TLR4 (toll like receptor 4) - Rat Genome Database

Name: TLR4
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Community Projects Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: TLR4 (toll like receptor 4) Pan paniscus

Analyze

Symbol:

TLR4

Name:

toll like receptor 4

RGD ID:

11873777

Description:

ENCODES a protein that exhibits lipopolysaccharide binding (ortholog); lipopolysaccharide immune receptor activity (ortholog); phosphatidylinositol 3-kinase binding (ortholog); INVOLVED IN activation of innate immune response (ortholog); astrocyte development (ortholog); B cell proliferation (ortholog); PARTICIPATES IN titanium dioxide nanoparticle response pathway; Toll-like receptor signaling pathway; ASSOCIATED WITH Acanthamoeba Keratitis (ortholog); Acne Conglobata (ortholog); Acute Coronary Syndrome (ortholog); FOUND IN cell surface (ortholog); lipopolysaccharide receptor complex (ortholog); plasma membrane (ortholog)

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

toll-like receptor 4

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TLR4 (toll like receptor 4)	NCBI	Ortholog
Mus musculus (house mouse):	Tlr4 (toll-like receptor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Tlr4 (toll-like receptor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tlr4 (toll like receptor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TLR4 (toll like receptor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tlr4 (toll like receptor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TLR4 (toll like receptor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TLR4 (toll like receptor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tlr4 (toll like receptor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

Mhudiblu_PPA_v0 - Bonobo Mhudiblu_PPA_v0 Assembly

Position:

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	9	21,630,343 - 21,652,922 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	88,827,495 - 88,840,458 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	117,180,250 - 117,193,510 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	117,180,550 - 117,190,711 (+)	Ensembl	panpan1.1		panPan2

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Acanthamoeba Keratitis (ISO)

acne (ISO)

Acne Conglobata (ISO)

Acute Coronary Syndrome (ISO)

acute kidney failure (ISO)

Acute Liver Failure (ISO)

Acute Lung Injury (ISO)

acute necrotizing pancreatitis (ISO)

acute pancreatitis (ISO)

Acute Tubulointerstitial Nephritis (ISO)

Acute-On-Chronic Liver Failure (ISO)

Alcoholic Fatty Liver (ISO)

allergic conjunctivitis (ISO)

allergic contact dermatitis (ISO)

allergic rhinitis (ISO)

Alzheimer's disease (ISO)

ankylosing spondylitis (ISO)

anogenital venereal wart (ISO)

anterior uveitis (ISO)

arteriosclerosis (ISO)

arthritis (ISO)

asthma (ISO)

atherosclerosis (ISO)

atopic dermatitis (ISO)

Bacteremia (ISO)

Bacterial Keratitis (ISO)

bacterial pneumonia (ISO)

Behcet's disease (ISO)

Brain Injuries (ISO)

brain ischemia (ISO)

breast cancer (ISO)

Bronchial Hyperreactivity (ISO)

carcinoma (ISO)

carotid artery disease (ISO)

carotid stenosis (ISO)

Chemical and Drug Induced Liver Injury (ISO)

cholesteatoma (ISO)

cholesteatoma of middle ear (ISO)

Chronic Hepatitis B (ISO)

Chronic Hepatitis C (ISO)

chronic obstructive pulmonary disease (ISO)

Chronic Pain (ISO)

Chronic Periodontitis (ISO)

colitis (ISO)

Colorectal Neoplasms (ISO)

contact dermatitis (ISO)

coronary artery disease (ISO)

COVID-19 (ISO)

Crohn's disease (ISO)

cutaneous leishmaniasis (ISO)

cystic echinococcosis (ISO)

cystic fibrosis (ISO)

dermatomyositis (ISO)

diabetes mellitus (ISO)

Diabetic Foot (ISO)

Diabetic Nephropathies (ISO)

diabetic neuropathy (ISO)

diabetic retinopathy (ISO)

dry eye syndrome (ISO)

Dysbiosis (ISO)

end stage renal disease (ISO)

Endotoxemia (ISO)

Entamoebiasis (ISO)

Eosinophilia (ISO)

Escherichia Coli Meningitis (ISO)

esophagus adenocarcinoma (ISO)

essential hypertension (ISO)

eumycotic mycetoma (ISO)

exfoliation syndrome (ISO)

Experimental Autoimmune Encephalomyelitis (ISO)

Experimental Autoimmune Neuritis (ISO)

Experimental Autoimmune Uveitis (ISO)

Experimental Diabetes Mellitus (ISO)

Experimental Liver Cirrhosis (ISO)

extrahepatic cholestasis (ISO)

eye disease (ISO)

familial Mediterranean fever (ISO)

fatty liver disease (ISO)

Fibrosis (ISO)

Fungal Eye Infections (ISO)

Fungal Keratitis (ISO)

genetic disease (ISO)

glomerulonephritis (ISO)

Hearing Loss (ISO)

Hemorrhagic Shock (ISO)

hepatocellular carcinoma (ISO)

hepatorenal syndrome (ISO)

Herpes Simplex Encephalitis (ISO)

herpes simplex virus keratitis (ISO)

Hyperalgesia (ISO)

hypertension (ISO)

ileitis (ISO)

Inflammation (ISO)

Insulin Resistance (ISO)

invasive aspergillosis (ISO)

Kawasaki disease (ISO)

keratitis (ISO)

kidney failure (ISO)

Kidney Reperfusion Injury (ISO)

learning disability (ISO)

leptospirosis (ISO)

liver cirrhosis (ISO)

Liver Injury (ISO)

Liver Reperfusion Injury (ISO)

low tension glaucoma (ISO)

lung adenocarcinoma (ISO)

lung disease (ISO)

Lung Injury (ISO)

Lung Neoplasms (ISO)

Lung Reperfusion Injury (ISO)

Lymphatic Metastasis (ISO)

macular degeneration (ISO)

mastitis (ISO)

mastoiditis (ISO)

melanoma (ISO)

membranoproliferative glomerulonephritis (ISO)

meningococcal meningitis (ISO)

multiple sclerosis (ISO)

myocardial infarction (ISO)

Myocardial Reperfusion Injury (ISO)

Nasal Polyps (ISO)

Neoplasm Invasiveness (ISO)

Neoplasm Metastasis (ISO)

Neuralgia (ISO)

non-alcoholic fatty liver disease (ISO)

obesity (ISO)

Ocular Onchocerciasis (ISO)

Optic Nerve Injuries (ISO)

Oral Lichen Planus (ISO)

otitis media (ISO)

Otitis Media with Effusion (ISO)

Ovarian Neoplasms (ISO)

Pain (ISO)

Painful Neuropathy (ISO)

pancreatitis (ISO)

perinatal necrotizing enterocolitis (ISO)

periodontitis (ISO)

Plaque, Atherosclerotic (ISO)

pleural tuberculosis (ISO)

Pneumococcal Meningitis (ISO)

pneumonia (ISO)

pre-eclampsia (ISO)

primary open angle glaucoma (ISO)

Prostatic Neoplasms (ISO)

Pseudomonas Aeruginosa Keratitis (ISO)

psoriasis (ISO)

pulmonary edema (ISO)

pulmonary emphysema (ISO)

pulmonary fibrosis (ISO)

pulmonary hypertension (ISO)

pulmonary tuberculosis (ISO)

pulpitis (ISO)

renal fibrosis (ISO)

Reperfusion Injury (ISO)

respiratory allergy (ISO)

Respiratory Sounds (ISO)

respiratory syncytial virus infectious disease (ISO)

Retina Reperfusion Injury (ISO)

Rhinosinusitis (ISO)

sciatic neuropathy (ISO)

Seasonal Allergic Rhinitis (ISO)

Sepsis (ISO)

severe COVID-19 (ISO)

sinusitis (ISO)

Spinal Cord Injuries (ISO)

Spinal Cord Reperfusion Injury (ISO)

sporotrichosis (ISO)

squamous cell carcinoma (ISO)

Stable Angina (ISO)

Stroke (ISO)

Subarachnoid Hemorrhage (ISO)

suppurative otitis media (ISO)

systemic lupus erythematosus (ISO)

temporal arteritis (ISO)

Transplant Rejection (ISO)

tuberculosis (ISO)

tympanosclerosis (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (ISO)

urinary bladder cancer (ISO)

urinary tract infection (ISO)

uveitis (ISO)

Ventricular Dysfunction, Left (ISO)

Viral Bronchiolitis (ISO)

viral meningitis (ISO)

vitiligo (ISO)

Wallerian Degeneration (ISO)

Weight Loss (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activation of innate immune response (IEA,ISO)

astrocyte development (IEA,ISO)

B cell proliferation (IEA,ISO)

B cell proliferation involved in immune response (IEA,ISO)

canonical NF-kappaB signal transduction (IEA)

cellular response to amyloid-beta (IEA)

cellular response to lipopolysaccharide (IEA,ISO)

cellular response to lipoteichoic acid (IEA,ISO)

cellular response to mechanical stimulus (IEA,ISO)

cellular response to oxidised low-density lipoprotein particle stimulus (IEA)

cellular response to platelet-derived growth factor stimulus (IEA)

cellular response to retinoic acid (ISO)

cellular response to type II interferon (IEA)

defense response to bacterium (IEA)

defense response to Gram-negative bacterium (IEA,ISO)

detection of lipopolysaccharide (IEA,ISS)

detection of mechanical stimulus involved in sensory perception of pain (ISO)

detection of temperature stimulus involved in sensory perception of pain (ISO)

ERK1 and ERK2 cascade (IEA,ISO)

gene expression (IEA,ISO)

immune response (IEA)

immune system process (IEA)

immunoglobulin mediated immune response (ISO)

inflammatory response (IEA,ISO)

innate immune response (IEA)

innate immune response-activating signaling pathway (ISO)

intestinal epithelial structure maintenance (IEA)

JNK cascade (IEA,ISO)

leukotriene metabolic process (ISO)

lipopolysaccharide-mediated signaling pathway (IEA,ISO)

lymphocyte proliferation (IEA,ISO)

macrophage activation (IEA,ISS)

MHC class II biosynthetic process (IEA,ISO)

microglia differentiation (IEA,ISO)

microglial cell activation (ISO)

MyD88-dependent toll-like receptor signaling pathway (IEA)

negative regulation of cold-induced thermogenesis (IEA)

negative regulation of ERK1 and ERK2 cascade (IEA)

negative regulation of interleukin-17 production (IEA)

negative regulation of interleukin-23 production (IEA)

negative regulation of interleukin-6 production (IEA)

negative regulation of tumor necrosis factor production (IEA)

negative regulation of type II interferon production (IEA)

neurogenesis (IEA,ISO)

nitric oxide biosynthetic process (IEA,ISO)

nitric oxide production involved in inflammatory response (IEA,ISO)

nucleotide-binding oligomerization domain containing 1 signaling pathway (IEA,ISO)

nucleotide-binding oligomerization domain containing 2 signaling pathway (IEA,ISO)

phagocytosis (IEA)

positive regulation of apoptotic process (ISO)

positive regulation of B cell proliferation (IEA,ISO)

positive regulation of canonical NF-kappaB signal transduction (IEA,ISO)

positive regulation of cellular response to macrophage colony-stimulating factor stimulus (IEA)

positive regulation of chemokine (C-X-C motif) ligand 2 production (IEA)

positive regulation of chemokine production (IEA)

positive regulation of cytokine production involved in inflammatory response (IEA)

positive regulation of DNA binding (ISO)

positive regulation of DNA-binding transcription factor activity (ISO)

positive regulation of ERK1 and ERK2 cascade (IEA,ISO)

positive regulation of extrinsic apoptotic signaling pathway (IEA)

positive regulation of gene expression (IEA,ISO)

positive regulation of inflammatory response (IEA)

positive regulation of interferon-alpha production (IEA)

positive regulation of interferon-beta production (IEA,ISO)

positive regulation of interleukin-1 beta production (IEA,ISS)

positive regulation of interleukin-1 production (IEA)

positive regulation of interleukin-10 production (IEA,ISO)

positive regulation of interleukin-12 production (IEA)

positive regulation of interleukin-6 production (IEA,ISO)

positive regulation of interleukin-8 production (IEA)

positive regulation of JNK cascade (IEA,ISO)

positive regulation of lymphocyte proliferation (IEA,ISO)

positive regulation of macrophage activation (IEA)

positive regulation of macrophage cytokine production (IEA,ISO)

positive regulation of matrix metallopeptidase secretion (IEA)

positive regulation of MHC class II biosynthetic process (IEA,ISO)

positive regulation of NF-kappaB transcription factor activity (ISO)

positive regulation of nitric oxide biosynthetic process (IEA,ISO)

positive regulation of nitric-oxide synthase biosynthetic process (IEA)

positive regulation of NLRP3 inflammasome complex assembly (IEA,ISS)

positive regulation of non-canonical NF-kappaB signal transduction (IEA)

positive regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway (IEA,ISO)

positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway (IEA,ISO)

positive regulation of peptidyl-tyrosine phosphorylation (ISO)

positive regulation of platelet activation (IEA)

positive regulation of reactive oxygen species biosynthetic process (IEA)

positive regulation of smooth muscle cell migration (IEA,ISO)

positive regulation of smooth muscle cell proliferation (IEA,ISO)

positive regulation of stress-activated MAPK cascade (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IEA)

positive regulation of tumor necrosis factor production (IEA,ISO)

positive regulation of type II interferon production (IEA)

regulation of dendritic cell cytokine production (IEA,ISO)

regulation of inflammatory response (IEA)

regulation of tumor necrosis factor production (ISO)

response to activity (ISO)

response to bacterium (IEA,ISO)

response to ethanol (ISO)

response to fatty acid (ISO)

response to glucocorticoid (ISO)

response to gold nanoparticle (ISO)

response to hypoxia (ISO)

response to insulin (ISO)

response to lipopolysaccharide (IEA,ISO)

response to oxidative stress (ISO)

response to progesterone (ISO)

response to retinoic acid (ISO)

response to toxic substance (ISO)

signal transduction (IEA)

skeletal muscle contraction (ISO)

stress-activated MAPK cascade (IEA,ISO)

toll-like receptor 4 signaling pathway (IEA,ISO)

toll-like receptor signaling pathway (IEA,ISO)

TRIF-dependent toll-like receptor signaling pathway (IEA)

wound healing involved in inflammatory response (IEA)

Cellular Component

cell projection (IEA)

cell surface (IEA,ISO)

cytoplasm (IEA)

early endosome (IEA)

endosome (IEA)

external side of plasma membrane (IEA)

lipopolysaccharide receptor complex (IEA,ISS)

membrane (IEA)

perinuclear region of cytoplasm (IEA)

phagocytic cup (IEA)

plasma membrane (IEA,ISO)

receptor complex (IEA,ISO)

ruffle (IEA)

Molecular Function

identical protein binding (IEA)

lipopolysaccharide binding (IEA,ISO)

lipopolysaccharide immune receptor activity (IEA,ISS)

NAD(P)+ nucleosidase activity (IEA)

NAD+ nucleotidase, cyclic ADP-ribose generating (IEA)

phosphatidylinositol 3-kinase binding (ISO)

protein binding (ISO)

protein heterodimerization activity (IEA)

signaling receptor activity (IEA)

signaling receptor binding (IEA)

transmembrane signaling receptor activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

titanium dioxide nanoparticle response pathway (ISO)

Toll-like receptor signaling pathway (ISO)

References

Additional References at PubMed

PMID:18810425	PMID:22301074	PMID:30032202

Genomics

Comparative Map Data

TLR4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	9	21,630,343 - 21,652,922 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	88,827,495 - 88,840,458 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	117,180,250 - 117,193,510 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	117,180,550 - 117,190,711 (+)	Ensembl	panpan1.1		panPan2

TLR4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	117,704,403 - 117,724,735 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	117,704,175 - 117,724,735 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	120,466,681 - 120,487,013 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	119,506,431 - 119,519,589 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	117,546,137 - 117,556,781	NCBI
Celera	9	91,114,228 - 91,127,535 (+)	NCBI		Celera
Cytogenetic Map	9	q33.1	NCBI
HuRef	9	90,084,535 - 90,097,850 (+)	NCBI		HuRef
CHM1_1	9	120,614,005 - 120,627,323 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	129,898,286 - 129,918,621 (+)	NCBI		T2T-CHM13v2.0

Tlr4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	66,745,788 - 66,765,338 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	66,745,821 - 66,848,521 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	66,827,551 - 66,846,581 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	66,827,584 - 66,930,284 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	66,488,845 - 66,503,831 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	66,314,172 - 66,329,158 (+)	NCBI		MGSCv36	mm8
Celera	4	65,431,141 - 65,446,127 (+)	NCBI		Celera
Cytogenetic Map	4	C1	NCBI
cM Map	4	34.66	NCBI

Tlr4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	80,145,867 - 80,159,501 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	80,145,826 - 80,159,628 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	82,524,918 - 82,538,532 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	84,342,217 - 84,355,831 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	84,317,856 - 84,331,470 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	82,587,424 - 82,601,056 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	82,587,420 - 82,601,052 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	86,690,670 - 86,704,302 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	83,564,100 - 83,577,735 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	83,569,212 - 83,582,848 (+)	NCBI
Celera	5	79,045,293 - 79,058,928 (+)	NCBI		Celera
RH 3.4 Map	5	643.7	RGD
Cytogenetic Map	5	q24	NCBI

Tlr4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	10,191,120 - 10,202,135 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	10,190,937 - 10,201,896 (-)	NCBI	ChiLan1.0	ChiLan1.0

TLR4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	71,356,390 - 71,367,166 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	71,356,390 - 71,367,165 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	69,768,502 - 69,779,281 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	72,483,514 - 72,494,289 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	72,483,210 - 72,494,579 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	71,012,889 - 71,023,665 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	71,034,981 - 71,045,756 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	71,767,611 - 71,778,394 (+)	NCBI		UU_Cfam_GSD_1.0

Tlr4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	186,750,688 - 186,763,650 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936487	6,518,441 - 6,533,095 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936487	6,519,140 - 6,532,018 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TLR4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	258,044,610 - 258,058,970 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	258,044,610 - 258,054,641 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	289,775,816 - 289,785,847 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TLR4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	21,873,762 - 21,885,562 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	21,871,773 - 21,885,515 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666035	21,002,852 - 21,019,229 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tlr4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	17,598,630 - 17,609,120 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	17,596,516 - 17,608,955 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001279223	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008958541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_034967032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_034967033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB445640	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AH008351	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JARIFH010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSPPAT00000038864 ⟹ ENSPPAP00000016171

Type:

CODING

Position:

Bonobo Assembly	Chr	Position (strand)	Source
PanPan1.1 Ensembl	9	117,180,550 - 117,190,711 (+)	Ensembl

RefSeq Acc Id:

NM_001279223 ⟹ NP_001266152

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Bonobo Assembly	Chr	Position (strand)	Source
NHGRI_mPanPan1	9	21,642,320 - 21,652,489 (-)	NCBI
Mhudiblu_PPA_v0	9	88,827,999 - 88,838,172 (+)	NCBI
PanPan1.1	9	117,180,550 - 117,190,711 (+)	NCBI

Sequence:

show sequence

ATGATGTCTGCCTCGCGCCTGGCTGGGACTCTGATCCCAGCCATGGCCTTCCTCTCCTGCGTGA
GACCAGAAAGCTGGGAGCCCTGCGTGGAGGTGGTTCCTAATATTACTTATCAATGCATGGAGCT
GAATTTCTACAAAATCCCCGACAACCTCCCCTTCTCAACCAAGAACCTGGACCTGAGCTTTAAT
CCCCTGAGGCATTTAGGCAGCTATAGCTTCTTCAGTTTCCCAGAACTGCAGGTGCTGGATTTAT
CCAGGTGTGAAATCCAGACAATTGAAGATGGGGCATATCAGAGCCTAAGCCACCTCTCCACCTT
AATATTGACAGGAAACCCCATCCAGAGTTTAGCCCTGGGAGCCTTTTCTGGACTATCAAGTTTA
CAGAAGCTGGTGGCTGTGGAGACAAATCTAGCATCTCTAGAGAACTTCCCCATTGGACATCTCA
AAACTTTGAAAGAACTTAATGTGGCTCACAATCTTATCCAATCTTTCAAATTACCTGAGTATTT
TTCTAATCTGACCAATCTAGAGCACTTGGACCTTTCCAGCAACAAGATTCAAAGTATTTATTGC
ACAGACTTGCGGGTTCTACATCAAATGCCCCTACTCAATCTCTCTTTAGACCTGTCCCTGAACC
CTATGAACTTTATCCAACCAGGTGCATTTAAAGAAATTAGGCTTCATAAGCTGACTTTGAGAAA
TAATTTTGATAGTTTAAATGTAATGAAAACTTGTATTCAAGGTCTGGCTGGTTTAGAAGTCCAT
CGTTTGGTTCTGGGAGAATTTAGAAATGAAGAAAACTTGGAAAAGTTTGACAAATCTGCTCTAG
AGGGCCTGTGCAATTTGACCATTGAAGAATTCCGATTAGCATACTTAGACTACTACCTCGATGA
TATTATTGACTTATTTAATTGTTTGACAAATGTTTCTTCATTTTCCCTGGTGAGTGTGACTATT
AAAAGCGTAAAAGACTTTTCTTATAATTTCGGATGGCAACATTTAGAATTAGTTAAGTGTAAAT
TTGGACAGTTTCCCACATTGAAACTCAAATCTCTCAAAAGGCTTACTTTCACTTCCAACAAAGG
TGGGAATGCTTTTTCAGAAGTTGATCTACCAAGCCTTGAGTTTCTAGATCTCAGTAGAAATGGC
TTGAGTTTCAAAGGTTGCTGTTCTCAAAGTGATTTTGGGACAACCAGCCTAAAGTATTTAGATC
TGAGCTTCAATGGTGTTATTACCATGAGTTCAAACTTCTTGGGCTTAGAACAACTAGAACATCT
GGATTTCCAGCATTCCAATTTGAAACAAATGAGTGAGTTTTCAGTATTCCTATCACTCAGAAAC
CTCATTTACCTTGACATTTCTCATACTCACACCAGAGTTGCTTTCAATGGCATCTTCAATGGCT
TGTCCAGTCTCGAAGTCTTGAAAATGGCTGGCAATTCTTTCCAGGAAAACTTCCTTCCAGATAT
CTTCACAGAGCTGAGAAACTTGACCTTCCTGGACCTCTCTCAGTGTCAACTGGAGCAGTTGTCT
CCAACAGCATTTAACTCACTCTCCAGTCTTCAGGTACTAAATATGAGCCACAACAACTTCTTTT
CATTGGATACGTTTCCTTATAAGTGTCTGAACTCCCTCCAGGTTCTTGATTACAGTCTCAATCA
CATAATGACTTCCAAAAAACAGGAACTACAGCATTTTCCAAGTAGTCTAGCTTTCTTAAATCTT
ACTCAGAATGACTTTGCTTGTACTTGTGAACACCAAAGTTTCCTGCAATGGATCAAGGACCAGA
GGCAGCTCTTGGTGGAAGTTGAACGAATGGAATGTGCAACACCTTCAGATAAGCAGGGCATGCC
TGTGCTGAGTTTGAATATCACCTGTCAGATGAATAAGACCATCATTGGTGTGTCGGTCCTCAGT
GTGCTTGTAGTATCTGTTGTAGCAGTTCTGGTCTATAAGTTCTATTTTCACCTGATGCTTCTTG
CTGGCTGCATAAAGTATGGTAGAGGTGAAAACATCTATGATGCCTTTGTTATCTACTCAAGCCA
GGATGAGGACTGGGTAAGGAATGAGCTAGTAAAGAATTTAGAAGAAGGGGTGCCTCCATTTCAG
CTCTGCCTTCACTACAGAGACTTTATTCCCGGTGTGGCCATTGCTGCCAACATCATCCATGAAG
GTTTCCATAAAAGCCGAAAGGTGATTGTTGTGGTGTCCCAGCACTTCATCCAGAGCCGCTGGTG
TATCTTTGAATATGAGATTGCTCAGACGTGGCAGTTTCTGAGCAGTCGTGCTGGTATCATCTTC
ATTGTCCTGCAGAAGGTGGAGAAGACCCTGCTCAGGCGGCAGGTGGAGCTGTACCGCCTTCTCA
GCAGGAACACTTACCTGGAGTGGGAGGACAGTGTCCTGGGGCGGCACATCTTCTGGAGACGACT
CAGAAAAGCCCTGCTGGATGGTAAATCATGGAATCCAGAAGGAACAGTGGGTACAGGATGCAAT
TGGCAGGAAGCAACATCTATCTGA

hide sequence

RefSeq Acc Id:

XM_034967032 ⟹ XP_034822923

Type:

CODING

Position:

Bonobo Assembly	Chr	Position (strand)	Source
NHGRI_mPanPan1	9	21,630,343 - 21,649,499 (-)	NCBI
Mhudiblu_PPA_v0	9	88,830,996 - 88,840,458 (+)	NCBI

RefSeq Acc Id:

XM_034967033 ⟹ XP_034822924

Type:

CODING

Position:

Bonobo Assembly	Chr	Position (strand)	Source
NHGRI_mPanPan1	9	21,630,343 - 21,652,922 (-)	NCBI
Mhudiblu_PPA_v0	9	88,827,495 - 88,840,458 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001266152	(Get FASTA)	NCBI Sequence Viewer
	XP_034822923	(Get FASTA)	NCBI Sequence Viewer
	XP_034822924	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF05320	(Get FASTA)	NCBI Sequence Viewer
	BAG55037	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSPPAP00000016171
	ENSPPAP00000016171.1
GenBank Protein	Q9TTN0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001266152 ⟸ NM_001279223
- Peptide Label:	precursor
- UniProtKB:	B3Y628 (UniProtKB/TrEMBL)
- Sequence:	show sequence MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFN PLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSL QKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC TDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVH RLVLGEFRNEENLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTI KSVKDFSYNFGWQHLELVKCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNG LSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRN LIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLS PTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNL TQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLS VLVVSVVAVLVYKFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQ LCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIF IVLQKVEKTLLRRQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCN WQEATSI hide sequence

RefSeq Acc Id:	XP_034822924 ⟸ XM_034967033
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_034822923 ⟸ XM_034967032
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSPPAP00000016171 ⟸ ENSPPAT00000038864

Protein Domains

LRRCT TIR

Additional Information

External Database Links

Database	Acc Id	Source(s)
Ensembl Genes	ENSPPAG00000031203	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSPPAT00000038864	ENTREZGENE
	ENSPPAT00000038864.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.10140	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.80.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Cys-rich_flank_reg_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Leu-rich_rpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Leu-rich_rpt_typical-subtyp	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LRR_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TIR_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Toll-like_receptor	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Toll_tir_struct_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	pps:100980644	UniProtKB/TrEMBL
NCBI Gene	TLR4	ENTREZGENE
PANTHER	PTHR24365	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TOLL-LIKE RECEPTOR 4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	LRR_8	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TIR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PIRSF	Toll-like_receptor	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	LEURICHRPT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	LRR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROKAR_LIPOPROTEIN	UniProtKB/TrEMBL
	TIR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	LRR_SD22	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LRR_TYP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LRRCT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TIR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	L domain-like	UniProtKB/Swiss-Prot
	Outer arm dynein light chain 1	UniProtKB/TrEMBL
	RNI-like	UniProtKB/TrEMBL
	SSF52200	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	B3Y628	ENTREZGENE, UniProtKB/TrEMBL
	Q9TTN0	ENTREZGENE, UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

RGD Manual Annotations