera	11	58,191,990 - 58,198,195 (-)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	31.97	NCBI

Il4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	37,771,203 - 37,776,750 (-)	NCBI	mRatBN7.2
mRatBN7.2 Ensembl	10	37,771,203 - 37,776,750 (-)	Ensembl
Rnor_6.0	10	38,963,979 - 38,969,531 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	38,963,979 - 38,969,531 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	38,745,706 - 38,751,258 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	39,074,582 - 39,080,134 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	10	39,083,152 - 39,088,705 (-)	NCBI
Celera	10	37,115,496 - 37,120,965 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

Il4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955408	4,058,052 - 4,065,999 (+)	NCBI	ChiLan1.0	ChiLan1.0

IL4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	5	134,253,039 - 134,261,581 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	134,253,039 - 134,261,581 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	5	128,091,342 - 128,099,886 (+)	NCBI	Mhudiblu_PPA_v0		panPan3

IL4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	134,986,817 - 134,994,365 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	134,986,817 - 134,994,365 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	140,455,331 - 140,462,879 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IL4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	35,492,158 - 35,501,349 (+)	NCBI	ChlSab1.1		chlSab2
ChlSab1.1 Ensembl	23	35,492,939 - 35,501,258 (+)	Ensembl	ChlSab1.1		chlSab2
Vero_WHO_p1.0	NW_023666034	42,443,750 - 42,449,550 (-)	NCBI	Vero_WHO_p1.0

Il4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624733	39,412,800 - 39,420,079 (-)	NCBI	HetGla_female_1.0		hetGla2

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	reproductive system	respiratory system	adipose tissue
High
Medium
Low			1						1	6	1
Below cutoff	2	4	13	3	6	3	4	2	9	1	7	3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001003159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AAEX04000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF054833	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF072696	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF083270	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF091132	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF104245	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF187322	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF239917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF328928	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF095771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAHUQ010000115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAQRD010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAUVH010000356	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	REHQ01000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSCAFT00000001367 ⟹ ENSCAFP00000001253

RefSeq Status:

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1 Ensembl	11	20,972,690 - 20,981,534 (+)	Ensembl

RefSeq Acc Id:

ENSCAFT00845019424 ⟹ ENSCAFP00845015186

RefSeq Status:

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
ROS_Cfam_1.0 Ensembl	11	21,758,630 - 21,767,482 (+)	Ensembl

RefSeq Acc Id:

NM_001003159 ⟹ NP_001003159

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1	11	20,972,693 - 20,981,539 (+)	NCBI
Dog10K_Boxer_Tasha	11	19,774,149 - 19,783,205 (+)	NCBI
ROS_Cfam_1.0	11	21,758,633 - 21,767,487 (+)	NCBI
UMICH_Zoey_3.1	11	20,477,129 - 20,485,985 (+)	NCBI
UNSW_CanFamBas_1.0	11	20,324,686 - 20,333,537 (+)	NCBI
UU_Cfam_GSD_1.0	11	20,967,178 - 20,976,037 (+)	NCBI

Sequence:

show sequence

ATTGTGAGCCTCTCCTAGTAAACTGATTTGTCTGCTATTGTCACTGCAAATAGAGATCTATTAA
TGGGTCTCACCTCCCAACTGATTCCAACTCTGGTCTGCTTACTAGCACTCACCAGCACCTTTGT
CCACGGACATAACTTCAATATTACTATTAAAGAGATCATCAAAATGTTGAACATCCTCACAGCG
AGAAACGACTCGTGCATGGAGCTGACTGTCAAGGACGTCTTCACTGCTCCAAAGAACACAAGCG
ATAAGGAAATCTTCTGCAGAGCTGCTACTGTACTGCGGCAGATCTATACACACAACTGCTCCAA
CAGATATCTCAGAGGACTCTACAGGAACCTCAGCAGCATGGCAAACAAGACCTGTTCTATGAAT
GAAATCAAGAAGAGTACACTGAAAGACTTCTTGGAAAGGCTAAAAGTGATCATGCAGAAGAAAT
ACTACAGGCATTGAAGCTGAATATTTTAATTTATGAGTTTTTAAATAGCTTTATTTTAAAAATA
TTTATATATTTATAACATAATAAAATAAAATATATATAGACTCTAAAAAAAAAAAAAAAAAAAA
AAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001003159	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC83931	(Get FASTA)	NCBI Sequence Viewer
	AAD09005	(Get FASTA)	NCBI Sequence Viewer
	AAD11563	(Get FASTA)	NCBI Sequence Viewer
	AAD46990	(Get FASTA)	NCBI Sequence Viewer
	AAD51860	(Get FASTA)	NCBI Sequence Viewer
	AAF01043	(Get FASTA)	NCBI Sequence Viewer
	AAF60177	(Get FASTA)	NCBI Sequence Viewer
	AAL26922	(Get FASTA)	NCBI Sequence Viewer
	ABL01502	(Get FASTA)	NCBI Sequence Viewer
	O77762	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001003159 ⟸ NM_001003159
- Peptide Label:	precursor
- UniProtKB:	A1E293 (UniProtKB/Swiss-Prot), O77762 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MGLTSQLIPTLVCLLALTSTFVHGHNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTS DKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKK YYRH hide sequence

RefSeq Acc Id:

ENSCAFP00000001253 ⟸ ENSCAFT00000001367

RefSeq Acc Id:

ENSCAFP00845015186 ⟸ ENSCAFT00845019424

Additional Information

External Database Links

Database	Acc Id	Source(s)
Ensembl Genes	ENSCAFG00000000880	Ensembl
	ENSCAFG00030011649	UniProtKB/Swiss-Prot
	ENSCAFG00040006346	UniProtKB/Swiss-Prot
	ENSCAFG00845010991	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSCAFP00030018780	UniProtKB/Swiss-Prot
	ENSCAFP00040010259	UniProtKB/Swiss-Prot
	ENSCAFP00845015186	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSCAFT00030021538	UniProtKB/Swiss-Prot
	ENSCAFT00040011833	UniProtKB/Swiss-Prot
	ENSCAFT00845019424	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.1250.10	UniProtKB/Swiss-Prot
InterPro	4_helix_cytokine-like_core	UniProtKB/Swiss-Prot
	IL-4	UniProtKB/Swiss-Prot
	IL-4/IL-13	UniProtKB/Swiss-Prot
	IL-4/IL-13_CS	UniProtKB/Swiss-Prot
KEGG Report	cfa:403785	UniProtKB/Swiss-Prot
NCBI Gene	IL4	ENTREZGENE
PANTHER	PTHR47401	UniProtKB/Swiss-Prot
Pfam	IL4	UniProtKB/Swiss-Prot
PIRSF	Interleukin_4	UniProtKB/Swiss-Prot
PRINTS	INTERLEUKIN4	UniProtKB/Swiss-Prot
PROSITE	INTERLEUKIN_4_13	UniProtKB/Swiss-Prot
SMART	IL4_13	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47266	UniProtKB/Swiss-Prot
UniProt	A1E293	ENTREZGENE
	IL4_CANLF	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	A1E293	UniProtKB/Swiss-Prot
VGNC ID	VGNC:41987	ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - PID (archival)