Wnt1 (wingless-type MMTV integration site family, member 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Wnt1 (wingless-type MMTV integration site family, member 1) Mus musculus

Analyze

Symbol:

Wnt1

Name:

wingless-type MMTV integration site family, member 1

RGD ID:

11491

MGI Page

MGI

Description:

Enables cytokine activity and protein domain specific binding activity. Involved in several processes, including astrocyte-dopaminergic neuron signaling; central nervous system development; and regulation of DNA-templated transcription. Acts upstream of or within several processes, including hemopoiesis; nervous system development; and regulation of protein metabolic process. Located in cell surface and extracellular region. Is expressed in several structures, including alimentary system; central nervous system; early conceptus; embryo ectoderm; and genitourinary system. Used to study breast cancer. Human ortholog(s) of this gene implicated in osteogenesis imperfecta type 15 and osteoporosis. Orthologous to human WNT1 (Wnt family member 1).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Int; Int-1; proto-oncogene Int-1; proto-oncogene protein Wnt-1; proto-oncogene Wnt-1; sw; swaying; wingless-related MMTV integration site 1; Wnt-; Wnt-1

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	WNT1 (Wnt family member 1)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Wnt1 (Wnt family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Wnt1 (Wnt family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	WNT1 (Wnt family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	WNT1 (Wnt family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Wnt1 (Wnt family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	WNT1 (Wnt family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	WNT1 (Wnt family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Wnt1 (Wnt family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	WNT1 (Wnt family member 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Rattus norvegicus (Norway rat):	Wnt1 (Wnt family member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	wnt1 (wingless-type MMTV integration site family, member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Drosophila melanogaster (fruit fly):	wg	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	98,687,738 - 98,691,711 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	98,687,738 - 98,691,718 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	98,789,857 - 98,793,830 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	98,789,857 - 98,793,837 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	98,620,288 - 98,624,261 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	98,617,891 - 98,621,864 (+)	NCBI		MGSCv36	mm8
Celera	15	100,939,306 - 100,943,279 (+)	NCBI		Celera
Cytogenetic Map	15	F1	NCBI
cM Map	15	54.65	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (IEP)

breast cancer (IAGP)

connective tissue disease (ISO)

Experimental Mammary Neoplasms (IDA)

genetic disease (ISO)

keratoconus (ISO)

osteogenesis imperfecta (ISO)

osteogenesis imperfecta type 15 (ISO)

osteogenesis imperfecta type 3 (ISO)

osteoporosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP)

3-isobutyl-1-methyl-7H-xanthine (EXP)

3-methyl-3H-imidazo[4,5-f]quinolin-2-amine (EXP)

4,4'-sulfonyldiphenol (EXP)

5-aza-2'-deoxycytidine (EXP)

aldehydo-D-glucose (ISO)

allethrin (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzene (EXP)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

bleomycin A2 (EXP)

cadmium dichloride (ISO)

cannabidiol (EXP)

carbon nanotube (EXP)

CGP 52608 (ISO)

chlorpyrifos (ISO)

copper(II) sulfate (ISO)

curcumin (ISO)

cyhalothrin (ISO)

cypermethrin (ISO)

D-glucose (ISO)

delta-tocotrienol (ISO)

dexamethasone (EXP,ISO)

dibenz[a,h]anthracene (EXP)

dichromium trioxide (ISO)

dimethylarsinic acid (ISO)

ethosuximide (ISO)

fenvalerate (ISO)

folic acid (EXP)

glucose (ISO)

glycerol 2-phosphate (ISO)

hydralazine (ISO)

hydrogen peroxide (ISO)

L-ascorbic acid 2-phosphate (ISO)

lead diacetate (ISO)

lead nitrate (ISO)

linalool (ISO)

lipopolysaccharide (ISO)

lithium chloride (ISO)

losartan (EXP,ISO)

maneb (ISO)

methylarsonic acid (ISO)

methylmercury chloride (EXP)

N-acetyl-L-cysteine (ISO)

nickel atom (ISO)

ochratoxin A (EXP,ISO)

paracetamol (EXP)

paraquat (EXP,ISO)

phenytoin (EXP)

reactive oxygen species (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

simazine (EXP)

sodium arsenite (EXP,ISO)

tebuconazole (ISO)

triptonide (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

animal organ morphogenesis (TAS)

animal organ regeneration (ISO)

astrocyte-dopaminergic neuron signaling (IMP)

BMP signaling pathway (ISO)

bone development (ISO)

branching involved in ureteric bud morphogenesis (IGI)

canonical Wnt signaling pathway (IBA,IDA,IGI,IMP,ISO,NAS,TAS)

canonical Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation (IDA)

cell fate commitment (IBA)

cell population proliferation (IDA)

cell proliferation in midbrain (IDA)

cell-cell signaling (IDA,TAS)

cellular response to peptide hormone stimulus (ISO)

central nervous system morphogenesis (IMP)

cerebellum development (IMP)

cerebellum formation (IMP)

diencephalon development (IGI)

dopaminergic neuron differentiation (IMP,TAS)

embryonic axis specification (IMP)

embryonic brain development (IDA)

fat cell differentiation (IDA)

forebrain anterior/posterior pattern specification (IGI)

hematopoietic stem cell proliferation (IDA)

hepatocyte differentiation (ISO)

inner ear morphogenesis (IGI)

metencephalon development (IMP)

midbrain development (IDA,IMP)

midbrain dopaminergic neuron differentiation (IMP)

midbrain-hindbrain boundary development (IMP)

midbrain-hindbrain boundary maturation during brain development (IMP)

myoblast fusion (IDA,IGI)

myotube differentiation (IGI)

negative regulation of apoptotic process (ISO)

negative regulation of BMP signaling pathway (ISO)

negative regulation of cell differentiation (IMP)

negative regulation of cell-cell adhesion (ISO)

negative regulation of cell-substrate adhesion (ISO)

negative regulation of cellular senescence (ISO)

negative regulation of fat cell differentiation (IDA,IMP)

negative regulation of oxidative stress-induced neuron death (IMP)

negative regulation of transforming growth factor beta receptor signaling pathway (IDA)

negative regulation of ubiquitin-dependent protein catabolic process (IDA)

neurogenesis (IDA)

neuron differentiation (IBA)

neuron fate commitment (IMP)

neuron fate determination (IMP)

obsolete negative regulation of cell aging (ISO)

positive regulation of cell population proliferation (ISO,TAS)

positive regulation of dermatome development (ISO)

positive regulation of DNA-binding transcription factor activity (IDA)

positive regulation of DNA-templated transcription (IDA,ISO)

positive regulation of fibroblast proliferation (ISO)

positive regulation of hematopoietic stem cell proliferation (IDA)

positive regulation of insulin-like growth factor receptor signaling pathway (ISO)

positive regulation of lamellipodium assembly (ISO)

positive regulation of Notch signaling pathway (ISO)

positive regulation of protein phosphorylation (IDA)

positive regulation of transcription by RNA polymerase II (IDA,IGI,NAS)

regulation of DNA-templated transcription (TAS)

response to wounding (ISO)

signal transduction (TAS)

signal transduction in response to DNA damage (ISO)

Spemann organizer formation (IMP)

spinal cord association neuron differentiation (IGI)

T cell differentiation in thymus (IDA)

ubiquitin-dependent SMAD protein catabolic process (IDA)

Wnt signaling pathway (IDA)

Cellular Component

cell surface (IDA)

cytoplasm (ISO)

endoplasmic reticulum lumen (TAS)

extracellular region (IDA)

extracellular space (IBA)

Wnt signalosome (IC)

Molecular Function

cytokine activity (IBA,IDA)

frizzled binding (IBA)

protein binding (IPI)

protein domain specific binding (IPI)

receptor ligand activity (IC,IDA,ISO)

signaling receptor binding (TAS)

Molecular Pathway Annotations Click to see Annotation Detail View

basal cell carcinoma pathway (IEA)

Hedgehog signaling pathway (IEA)

Wnt signaling pathway (IEA,IMP)

Wnt signaling, canonical pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal brain white matter morphology (IEA)

abnormal cerebellar cortex morphology (IEA)

abnormal cerebellum anterior vermis morphology (IEA)

abnormal cerebellum development (IEA)

abnormal cranial flexure morphology (IAGP)

abnormal dermomyotome development (IAGP)

abnormal dorsal-ventral axis patterning (IAGP)

abnormal endolymphatic duct morphology (IAGP)

abnormal forebrain development (IAGP)

abnormal forebrain morphology (IAGP)

abnormal frontal lobe morphology (IAGP)

abnormal gait (IEA)

abnormal hindbrain development (IAGP)

abnormal hindbrain morphology (IAGP)

abnormal inferior colliculus morphology (IEA)

abnormal innervation (IAGP)

abnormal locomotor coordination (IEA)

abnormal melanoblast morphology (IAGP)

abnormal metencephalon morphology (IAGP)

abnormal midbrain development (IAGP)

abnormal midbrain morphology (IAGP)

abnormal midbrain-hindbrain boundary development (IAGP)

abnormal motor coordination/balance (IAGP)

abnormal myotome development (IAGP)

abnormal neural crest cell morphology (IAGP)

abnormal parietal bone morphology (IAGP)

abnormal posture (IEA)

abnormal rhombomere morphology (IAGP)

abnormal thyroid cartilage morphology (IAGP)

absent cerebellum (IAGP)

absent hyoid bone (IAGP)

absent metencephalon (IAGP)

absent midbrain (IAGP)

absent midbrain-hindbrain boundary (IAGP)

absent stapes (IAGP)

ataxia (IAGP)

caudal body truncation (IAGP)

decreased midbrain size (IAGP)

decreased neuron number (IAGP)

decreased neuronal precursor cell number (IAGP)

decreased rhombomere 1 size (IAGP)

decreased thymocyte number (IAGP)

embryonic lethality during organogenesis, incomplete penetrance (IAGP)

hydrocephaly (IAGP)

impaired swimming (IEA)

increased circulating cholesterol level (IEA)

increased circulating creatinine level (IEA)

lethality throughout fetal growth and development, incomplete penetrance (IAGP)

muscle hypertonia (IEA)

neonatal lethality, complete penetrance (IAGP)

neonatal lethality, incomplete penetrance (IAGP)

premature neuronal precursor differentiation (IAGP)

prenatal lethality, complete penetrance (IAGP)

preweaning lethality, incomplete penetrance (IEA)

reduced linear vestibular evoked potential (IAGP)

small alisphenoid bone (IAGP)

small basisphenoid bone (IAGP)

small dorsal root ganglion (IAGP)

small otic capsule (IAGP)

small presphenoid bone (IAGP)

small temporal bone squamous part (IAGP)

weaving (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Wnt/ß-catenin signaling enhances osteoblastogenic differentiation from human periodontal ligament fibroblasts.	Heo JS, etal., Mol Cells. 2010 Nov;30(5):449-54. doi: 10.1007/s10059-010-0139-3. Epub 2010 Sep 10.
2.	Wnt signalling required for expansion of neural crest and CNS progenitors.	Ikeya M, etal., Nature. 1997 Oct 30;389(6654):966-70.
3.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
4.	MGDs mouse GO annotations	MGD data from the GO Consortium
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	The Wnt Homepage	Roel Nusse - Howard Hughes Medical Institute and the Department of Developmental Biology at Stanford University, California, USA
11.	Cooperative induction of mammary tumorigenesis by TGFalpha and Wnts.	Schroeder JA, etal., Oncogene. 2000 Jun 29;19(28):3193-9.
12.	Transformation by Wnt family proteins correlates with regulation of beta-catenin.	Shimizu H, etal., Cell Growth Differ. 1997 Dec;8(12):1349-58.
13.	Alternative wnt signaling is initiated by distinct receptors.	van Amerongen R, etal., Sci Signal. 2008 Sep 2;1(35):re9.
14.	Differential transformation of mammary epithelial cells by Wnt genes.	Wong GT, etal., Mol Cell Biol. 1994 Sep;14(9):6278-86.

Additional References at PubMed

PMID:1295734	PMID:1349587	PMID:1354638	PMID:1358803	PMID:1360404	PMID:1377062	PMID:1379621	PMID:1386556	PMID:1401899	PMID:1534034	PMID:1535241	PMID:1617723
PMID:1695322	PMID:1794049	PMID:1797232	PMID:1835670	PMID:1846319	PMID:1981055	PMID:2202907	PMID:2205396	PMID:2279700	PMID:2429320	PMID:2534596	PMID:2566557
PMID:2882510	PMID:2885263	PMID:2907320	PMID:3018519	PMID:3111720	PMID:3180222	PMID:3293998	PMID:3471390	PMID:3594565	PMID:3594566	PMID:6091914	PMID:6297757
PMID:6318122	PMID:6321961	PMID:6690234	PMID:7482350	PMID:7490102	PMID:7556445	PMID:7561827	PMID:7566980	PMID:7571419	PMID:7577673	PMID:7587381	PMID:7601910
PMID:7660319	PMID:7705663	PMID:7743923	PMID:7768185	PMID:7841657	PMID:7846766	PMID:7884899	PMID:7892260	PMID:7896292	PMID:7925022	PMID:7925023	PMID:7947319
PMID:7958454	PMID:7987839	PMID:7988795	PMID:8050356	PMID:8058323	PMID:8094303	PMID:8111977	PMID:8157699	PMID:8166667	PMID:8222343	PMID:8224845	PMID:8251184
PMID:8268655	PMID:8275860	PMID:8299937	PMID:8380647	PMID:8386870	PMID:8441400	PMID:8463278	PMID:8464495	PMID:8482578	PMID:8555108	PMID:8555114	PMID:8575294
PMID:8597630	PMID:8597644	PMID:8621489	PMID:8626038	PMID:8645601	PMID:8668193	PMID:8710372	PMID:8848044	PMID:8872459	PMID:8887544	PMID:8906497	PMID:8910786
PMID:8951055	PMID:8995189	PMID:9006071	PMID:9056772	PMID:9070329	PMID:9159136	PMID:9160667	PMID:9169087	PMID:9192640	PMID:9205106	PMID:9247260	PMID:9247335
PMID:9256343	PMID:9260931	PMID:9342056	PMID:9342439	PMID:9356179	PMID:9362461	PMID:9405645	PMID:9407023	PMID:9419974	PMID:9434954	PMID:9441669	PMID:9449667
PMID:9473323	PMID:9486536	PMID:9521907	PMID:9576833	PMID:9585504	PMID:9598343	PMID:9620767	PMID:9652750	PMID:9680378	PMID:9733573	PMID:9753670	PMID:9769173
PMID:9799734	PMID:9808626	PMID:9811581	PMID:9843687	PMID:9889131	PMID:9891778	PMID:9895322	PMID:9926929	PMID:9988215	PMID:10079236	PMID:10090727	PMID:10197631
PMID:10213494	PMID:10339439	PMID:10349636	PMID:10354469	PMID:10398531	PMID:10409502	PMID:10449357	PMID:10477297	PMID:10490024	PMID:10518499	PMID:10557084	PMID:10585256
PMID:10589677	PMID:10603349	PMID:10640709	PMID:10642791	PMID:10693795	PMID:10713683	PMID:10733525	PMID:10751172	PMID:10756063	PMID:10842066	PMID:10866835	PMID:10937998
PMID:10946068	PMID:11029007	PMID:11029008	PMID:11038171	PMID:11042159	PMID:11071781	PMID:11076861	PMID:11124114	PMID:11217851	PMID:11265645	PMID:11287179	PMID:11336703
PMID:11357136	PMID:11429295	PMID:11448771	PMID:11459829	PMID:11493561	PMID:11500373	PMID:11511541	PMID:11520664	PMID:11532882	PMID:11532921	PMID:11532991	PMID:11704761
PMID:11731459	PMID:11731460	PMID:11748135	PMID:11751871	PMID:11823447	PMID:11832495	PMID:11834740	PMID:11877374	PMID:11900971	PMID:11920562	PMID:11956231	PMID:12015971
PMID:12054580	PMID:12121999	PMID:12153396	PMID:12154096	PMID:12242712	PMID:12361972	PMID:12367504	PMID:12379851	PMID:12412008	PMID:12421714	PMID:12429977	PMID:12466851
PMID:12477932	PMID:12569128	PMID:12645927	PMID:12645929	PMID:12668639	PMID:12682014	PMID:12697065	PMID:12736208	PMID:12815618	PMID:12832534	PMID:12874124	PMID:12915124
PMID:12915301	PMID:12937339	PMID:14507778	PMID:14557550	PMID:14597577	PMID:14605369	PMID:14651936	PMID:14668450	PMID:14681479	PMID:14716020	PMID:14732490	PMID:14975722
PMID:15035989	PMID:15044261	PMID:15053978	PMID:15057272	PMID:15057752	PMID:15064719	PMID:15105370	PMID:15105374	PMID:15116386	PMID:15121182	PMID:15143170	PMID:15183721
PMID:15194563	PMID:15207262	PMID:15207855	PMID:15226823	PMID:15265686	PMID:15282335	PMID:15308626	PMID:15337757	PMID:15342465	PMID:15454084	PMID:15469980	PMID:15489334
PMID:15496414	PMID:15496443	PMID:15525667	PMID:15546883	PMID:15568017	PMID:15574752	PMID:15576404	PMID:15580630	PMID:15607945	PMID:15623804	PMID:15678491	PMID:15680361
PMID:15691760	PMID:15708565	PMID:15728361	PMID:15790971	PMID:15802266	PMID:15809042	PMID:15837799	PMID:15857913	PMID:15880404	PMID:15888552	PMID:15950605	PMID:15961523
PMID:15979579	PMID:16054034	PMID:16061670	PMID:16098141	PMID:16116452	PMID:16126904	PMID:16141072	PMID:16141073	PMID:16168404	PMID:16207730	PMID:16221730	PMID:16235133
PMID:16243425	PMID:16273520	PMID:16294019	PMID:16339193	PMID:16364898	PMID:16414173	PMID:16423343	PMID:16458284	PMID:16510589	PMID:16530751	PMID:16540515	PMID:16543246
PMID:16571630	PMID:16571633	PMID:16575902	PMID:16601693	PMID:16602821	PMID:16651541	PMID:16678101	PMID:16728479	PMID:16790481	PMID:16801545	PMID:16908522	PMID:16908535
PMID:16920709	PMID:16950122	PMID:16973609	PMID:17030179	PMID:17055474	PMID:17060457	PMID:17064353	PMID:17067568	PMID:17143295	PMID:17143296	PMID:17150206	PMID:17151198
PMID:17166916	PMID:17202265	PMID:17239604	PMID:17241623	PMID:17257418	PMID:17280871	PMID:17350462	PMID:17360769	PMID:17366625	PMID:17372190	PMID:17428831	PMID:17481602
PMID:17488627	PMID:17522159	PMID:17537797	PMID:17582687	PMID:17654715	PMID:17673212	PMID:17676634	PMID:17687036	PMID:17690294	PMID:17855431	PMID:17916349	PMID:17922007
PMID:17943183	PMID:17953485	PMID:17971207	PMID:18057099	PMID:18086577	PMID:18094027	PMID:18187455	PMID:18199579	PMID:18201971	PMID:18216176	PMID:18241853	PMID:18297060
PMID:18330926	PMID:18331719	PMID:18351675	PMID:18364260	PMID:18427129	PMID:18429041	PMID:18459960	PMID:18462697	PMID:18480159	PMID:18480464	PMID:18483247	PMID:18505367
PMID:18511911	PMID:18522499	PMID:18536717	PMID:18539270	PMID:18601749	PMID:18635608	PMID:18697834	PMID:18769115	PMID:18800919	PMID:18820178	PMID:18838463	PMID:18929642
PMID:18930042	PMID:18953410	PMID:19056356	PMID:19061838	PMID:19093031	PMID:19097048	PMID:19103755	PMID:19129494	PMID:19149881	PMID:19170762	PMID:19179402	PMID:19185060
PMID:19225568	PMID:19267898	PMID:19282366	PMID:19285468	PMID:19298856	PMID:19334287	PMID:19339510	PMID:19380520	PMID:19422288	PMID:19473496	PMID:19515997	PMID:19527706
PMID:19556343	PMID:19557172	PMID:19562671	PMID:19592574	PMID:19616131	PMID:19628668	PMID:19668217	PMID:19725118	PMID:19732765	PMID:19733540	PMID:19734317	PMID:19741143
PMID:19793884	PMID:19796621	PMID:19841259	PMID:19842188	PMID:19846726	PMID:19850029	PMID:19861162	PMID:19924825	PMID:19951692	PMID:19956832	PMID:19968985	PMID:20011526
PMID:20028388	PMID:20107508	PMID:20118494	PMID:20159958	PMID:20171206	PMID:20206242	PMID:20359476	PMID:20383322	PMID:20404086	PMID:20457670	PMID:20532162	PMID:20565980
PMID:20610763	PMID:20627076	PMID:20652258	PMID:20682799	PMID:20699298	PMID:20702562	PMID:20816794	PMID:20829439	PMID:20890044	PMID:20940229	PMID:20960561	PMID:20980404
PMID:21041481	PMID:21044957	PMID:21078992	PMID:21147849	PMID:21172336	PMID:21209331	PMID:21244856	PMID:21246653	PMID:21246658	PMID:21262207	PMID:21267068	PMID:21270710
PMID:21285411	PMID:21307096	PMID:21321190	PMID:21347250	PMID:21377456	PMID:21394823	PMID:21425415	PMID:21451048	PMID:21501592	PMID:21539518	PMID:21539826	PMID:21552538
PMID:21636700	PMID:21664901	PMID:21677750	PMID:21691068	PMID:21698205	PMID:21713770	PMID:21731673	PMID:21752258	PMID:21752929	PMID:21761482	PMID:21768372	PMID:21857982
PMID:21858009	PMID:21858141	PMID:21858154	PMID:21873635	PMID:21880902	PMID:21917789	PMID:21925158	PMID:21929743	PMID:21936019	PMID:21963425	PMID:22007134	PMID:22046319
PMID:22085926	PMID:22110056	PMID:22158103	PMID:22166339	PMID:22173107	PMID:22190459	PMID:22232070	PMID:22272614	PMID:22278924	PMID:22290867	PMID:22291885	PMID:22434869
PMID:22494971	PMID:22572818	PMID:22625652	PMID:22627288	PMID:22677559	PMID:22710872	PMID:22718343	PMID:22733757	PMID:22778034	PMID:22846569	PMID:22956684	PMID:22993445
PMID:23041116	PMID:23041177	PMID:23074223	PMID:23094090	PMID:23152495	PMID:23190887	PMID:23324743	PMID:23376422	PMID:23393138	PMID:23420609	PMID:23444352	PMID:23444360
PMID:23499309	PMID:23553522	PMID:23583383	PMID:23585476	PMID:23592779	PMID:23618354	PMID:23648512	PMID:23754280	PMID:23778311	PMID:23827310	PMID:23884445	PMID:23892366
PMID:24067880	PMID:24080509	PMID:24151333	PMID:24194600	PMID:24315444	PMID:24335253	PMID:24348261	PMID:24394376	PMID:24586192	PMID:24610003	PMID:24623077	PMID:24634143
PMID:24706781	PMID:24715462	PMID:24718611	PMID:24865218	PMID:24929002	PMID:24952961	PMID:24961246	PMID:24982181	PMID:24995796	PMID:25053429	PMID:25092896	PMID:25318560
PMID:25422594	PMID:25443287	PMID:25456121	PMID:25483966	PMID:25528224	PMID:25677507	PMID:25761772	PMID:25799573	PMID:26045742	PMID:26049140	PMID:26118627	PMID:26164566
PMID:26204899	PMID:26311466	PMID:26411367	PMID:26443994	PMID:26444681	PMID:26450967	PMID:26452989	PMID:26527802	PMID:26537990	PMID:26542012	PMID:26735577	PMID:26879466
PMID:26903501	PMID:27001213	PMID:27144312	PMID:27171818	PMID:27184910	PMID:27302397	PMID:27341073	PMID:27362799	PMID:27414798	PMID:27578777	PMID:27770010	PMID:27864382
PMID:28003366	PMID:28069795	PMID:28074006	PMID:28199987	PMID:28424350	PMID:28576832	PMID:28628032	PMID:28813421	PMID:28834739	PMID:28893947	PMID:29069662	PMID:29246763
PMID:29321139	PMID:29437830	PMID:29526736	PMID:29891676	PMID:30347193	PMID:30404864	PMID:30470704	PMID:30477246	PMID:30509497	PMID:30651295	PMID:30690791	PMID:30940800
PMID:31038803	PMID:31185248	PMID:31226309	PMID:31371375	PMID:31582804	PMID:31647919	PMID:31869353	PMID:32369212	PMID:32439762	PMID:32553152	PMID:32703236	PMID:32708917
PMID:32741376	PMID:32979334	PMID:33046507	PMID:33060832	PMID:33139146	PMID:33141892	PMID:33188033	PMID:33189914	PMID:33195246	PMID:33283877	PMID:33469032	PMID:33567267
PMID:33737325	PMID:33932339	PMID:33935652	PMID:34321664	PMID:34722541	PMID:34759273	PMID:34884468	PMID:35120575	PMID:35514236	PMID:35603707	PMID:35781329	PMID:35831952
PMID:35863746	PMID:36210210	PMID:36305473

Genomics

Comparative Map Data

Wnt1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	98,687,738 - 98,691,711 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	98,687,738 - 98,691,718 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	98,789,857 - 98,793,830 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	98,789,857 - 98,793,837 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	98,620,288 - 98,624,261 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	98,617,891 - 98,621,864 (+)	NCBI		MGSCv36	mm8
Celera	15	100,939,306 - 100,943,279 (+)	NCBI		Celera
Cytogenetic Map	15	F1	NCBI
cM Map	15	54.65	NCBI

WNT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	48,978,322 - 48,982,620 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	12	48,978,322 - 48,982,620 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	49,372,105 - 49,376,403 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	47,658,503 - 47,662,746 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	47,658,502 - 47,662,746	NCBI
Celera	12	48,167,028 - 48,171,188 (+)	NCBI		Celera
Cytogenetic Map	12	q13.12	NCBI
HuRef	12	46,403,758 - 46,407,918 (+)	NCBI		HuRef
CHM1_1	12	49,338,028 - 49,342,188 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	48,940,505 - 48,944,803 (+)	NCBI		T2T-CHM13v2.0

Wnt1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	129,938,604 - 129,942,651 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	129,938,604 - 129,942,651 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	131,745,620 - 131,749,666 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	7	133,971,174 - 133,975,220 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	7	133,883,687 - 133,887,733 (+)	NCBI	Rnor_WKY
Rnor_6.0	7	140,464,999 - 140,469,046 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	140,464,999 - 140,469,046 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	114,975,118 - 114,979,165 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	137,557,836 - 137,561,883 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	126,427,473 - 126,431,520 (+)	NCBI		Celera
Cytogenetic Map	7	q36	NCBI

Wnt1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955500	7,797,060 - 7,811,167 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955500	7,797,063 - 7,811,142 (+)	NCBI	ChiLan1.0	ChiLan1.0

WNT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	12	40,648,413 - 40,652,583 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	40,648,413 - 40,652,583 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	12	39,767,839 - 39,772,460 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

WNT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	5,588,151 - 5,592,254 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	5,574,940 - 5,592,060 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	40,665,906 - 40,669,560 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	5,639,156 - 5,642,810 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	5,639,162 - 5,643,065 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	5,603,082 - 5,606,734 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	5,593,278 - 5,596,931 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	41,058,211 - 41,061,867 (+)	NCBI		UU_Cfam_GSD_1.0

Wnt1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	66,379,465 - 66,383,960 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936512	6,780,882 - 6,785,358 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936512	6,781,001 - 6,785,358 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WNT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	15,010,786 - 15,014,998 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	15,010,607 - 15,015,007 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	15,420,829 - 15,425,219 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

WNT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	45,217,402 - 45,222,996 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	45,219,027 - 45,222,017 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	200,920,985 - 200,926,676 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wnt1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624816	3,209,699 - 3,212,606 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624816	3,209,605 - 3,212,969 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

miRNA Target Status

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
Mir122	mmu-miR-122-5p	OncomiRDB	external_info	NA	NA	22276989

Predicted Target Of

	Summary Value
Count of predictions:	487
Count of miRNA genes:	313
Interacting mature miRNAs:	351
Transcripts:	ENSMUST00000023734
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
26884442	Sklq6_m	skull length QTL 6, 5 week (mouse)					15	6129481	100797881	Mouse
1357526	Hyplip2_m	hyperlipidemia 2 (mouse)			Not determined		15	12402203	102896555	Mouse
26884425	Cvht2_m	cranial vault height 2, 5 week (mouse)					15	28800146	102008435	Mouse
1558985	Eae32_m	experimental allergic encephalomyelitis susceptibility 32 (mouse)			Not determined		15	32578416	103425899	Mouse
26884399	Humsd1_m	humerus midshaft diameter 1, 5 week (mouse)					15	48363396	101708435	Mouse
1302074	Bmd4_m	bone mineral density 4 (mouse)			Not determined		15	56186708	103425899	Mouse
1302197	Bhr2_m	bronchial hyperresponsiveness 2 (mouse)			Not determined		15	64306334	103425899	Mouse
4141135	Cia35_m	collagen induced arthritis 35 (mouse)			Not determined		15	64811826	98811946	Mouse
1301119	Drb7_m	dopamine receptor binding 7 (mouse)			Not determined		15	65336578	99341028	Mouse
1301171	Brm2_m	brachyury modifier 2 (mouse)			Not determined		15	65525376	99525499	Mouse
4141921	Pstc3_m	periosteal circumference 3 (mouse)			Not determined		15	67270698	101270847	Mouse
1300627	Sluc26_m	susceptibility to lung cancer 26 (mouse)			Not determined		15	70345653	104073951	Mouse
1300648	Dbsty4_m	diabesity 4 (mouse)			Not determined		15	70349271	104073951	Mouse
1300726	Pitm4_m	prion incubation time 4 (mouse)			Not determined		15	70349271	104073951	Mouse
14747011	Mancz13_m	mandible centroid size 13 (mouse)					15	72382669	104073951	Mouse
12791003	Aath8_m	aortic arch atherosclerosis 8 (mouse)					15	73430144	104073951	Mouse
1300851	Heal4_m	wound healing/regeneration 4 (mouse)			Not determined		15	77527592	104073951	Mouse
4142060	W3q6_m	weight 3 weeks QTL 6 (mouse)			Not determined			78601103	102901704	Mouse
1357894	Epfpq3_m	epididymal fat percentage QTL 3 (mouse)			Not determined		15	78601103	102901704	Mouse
14928306	Manh79_m	mandible shape 79 (mouse)					15	78847557	104073951	Mouse
12880411	V125Dq11_m	vitamin D active form serum level QTL 11 (mouse)					15	78897881	104073951	Mouse
10402490	Dipa5_m	drug induced psychomotor activation 5 (mouse)			Not determined		15	79163411	104073951	Mouse
4141897	Imrfq2_m	immune response to Factor IX QTL 2 (mouse)			Not determined			79908940	104073951	Mouse
1301284	Cosz3_m	cocaine seizure 3 (mouse)			Not determined		15	80313634	104073951	Mouse
4141902	Cia37_m	collagen induced arthritis 37 (mouse)			Not determined		15	80884933	104073951	Mouse
1300974	Pgia9_m	proteoglycan induced arthritis 9 (mouse)			Not determined		15	80884933	104073951	Mouse
4141511	Gdcr1_m	glycerolphosphate dehydrogenase regulator 1 (mouse)			Not determined			82615474	104073951	Mouse
11530037	Sluc34a_m	susceptibility to lung cancer 34a (mouse)					15	85896437	104073951	Mouse
11530038	Sluc34b_m	susceptibility to lung cancer 34b (mouse)					15	85896437	104073951	Mouse
1357614	Bmca_m	bile mucin accumulation (mouse)			Not determined		15	85896437	104073951	Mouse
1301918	Skull22_m	skull morphology 22 (mouse)			Not determined		15	85901546	104073951	Mouse
4141581	Dshv1_m	dorsal hippocampal volume 1 (mouse)			Not determined			92788640	103425899	Mouse
14700689	Carg5_m	Candida albicans resistance gene 5 (mouse)					15	97697881	103008427	Mouse
11528547	Sluc34_m	susceptibility to lung cancer 34 (mouse)					15	97884933	102896555	Mouse

Markers in Region

Wnt1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	98,793,109 - 98,793,684	UniSTS	GRCm38
MGSCv37	15	98,623,540 - 98,624,115	UniSTS	GRCm37
Celera	15	100,942,558 - 100,943,133	UniSTS
Cytogenetic Map	15	F1-F3	UniSTS
cM Map	15	56.8	UniSTS
cM Map	15	56.8	UniSTS
cM Map	15	56.8	UniSTS

M11943

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	98,792,926 - 98,793,015	UniSTS	GRCm38
MGSCv37	15	98,623,357 - 98,623,446	UniSTS	GRCm37
Celera	15	100,942,375 - 100,942,464	UniSTS
Cytogenetic Map	15	F1-F3	UniSTS
Whitehead/MRC_RH	15	875.67	UniSTS

PMC195989P1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	98,788,623 - 98,789,315	UniSTS	GRCm38
MGSCv37	15	98,619,054 - 98,619,746	UniSTS	GRCm37
Celera	15	100,938,072 - 100,938,764	UniSTS
Cytogenetic Map	15	F1-F3	UniSTS

Wnt1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	98,792,883 - 98,793,727	UniSTS	GRCm38
MGSCv37	15	98,623,314 - 98,624,158	UniSTS	GRCm37
Celera	15	100,942,332 - 100,943,176	UniSTS
Cytogenetic Map	15	F1-F3	UniSTS

Wnt1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	15	F1-F3	UniSTS

Wnt1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	98,793,601 - 98,793,753	UniSTS	GRCm38
MGSCv37	15	98,624,032 - 98,624,184	UniSTS	GRCm37
Celera	15	100,943,050 - 100,943,202	UniSTS
Cytogenetic Map	15	F1-F3	UniSTS

Wnt1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	98,792,671 - 98,793,269	UniSTS	GRCm38
MGSCv37	15	98,623,102 - 98,623,700	UniSTS	GRCm37
Celera	15	100,942,120 - 100,942,718	UniSTS
Cytogenetic Map	15	F1-F3	UniSTS

Wnt1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	98,791,925 - 98,792,584	UniSTS	GRCm38
MGSCv37	15	98,622,356 - 98,623,015	UniSTS	GRCm37
Celera	15	100,941,374 - 100,942,033	UniSTS
Cytogenetic Map	15	F1-F3	UniSTS

Wnt1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	98,793,639 - 98,793,801	UniSTS	GRCm38
MGSCv37	15	98,624,070 - 98,624,232	UniSTS	GRCm37
Celera	15	100,943,088 - 100,943,250	UniSTS
Cytogenetic Map	15	F1-F3	UniSTS
cM Map	15	56.8	UniSTS

Wnt1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	98,790,567 - 98,790,688	UniSTS	GRCm38
MGSCv37	15	98,620,998 - 98,621,119	UniSTS	GRCm37
Celera	15	100,940,016 - 100,940,137	UniSTS
Cytogenetic Map	15	F1-F3	UniSTS
cM Map	15	56.8	UniSTS

Wnt1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	98,788,940 - 98,789,079	UniSTS	GRCm38
MGSCv37	15	98,619,371 - 98,619,510	UniSTS	GRCm37
Celera	15	100,938,389 - 100,938,528	UniSTS
Cytogenetic Map	15	F1-F3	UniSTS
cM Map	15	56.8	UniSTS

Wnt1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	98,790,134 - 98,790,908	UniSTS	GRCm38
MGSCv37	15	98,620,565 - 98,621,339	UniSTS	GRCm37
Celera	15	100,939,583 - 100,940,357	UniSTS
Cytogenetic Map	15	F1-F3	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_021279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB039234	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB039236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB039237	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB039238	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB039239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB039240	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB039241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB039242	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC156543	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK141669	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC005449	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466550	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	K02593	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M11943	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000023734 ⟹ ENSMUSP00000023734

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	15	98,687,738 - 98,691,718 (+)	Ensembl
GRCm38.p6 Ensembl	15	98,789,857 - 98,793,837 (+)	Ensembl

RefSeq Acc Id:

NM_021279 ⟹ NP_067254

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	15	98,687,738 - 98,691,711 (+)	NCBI
GRCm38	15	98,789,857 - 98,793,830 (+)	NCBI
MGSCv37	15	98,620,288 - 98,624,261 (+)	RGD
Celera	15	100,939,306 - 100,943,279 (+)	RGD
cM Map	15		ENTREZGENE

Sequence:

show sequence

GCCACAGCTTCGCTCGCCACTCATTGTCTGTGGCCCTGACCAGTGCGCCCTGGTGCTTTTAGTG
CCGCCCGGGCCCGGAGGGGCAGCCTCTTCTCACTGCAGTCAGCGCCGCAACTATAAGAGGCCTA
TAAGAGGCGGTGCCTCCCGCAGTGGCTGCTTCAGCCCAGCAGCCAGGACAGCGAACCATGCTGC
CTGCGGCCCGCCTCCAGACTTATTAGAGCCAGCCTGGGAACTCGCATCACTGCCCTCACCGCTG
TGTCCAGTCCCACCGTCGCGGACAGCAACCACAGTCGTCAGAACCGCAGCACAGAACCAGCAAG
GCCAGGCAGGCCATGGGGCTCTGGGCGCTGCTGCCCAGCTGGGTTTCTACTACGTTGCTACTGG
CACTGACCGCTCTGCCCGCAGCCCTGGCTGCCAACAGTAGTGGCCGATGGTGGGGCATCGTGAA
CATAGCCTCCTCCACGAACCTGTTGACGGATTCCAAGAGTCTGCAGCTGGTGCTCGAGCCCAGT
CTGCAGCTGCTGAGCCGCAAGCAGCGGCGACTGATCCGACAGAACCCGGGGATCCTGCACAGCG
TGAGTGGAGGGCTCCAGAGCGCTGTGCGAGAGTGCAAATGGCAATTCCGAAACCGCCGCTGGAA
CTGCCCCACTGCTCCGGGGCCCCACCTCTTCGGCAAGATCGTCAACCGAGGCTGCCGAGAAACA
GCGTTCATCTTCGCAATCACCTCCGCCGGGGTCACACATTCCGTGGCGCGCTCCTGCTCCGAAG
GCTCCATCGAGTCCTGCACCTGCGACTACCGGCGGCGCGGCCCTGGGGGCCCCGACTGGCACTG
GGGGGGCTGCAGTGACAACATCGATTTTGGTCGCCTCTTTGGCCGAGAGTTCGTGGACTCCGGG
GAGAAGGGGCGGGACCTACGCTTCCTCATGAACCTTCACAACAACGAGGCAGGGCGAACGACCG
TGTTCTCTGAGATGCGCCAAGAGTGCAAATGCCACGGGATGTCCGGCTCCTGCACGGTGCGCAC
GTGTTGGATGCGGCTGCCCACGCTGCGCGCTGTGGGCGACGTGCTGCGCGACCGCTTCGACGGC
GCCTCCCGCGTCCTTTACGGCAACCGAGGCAGCAACCGCGCCTCGCGGGCGGAGCTGCTGCGCC
TGGAGCCCGAAGACCCCGCGCACAAGCCTCCCTCCCCTCACGACCTCGTCTACTTCGAGAAATC
GCCCAACTTCTGCACGTACAGTGGCCGCCTGGGCACAGCTGGCACAGCTGGACGAGCTTGCAAC
AGCTCGTCTCCCGCGCTGGACGGCTGTGAGCTGCTGTGCTGTGGCCGAGGCCACCGCACGCGCA
CGCAGCGCGTCACGGAGCGCTGCAACTGCACCTTCCACTGGTGCTGCCACGTCAGCTGCCGCAA
CTGCACGCACACGCGCGTTCTGCACGAGTGTCTATGAGGTGCCGCGCCTCCGGGAACGGGAACG
CTCTCTTCCAGTTCTCAGACACACTCGCTGGTCCTGATGTTTGCCCACCCTACCGCGTCCAGCC
ACAGTCCCAGGGTTCATAGCGATCCATCTCTCCCACCTCCTACCTGGGGACTCCTGAAACCACT
TGCCTGAGTCGGCTCGAACCCTTTTGCCATCCTGAGGGCCCTGACCCAGCCTACCTCCCTCCCT
CTTTGAGGGAGACTCCTTTTGCACTGCCCCCCAATTTGGCCAGAGGGTGAGAGAAAGATTCTTC
TTCTGGGGTGGGGGTGGGGAGGTCAACTCTTGAAGGTGTTGCGGTTCCTGATGTATTTTGCGCT
GTGACCTCTTTGGGTATTATCACCTTTCCTTGTCTCTCGGGTCCCTATAGGTCCCTTGAGTTCT
CTAACCAGCACCTCTGGGCTTCAAGGCCTTTCCCCTCCCACCTGTAGCTGAAGAGTTTCCGAGT
TGAAAGGGCACGGAAAGCTAAGTGGGAAAGGAGGTTGCTGGACCCAGCAGCAAAACCCTACATT
CTCCTTGTCTCTGCCTCGGAGCCATTGAACAGCTGTGAACCATGCCTCCCTCAGCCTCCTCCCA
CCCCTTCCTGTCCTGCCTCCTCATCACTGTGTAAATAATTTGCACCGAAATGTGGCCGCAGAGC
CACGCGTTCGGTTATGTAAATAAAACTATTTATTGTGCTGGGTTCCAGCCTGGGTTGCAGAGAC
CACCCTCACCCCACCTCACTGCTCCTCTGTTCTGCTCGCCAGTCCTTTTGTTATCCGACCTTTT
TTCTCTTTTACCCAGCTTCTCATAGGCGCCCTTGCCCACCGGATCAGTATTTCCTTCCACTGTA
GCTATTAGTGGCTCCTCGCCCCCACCAATGTAGTATCTTCCTCTGAGGAATAAAATATCTATTT
TTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_067254	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA39321	(Get FASTA)	NCBI Sequence Viewer
	AAA39322	(Get FASTA)	NCBI Sequence Viewer
	AAH05449	(Get FASTA)	NCBI Sequence Viewer
	BAB68758	(Get FASTA)	NCBI Sequence Viewer
	BAB68760	(Get FASTA)	NCBI Sequence Viewer
	BAB68761	(Get FASTA)	NCBI Sequence Viewer
	BAB68762	(Get FASTA)	NCBI Sequence Viewer
	BAB68763	(Get FASTA)	NCBI Sequence Viewer
	BAB68764	(Get FASTA)	NCBI Sequence Viewer
	BAB68765	(Get FASTA)	NCBI Sequence Viewer
	BAB68766	(Get FASTA)	NCBI Sequence Viewer
	BAE24792	(Get FASTA)	NCBI Sequence Viewer
	EDL04166	(Get FASTA)	NCBI Sequence Viewer
	P04426	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_067254 ⟸ NM_021279
- Peptide Label:	precursor
- UniProtKB:	P04426 (UniProtKB/Swiss-Prot), Q3UR96 (UniProtKB/TrEMBL), A0A8C6G7X7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGLWALLPSWVSTTLLLALTALPAALAANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPSLQLL SRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIF AITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGR DLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRV LYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSP ALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL hide sequence

RefSeq Acc Id:

ENSMUSP00000023734 ⟸ ENSMUST00000023734

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P04426-F1-model_v2	AlphaFold	P04426	1-370	view protein structure

Promoters

RGD ID:

6849067

Promoter ID:

MM_XEF:2679

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Lung

Transcripts:

NM_001043850, NM_001101736, NM_001164982, NM_130951, NM_164746

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	15	98,621,271 - 98,621,771 (+)	MPROMDB

RGD ID:

6849060

Promoter ID:

MM_XEF:2680

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Lung

Transcripts:

NM_001114350, NM_001123500

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	15	98,621,971 - 98,622,471 (+)	MPROMDB

RGD ID:

8684938

Promoter ID:

EPDNEW_M20500

Type:

initiation region

Name:

Wnt1_1

Description:

Mus musculus wingless-type MMTV integration site family, member1 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	15	98,789,845 - 98,789,905	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:98953	AgrOrtholog
Ensembl Genes	ENSMUSG00000022997	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000023734	ENTREZGENE
	ENSMUSP00000023734.8	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000023734	ENTREZGENE
	ENSMUST00000023734.8	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.2460.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Wnt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Wnt1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Wnt_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Wnt_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:22408	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:98953	ENTREZGENE
NCBI Gene	22408	ENTREZGENE
PANTHER	PROTO-ONCOGENE WNT-1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR12027	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	wnt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Wnt1	PhenoGen
PRINTS	WNT1PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WNTPROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	WNT1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	WNT1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8C6G7X7	ENTREZGENE
	P04426	ENTREZGENE
	Q3UR96	ENTREZGENE, UniProtKB/TrEMBL
	WNT1_MOUSE	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-07-01	Wnt1	wingless-type MMTV integration site family, member 1		wingless-related MMTV integration site 1	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Mammalian Phenotype