S100b (S100 protein, beta polypeptide, neural)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: S100b (S100 protein, beta polypeptide, neural) Mus musculus

Analyze

Symbol:

S100b

Name:

S100 protein, beta polypeptide, neural

RGD ID:

11252

MGI Page

MGI

Description:

Is expressed in several structures, including alimentary system; integumental system; nervous system; respiratory system; and sensory organ. Human ortholog(s) of this gene implicated in Alzheimer's disease; Parkinson's disease; aspergillosis; and schizophrenia. Orthologous to human S100B (S100 calcium binding protein B); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH (S)-nicotine; 1,2-dimethylhydrazine; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Also known as:

AI850290; Bpb; MGC74317; protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	S100B (S100 calcium binding protein B)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	S100b (S100 calcium binding protein B)	HGNC	Treefam, EggNOG, NCBI, OMA, HomoloGene, Inparanoid, Panther, PhylomeDB, OrthoDB, Ensembl
Chinchilla lanigera (long-tailed chinchilla):	S100b (S100 calcium binding protein B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	S100B (S100 calcium binding protein B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	S100B (S100 calcium binding protein B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	S100B (S100 calcium binding protein B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	S100B (S100 calcium binding protein B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	S100b (S100 calcium binding protein B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	S100b (S100 calcium binding protein B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|TreeFam)
Homo sapiens (human):	S100B (S100 calcium binding protein B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)
Danio rerio (zebrafish):	s100b (S100 calcium binding protein, beta (neural))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|Roundup\|TreeFam)

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	76,089,670 - 76,097,153 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	10	76,089,687 - 76,096,993 (+)	Ensembl
GRCm38	10	76,253,836 - 76,261,319 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	76,253,853 - 76,261,159 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	75,716,581 - 75,724,064 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	10	75,697,569 - 75,703,813 (+)	NCBI			mm8
Celera	10	77,297,763 - 77,305,246 (+)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	38.76	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Acute Coronary Syndrome (ISO)

Alzheimer's disease (IMP,ISO)

Animal Disease Models (ISO)

aspergillosis (ISO)

asphyxia neonatorum (ISO)

Attention Deficit and Disruptive Behavior Disorders (ISO)

autistic disorder (ISO)

Axenfeld-Rieger syndrome type 3 (ISO)

bacterial meningitis (ISO)

bipolar disorder (ISO)

borna disease (ISO)

brain disease (ISO)

brain edema (ISO)

Brain Injuries (ISO)

Brain Injuries, Diffuse (ISO)

brain ischemia (ISO)

Brain Neoplasms (ISO)

Cerebral Hemorrhage (ISO)

Creutzfeldt-Jakob disease (ISO)

demyelinating disease (ISO)

Dental Pulp Exposure (ISO)

dilated cardiomyopathy (ISO)

Down syndrome (ISO)

epilepsy (ISO)

Experimental Diabetes Mellitus (ISO)

Femoral Fractures (ISO)

Hematoma (ISO)

hypertension (ISO)

Hypotension (ISO)

Hypoxia-Ischemia, Brain (ISO)

Inflammation (ISO)

intracranial vasospasm (ISO)

invasive aspergillosis (IMP)

Machado-Joseph disease (ISO)

mental depression (ISO)

Mercury Poisoning, Nervous System (ISO)

migraine without aura (ISO)

myocardial infarction (ISO)

Myocardial Reperfusion Injury (ISO)

neuromyelitis optica (ISO)

Parkinson's disease (IEP,ISO)

relapsing-remitting multiple sclerosis (ISO)

Reperfusion Injury (ISO)

schizophrenia (ISO)

Sepsis (ISO)

sleep apnea (ISO)

Spinal Fractures (ISO)

Stroke (ISO)

urinary bladder cancer (IEP)

visual epilepsy (ISO)

West Nile fever (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(+)-pilocarpine (ISO)

(1->3)-beta-D-glucan (ISO)

(R)-lipoic acid (ISO)

(R)-noradrenaline (ISO)

(S)-nicotine (EXP)

1,2-dimethylhydrazine (EXP,ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (EXP)

2,2,2-tetramine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

3,3',5,5'-tetrabromobisphenol A (EXP)

3,4-dihydroxybenzaldehyde (ISO)

3,7-dihydropurine-6-thione (ISO)

3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

6-propyl-2-thiouracil (ISO)

aconitine (EXP)

aluminium atom (ISO)

aluminium(0) (ISO)

aminoguanidine (ISO)

ammonia (ISO)

ammonium chloride (ISO)

arsenous acid (ISO)

astemizole (ISO)

benzo[a]pyrene (ISO)

bexarotene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buspirone (EXP)

C60 fullerene (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

capsaicin (ISO)

carbofuran (ISO)

carbon nanotube (EXP)

chrysin (EXP)

cobalt atom (ISO)

cocaine (ISO)

cycloheximide (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

dibenziodolium (ISO)

dibutyl phthalate (ISO)

dimethoate (ISO)

diuron (ISO)

dorsomorphin (ISO)

endosulfan (ISO)

entinostat (ISO)

ethanol (EXP)

fluoxetine (EXP,ISO)

folic acid (EXP)

furosemide (ISO)

glyphosate (ISO)

heparin (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

ketamine (ISO)

L-ascorbic acid (ISO)

lead diacetate (ISO)

lipoic acid (ISO)

manganese(II) chloride (EXP)

mercaptopurine (ISO)

mercury atom (ISO)

mercury(0) (ISO)

methylmercury chloride (ISO)

monascin (ISO)

morphine (EXP)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO)

nickel sulfate (ISO)

nicotine (EXP)

nitric oxide (EXP,ISO)

nitroprusside (ISO)

ouabain (ISO)

oxidopamine (EXP)

panobinostat (ISO)

paracetamol (ISO)

paraquat (ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenethyl caffeate (ISO)

phenylephrine (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

purine-6-thiol (ISO)

quercetin (ISO)

reactive oxygen species (EXP,ISO)

resveratrol (ISO)

risperidone (ISO)

SB 203580 (EXP)

SB 431542 (ISO)

Soman (ISO)

streptozocin (ISO)

titanium dioxide (EXP)

trichostatin A (ISO)

Tungsten carbide (ISO)

valproic acid (EXP,ISO)

veliparib (EXP)

vinclozolin (ISO)

vitamin E (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

astrocyte differentiation (ISO)

cellular calcium ion homeostasis (NAS)

cellular response to hypoxia (ISO)

energy reserve metabolic process (NAS)

learning or memory (IMP)

long-term synaptic potentiation (ISO)

memory (IMP)

negative regulation of skeletal muscle cell differentiation (ISO)

positive regulation of apoptotic process (ISO)

positive regulation of cell population proliferation (IBA,ISO)

positive regulation of I-kappaB kinase/NF-kappaB signaling (IBA,ISO)

positive regulation of myelination (ISO)

positive regulation of synaptic transmission (ISO)

regulation of cell shape (ISO)

regulation of cytokine production (NAS)

regulation of long-term neuronal synaptic plasticity (NAS)

regulation of neuronal synaptic plasticity (IMP)

response to glucocorticoid (ISO)

response to methylmercury (ISO)

Cellular Component

cytoplasm (IBA,IDA,ISO,NAS)

cytosol (ISO)

extracellular region (NAS)

extracellular space (IBA,ISO)

intracellular membrane-bounded organelle (ISO)

neuronal cell body (IDA)

nucleoplasm (ISO)

nucleus (IBA,IDA,ISO)

perinuclear region of cytoplasm (ISO)

ruffle (ISO)

Molecular Function

calcium ion binding (IBA,ISO,NAS)

calcium-dependent protein binding (IBA,ISO)

identical protein binding (ISO)

metal ion binding (IEA)

protein binding (ISO)

protein homodimerization activity (ISO)

RAGE receptor binding (IBA,ISO)

S100 protein binding (IBA,ISO)

signaling receptor binding (ISO)

zinc ion binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium/calcium-mediated signaling pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

allodynia (IAGP)

increased circulating magnesium level (IEA)

no abnormal phenotype detected (IAGP)

References

References - curated


1.	Al-Jarrah MD and Jamous M, NeuroRehabilitation. 2011;28(4):359-63.
2.	Aviles-Reyes RX, etal., J Neurochem. 2010 Feb;112(4):854-69. Epub 2009 Dec 10.
3.	Baydas G, etal., Free Radic Biol Med. 2003 Oct 1;35(7):797-804.
4.	Beer C, etal., J Neuroinflammation. 2010 Oct 29;7:71.
5.	Berger RP, etal., Dev Neurosci. 2010;32(5-6):396-405. Epub 2010 Sep 18.
6.	Brouns R, etal., Clin Chem. 2010 Mar;56(3):451-8. Epub 2009 Dec 3.
7.	Brozzi F, etal., J Biol Chem. 2009 Mar 27;284(13):8797-811. Epub 2009 Jan 15.
8.	Cai XY, etal., Atherosclerosis. 2011 Aug;217(2):536-42. Epub 2011 May 27.
9.	Canzobre MC and Rios H, Neurosci Lett. 2010 Feb 5;470(1):71-5. Epub 2009 Dec 30.
10.	Chaung WW, etal., Mol Med. 2011;17(9-10):1075-83. doi: 10.2119/molmed.2010.00104. Epub 2011 Jun 17.
11.	Chaves ML, etal., J Neuroinflammation. 2010 Jan 27;7:6.
12.	Chohan G, etal., J Neurol Neurosurg Psychiatry. 2010 Nov;81(11):1243-8. Epub 2010 Sep 20.
13.	Collino M, etal., Diabetes. 2009 Jan;58(1):235-42. Epub 2008 Oct 7.
14.	Cunha C, etal., PLoS One. 2011;6(11):e27962. doi: 10.1371/journal.pone.0027962. Epub 2011 Nov 17.
15.	Fujii C, etal., Neurosci Lett. 2011 Apr 20;494(1):86-8. Epub 2011 Mar 1.
16.	Gankam Kengne F, etal., J Am Soc Nephrol. 2011 Oct;22(10):1834-45. Epub 2011 Sep 1.
17.	Gazzolo D, etal., Clin Chem. 2004 May;50(5):941-4.
18.	Gazzolo D, etal., Crit Care Med. 2004 Jan;32(1):131-6.
19.	Ge YL, etal., Acta Anaesthesiol Scand. 2007 Nov;51(10):1331-7.
20.	Gitton Y, etal., Nature 2002 Dec 5;420(6915):586-90.
21.	Gonzalez-Quevedo A, etal., Clin Biochem. 2011 Feb;44(2-3):154-9. Epub 2010 Dec 1.
22.	Hamed SA, etal., Neuropediatrics. 2009 Apr;40(2):66-72. Epub 2009 Oct 6.
23.	James ML, etal., Biomarkers. 2009 Sep;14(6):388-94.
24.	Lebed YV, etal., Neurosci Lett. 2008 Oct 24;444(2):181-5. Epub 2008 Aug 8.
25.	Lee SJ, etal., Emerg Med J. 2010 Mar;27(3):209-12.
26.	Lin YW and Hsieh CL, J Ethnopharmacol. 2011 May 17;135(2):313-20. Epub 2011 Mar 21.
27.	Liu J, etal., Biochem Biophys Res Commun. 2005 Mar 4;328(1):335-41. doi: 10.1016/j.bbrc.2004.12.175.
28.	MacDonald G, etal., Genomics 1991 Oct;11(2):317-23.
29.	Machado-Vieira R, etal., Life Sci. 2004 Dec 31;76(7):805-11.
30.	Mazzini GS, etal., J Card Fail. 2007 Dec;13(10):850-4.
31.	MGD and Homologene mouse data transfer
32.	MGD data from the GO Consortium
33.	MGD IEA
34.	Mori T, etal., Glia. 2010 Feb;58(3):300-14.
35.	Ohtaki N, etal., J Virol. 2007 Jun;81(11):5940-8. Epub 2007 Mar 21.
36.	Oses JP, etal., Brain Res Bull. 2004 Sep 30;64(3):237-42.
37.	Pelinka LE, etal., Br J Anaesth. 2003 Oct;91(4):595-7.
38.	Petzold A, etal., Brain. 2002 Jul;125(Pt 7):1462-73.
39.	Petzold A, etal., Muscle Nerve. 2010 Jan;41(1):42-9.
40.	Qi LY, etal., Neurosci Lett. 2009 Sep 22;462(2):113-7. Epub 2009 Jun 17.
41.	Reymond A, etal., Nature 2002 Dec 5;420(6915):582-6.
42.	RGD automated import pipeline
43.	RGD automated import pipeline for gene-chemical interactions
44.	Rodrigues L, etal., J Neural Transm. 2010 Nov;117(11):1295-305. Epub 2010 Oct 16.
45.	Roltsch E, etal., J Neuroinflammation. 2010 Nov 16;7:78.
46.	Schaub MC and Heizmann CW, Biochem Biophys Res Commun. 2008 Apr 25;369(1):247-64. Epub 2007 Oct 25.
47.	Sorci G, etal., PLoS Pathog. 2011 Mar;7(3):e1001315. Epub 2011 Mar 10.
48.	Tanaka Y, etal., Life Sci. 2007 Aug 2;81(8):657-63. Epub 2007 Jul 21.
49.	Tsoporis JN, etal., Circ Res. 2010 Jan 8;106(1):93-101. Epub 2009 Nov 12.
50.	Yao R, etal., Anticancer Res. 2007 Sep-Oct;27(5A):3051-8.
51.	Ye Y, etal., Neurosci Lett. 2011 Sep 26;503(1):15-9. Epub 2011 Aug 6.
52.	Yilmaz N, etal., Cell Mol Neurobiol. 2011 May;31(4):579-85. Epub 2011 Feb 4.
53.	Zhai J, etal., Behav Brain Res. 2011 Mar 1;217(2):363-8. Epub 2010 Nov 9.
54.	Zhou J, etal., Zhong Nan Da Xue Xue Bao Yi Xue Ban. 2011 Jun;36(6):504-10.
55.	Zurek J and Fedora M, Acta Neurochir (Wien). 2011 Oct 7.

Additional References at PubMed

PMID:1359872	PMID:1783381	PMID:1975791	PMID:2323034	PMID:7511035	PMID:7546735	PMID:7558021	PMID:7582813	PMID:7749229	PMID:7851892	PMID:7916323	PMID:8137163
PMID:8202493	PMID:8376406	PMID:8565847	PMID:8611721	PMID:8787758	PMID:8846093	PMID:8889548	PMID:8898859	PMID:8946407	PMID:8949922	PMID:9232833	PMID:9628829
PMID:9754881	PMID:9834195	PMID:10051316	PMID:10349636	PMID:10395934	PMID:10467564	PMID:10588868	PMID:10613844	PMID:10617132	PMID:10655525	PMID:10837142	PMID:11027232
PMID:11032813	PMID:11042146	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11222062	PMID:11409899	PMID:11835317	PMID:11872254	PMID:11891290	PMID:12042313	PMID:12377780
PMID:12393261	PMID:12466851	PMID:12477932	PMID:12490199	PMID:12508309	PMID:12526882	PMID:12533614	PMID:12561079	PMID:12618141	PMID:12645009	PMID:12673835	PMID:12742260
PMID:12812790	PMID:12842915	PMID:14610273	PMID:14625556	PMID:14638863	PMID:14648547	PMID:14681479	PMID:15102707	PMID:15126113	PMID:15236402	PMID:15248193	PMID:15336958
PMID:15489334	PMID:15555923	PMID:15572147	PMID:15621007	PMID:15699280	PMID:15714282	PMID:15782413	PMID:15810011	PMID:15852015	PMID:15882580	PMID:15944126	PMID:16014513
PMID:16141072	PMID:16141073	PMID:16330018	PMID:16467531	PMID:16518823	PMID:16537572	PMID:16600520	PMID:16938360	PMID:17024657	PMID:17042795	PMID:17078026	PMID:17178400
PMID:17331210	PMID:17362503	PMID:17391983	PMID:17436285	PMID:17537790	PMID:17553984	PMID:17661397	PMID:17729158	PMID:17942321	PMID:18024993	PMID:18031722	PMID:18090917
PMID:18215621	PMID:18287078	PMID:18451356	PMID:18501628	PMID:18551627	PMID:18599158	PMID:18638525	PMID:18641643	PMID:18649404	PMID:18728187	PMID:18812013	PMID:18854036
PMID:18945900	PMID:19298847	PMID:19345204	PMID:19373938	PMID:19389366	PMID:19679874	PMID:19701198	PMID:19713945	PMID:19718438	PMID:19723505	PMID:20069545	PMID:20096683
PMID:20099023	PMID:20203209	PMID:20387078	PMID:20457761	PMID:20463215	PMID:20549747	PMID:20554876	PMID:20610746	PMID:20825492	PMID:20830809	PMID:20881139	PMID:20935640
PMID:21048147	PMID:21122816	PMID:21125652	PMID:21146588	PMID:21147077	PMID:21220101	PMID:21264954	PMID:21267068	PMID:21319224	PMID:21376255	PMID:21545793	PMID:21677750
PMID:21693512	PMID:21693575	PMID:21776083	PMID:21779383	PMID:21856951	PMID:21857657	PMID:21873635	PMID:21957238	PMID:22046273	PMID:22056141	PMID:22071110	PMID:22103411
PMID:22156770	PMID:22160720	PMID:22173850	PMID:22223678	PMID:22234186	PMID:22266424	PMID:22461560	PMID:22508049	PMID:22522171	PMID:22542597	PMID:22689348	PMID:22705452
PMID:22766236	PMID:22828627	PMID:22906231	PMID:22918885	PMID:22951639	PMID:22956844	PMID:23000886	PMID:23100423	PMID:23169921	PMID:23196656	PMID:23223288	PMID:23293287
PMID:23382203	PMID:23482493	PMID:23695674	PMID:23719262	PMID:23729438	PMID:23744272	PMID:23804363	PMID:23806210	PMID:23821580	PMID:23828756	PMID:23895693	PMID:23899512
PMID:23948251	PMID:24120991	PMID:24236178	PMID:24239551	PMID:24301385	PMID:24466267	PMID:24582971	PMID:24652767	PMID:24717433	PMID:24859200	PMID:24931760	PMID:24952961
PMID:24979729	PMID:24983448	PMID:25044744	PMID:25079316	PMID:25151262	PMID:25152033	PMID:25176044	PMID:25285789	PMID:25327963	PMID:25331604	PMID:25382142	PMID:25433207
PMID:25482070	PMID:25556712	PMID:25564653	PMID:25757744	PMID:25817898	PMID:25883935	PMID:25888505	PMID:25934499	PMID:25995483	PMID:26115514	PMID:26204512	PMID:26348989
PMID:26387477	PMID:26499172	PMID:26571399	PMID:26644518	PMID:26651999	PMID:26657772	PMID:26740489	PMID:26907191	PMID:27076429	PMID:27142930	PMID:27196066	PMID:27291295
PMID:27294512	PMID:27318131	PMID:27601207	PMID:27693255	PMID:27707970	PMID:27798843	PMID:27914912	PMID:27965439	PMID:28087714	PMID:28174179	PMID:28266561	PMID:28280459
PMID:28373281	PMID:28402856	PMID:28656980	PMID:28684471	PMID:28728023	PMID:28965759	PMID:28970581	PMID:28984873	PMID:29285798	PMID:29326173	PMID:29483282	PMID:29499206
PMID:29732603	PMID:29779941	PMID:29899142	PMID:30076898	PMID:30229393	PMID:30266827	PMID:30292786	PMID:30348677	PMID:30472119	PMID:30668728	PMID:30759972	PMID:30819894
PMID:30870413	PMID:30870432	PMID:31043739	PMID:31143101	PMID:31200100	PMID:31318166	PMID:31586559	PMID:31690636	PMID:31696965	PMID:31801076	PMID:31953387	PMID:32017713
PMID:32024956	PMID:32081718	PMID:32220631	PMID:32291340	PMID:32325033	PMID:32579270	PMID:33116259

Genomics

Comparative Map Data

S100b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	76,089,670 - 76,097,153 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	10	76,089,687 - 76,096,993 (+)	Ensembl
GRCm38	10	76,253,836 - 76,261,319 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	76,253,853 - 76,261,159 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	75,716,581 - 75,724,064 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	10	75,697,569 - 75,703,813 (+)	NCBI			mm8
Celera	10	77,297,763 - 77,305,246 (+)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	38.76	NCBI

S100B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	21	46,598,604 - 46,605,208 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	21	46,598,604 - 46,605,243 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	21	48,018,517 - 48,024,995 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	21	46,842,959 - 46,849,463 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	21	46,842,958 - 46,849,424	NCBI
Celera	21	33,131,698 - 33,138,202 (-)	NCBI
Cytogenetic Map	21	q22.3	NCBI
HuRef	21	33,398,429 - 33,404,960 (-)	NCBI		HuRef
CHM1_1	21	47,579,370 - 47,585,892 (-)	NCBI		CHM1_1

S100b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	12,372,866 - 12,381,619 (-)	NCBI
Rnor_6.0 Ensembl	20	13,130,636 - 13,142,856 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0	20	13,130,633 - 13,142,856 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	20	15,287,745 - 15,296,485 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	12,791,440 - 12,824,508 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	20	12,791,666 - 12,824,735 (-)	NCBI
Celera	20	13,867,276 - 13,875,895 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

S100b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955407	42,972,584 - 42,980,510 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955407	42,972,584 - 42,980,510 (-)	NCBI	ChiLan1.0	ChiLan1.0

S100B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	21	46,197,750 - 46,203,953 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	21	46,197,750 - 46,203,953 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	21	33,063,845 - 33,070,073 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

S100B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1 Ensembl	31	39,784,506 - 39,788,183 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1	31	39,783,990 - 39,788,289 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

S100B
(Sus scrofa - pig)

No map positions available.

S100B
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	90,188,820 - 90,194,986 (-)	NCBI
ChlSab1.1 Ensembl	2	90,188,639 - 90,195,023 (-)	Ensembl

S100b
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624745	31,645,927 - 31,652,846 (-)	NCBI

Position Markers

AI850290

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
MGSCv37	10	75,723,547 - 75,723,689	UniSTS	GRCm37
Celera	10	77,304,729 - 77,304,871	UniSTS
Cytogenetic Map	10	C1	UniSTS
cM Map	10		UniSTS
Whitehead/MRC_RH	10	871.11	UniSTS

UniSTS:224308

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	10	76,260,202 - 76,260,357	UniSTS	GRCm38
MGSCv37	10	75,722,947 - 75,723,102	UniSTS	GRCm37
Celera	10	77,304,129 - 77,304,284	UniSTS
Cytogenetic Map	10	C1	UniSTS
cM Map	10	41.0	UniSTS

S100b

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	10	C1	UniSTS
cM Map	10	41.0	UniSTS

AI850290

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	10	76,260,802 - 76,260,944	UniSTS	GRCm38
MGSCv37	10	75,723,547 - 75,723,689	UniSTS	GRCm37
Celera	10	77,304,729 - 77,304,871	UniSTS
Cytogenetic Map	10	C1	UniSTS
Whitehead/MRC_RH	10	871.11	UniSTS

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357740	Obsty3_m	obesity 3 (mouse)			Not determined		10	8359714	116355075	Mouse
1301386	Sysbp1_m	systolic blood pressure 1 (mouse)			Not determined		10	10232521	87565233	Mouse
1357825	Kidpq2_m	kidney weight percentage QTL 2 (mouse)			Not determined		10	12828307	84243920	Mouse
1357656	Hrtq3_m	heart weight QTL 3 (mouse)			Not determined		10	12828307	84243920	Mouse
1357864	Scfpq1_m	subcutaneous fat pad percentage QTL 1 (mouse)			Not determined		10	12828307	84243920	Mouse
1357893	Lvrq4_m	liver weight QTL 4 (mouse)			Not determined		10	12828307	84243920	Mouse
4142380	W3q11_m	weight 3 weeks QTL 11 (mouse)			Not determined			12828307	84243920	Mouse
4141943	W6q6_m	weight 6 weeks QTL 6 (mouse)			Not determined			12828307	84243920	Mouse
4141956	Egq7_m	early growth QTL 7 (mouse)			Not determined			12828307	84243920	Mouse
4142272	W10q5_m	weight 10 weeks QTL 5 (mouse)			Not determined			12828307	84243920	Mouse
39128215	Lwq17_m	liver weight QTL 17 (mouse)					10	12828307	84243920	Mouse
1302067	Scc9_m	colon tumor susceptibility 9 (mouse)			Not determined		10	18383585	125739363	Mouse
27226772	Tibl13_m	tibia length 13, 10 week (mouse)					10	19000000	129800000	Mouse
1558757	Eae34_m	experimental allergic encephalomyelitis susceptibility 34 (mouse)			Not determined		10	21532255	114381325	Mouse
26884403	Cvht8_m	cranial vault height 8, 16 week (mouse)					10	23000000	91200000	Mouse
26884426	Cvht1_m	cranial vault height 1, 5 week (mouse)					10	24800000	121200000	Mouse
27095911	Pglq15_m	pelvic girdle length QTL 15, 16 week (mouse)					10	39300000	129800000	Mouse
27226764	Tibl19_m	tibia length 19, 16 week (mouse)					10	39300000	129800000	Mouse
26884411	Bzwq8_m	bi-zygomatic width QTL 8, 10 week (mouse)					10	45000000	116100000	Mouse
26884407	Bzwq14_m	bi-zygomatic width QTL 14, 16 wee (mouse)					10	45600000	120800000	Mouse
4142313	Angvq1_m	angiogenesis by VEGF QTL 1 (mouse)			Not determined			46844307	82655287	Mouse
1302150	Bbaa18_m	B.burgdorferi-associated arthritis 18 (mouse)			Not determined		10	49502233	83502378	Mouse
4142169	Pbwg16_m	postnatal body weight growth 16 (mouse)			Not determined		10	50012408	84012633	Mouse
1300597	Skull14_m	skull morphology 14 (mouse)			Not determined		10	50012408	84012633	Mouse
10045641	Jckm3_m	juvenile cystic kidney modifier 3 (mouse)			Not determined		10	50012408	84012633	Mouse
1301966	Lifespan2_m	life span 2 (mouse)			Not determined		10	50012443	84012618	Mouse
1357737	Hpcr2_m	hepatocarcinogen resistance 2 (mouse)			Not determined		10	50012443	84012618	Mouse
1300882	Ath17_m	atherosclerosis 17 (mouse)			Not determined		10	51255660	85255809	Mouse
1301502	Eae17_m	susceptibility to experimental allergic encephalomyelitis 17 (mouse)			Not determined		10	51255660	85255809	Mouse
1301380	Cia8_m	collagen induced arthritis QTL 8 (mouse)			Not determined		10	51617304	82655287	Mouse
14746991	Manh68_m	mandible shape 68 (mouse)					10	52444667	86444667	Mouse
1301787	Bsc1_m	brain size control 1 (mouse)			Not determined		10	58681135	92681262	Mouse
26884450	Sklq15_m	skull length QTL 15, 16 week (mouse)					10	59500000	122500000	Mouse
13208560	Wght9_m	weight 9 (mouse)					10	60000000	121000000	Mouse
26884424	Zlq9_m	zygomatic length QTL 9, 16 week (mouse)					10	64100000	116100000	Mouse
1302060	El3_m	epilepsy 3 (mouse)			Not determined		10	65655104	99655287	Mouse
1300533	Aem3_m	anti-erythrocyte autoantibody modifier 3 (mouse)			Not determined		10	65655104	99655287	Mouse
1301737	Insq9_m	insulin QTL 9 (mouse)			Not determined		10	65655104	99655287	Mouse
1302035	Lmb4_m	lupus in MRL and B6 F2 cross (mouse)			Not determined		10	67012408	92422811	Mouse
26884447	Sklq9_m	skull length QTL 9, 10 week (mouse)					10	67500000	111900000	Mouse
26884430	Zlq5_m	zygomatic length QTL 5, 10 week (mouse)					10	68000000	125000000	Mouse
26884405	Huml2_m	humerus length 2, 5 week (mouse)					10	69900000	132500000	Mouse
11039497	Ltpr5a_m	Leishmania tropica response 5a (mouse)					10	73671039	107671185	Mouse
4142107	Obrq12_m	obesity resistance QTL 12 (mouse)			Not determined			74151384	82655287	Mouse
11353832	Pcholq4_m	plasma cholesterol QTL 4 (mouse)					10	74151384	125680038	Mouse
11353843	Gluq1_m	blood glucose QTL 1 (mouse)					10	74151384	125680038	Mouse
1300975	Fembrs3_m	femur breaking strength 3 (mouse)			Not determined		10	75502706	109502905	Mouse
4142137	Femwf3_m	femur work to failure 3 (mouse)			Not determined			75502706	109502905	Mouse
1357632	Vtbt9_m	vertebral trabecular bone trait 9 (mouse)			Not determined		10	75502706	109502905	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	357
Count of miRNA genes:	261
Interacting mature miRNAs:	294
Transcripts:	ENSMUST00000036387
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_009115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC006507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC140851	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK134625	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK135083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK161945	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AW456919	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061178	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CX205737	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KT314221	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KT314222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L22144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000036387 ⟹ ENSMUSP00000047968

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	10	76,253,853 - 76,261,159 (+)	Ensembl

RefSeq Acc Id:

NM_009115 ⟹ NP_033141

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	10	76,089,670 - 76,097,153 (+)	NCBI
GRCm38	10	76,253,836 - 76,261,319 (+)	ENTREZGENE
MGSCv37	10	75,716,581 - 75,724,064 (+)	RGD
Celera	10	77,297,763 - 77,305,246 (+)	RGD
cM Map	10		ENTREZGENE

Sequence:

show sequence

GTGGACTGCGCCAAGCCCACACCCAGTTCTCTCTGCAGGAAGAATAAGAAGCTGTTCTGTCTAC
ACTCCTGTTACTCGGACACTGAAGCCAGAGAGGACTCCAGCAGCAAAGGTGACCAGGAGCTCCC
GGGATGTCCGAGCTGGAGAAGGCCATGGTTGCCCTCATTGATGTCTTCCACCAGTACTCCGGGC
GAGAGGGTGACAAGCACAAGCTGAAGAAGTCAGAACTGAAGGAGCTTATCAACAACGAGCTCTC
TCACTTCCTGGAGGAAATCAAGGAGCAGGAAGTGGTGGACAAAGTGATGGAGACGCTGGACGAA
GATGGGGATGGGGAGTGTGACTTCCAGGAGTTCATGGCCTTCGTCGCCATGGTGACCACGGCCT
GCCATGAGTTCTTTGAACATGAGTGAGACCAAAAAAAAAAAAAAAAAAAAAAAAAGTAGCTGAG
CTGTTTCTGCAACAGACATGAGGGTCACAAGAGGAGGCACAGCAAAGGCTCATGGGCTCGAAGG
AGCTGAGCTCTCTAGACACACATAACTAATTAGGAAGCTTGGTTTGCTTTGGGGATGAAACCCC
AACCCCCTTCCCAGGGGCTGCTTTAAGTTAGCACATCATGATTTCTGCTAGGCTAGGCATTCCC
GTGAGCTGACTGGTCCCAGGAACTGTTGGTAAGGGTCACTTAGGGGATGAGATCAACGCTCTGT
TGATAAAACACGTGTTGCTGACCACCATGCCCCTGTAGAAGAGTCACCTGTAAGAATCAAGGCA
GACTACCAACAGTACTTCCGTCAGTCAGCTTTCTTAGATGTATGCTTCCCATACATCTACAGAC
CCACAGCTGGATCTGCTGCCACCCGAAGAGGTTGCTCATCCTTACACCTGCTTGCCATCTGCCT
GAGCAAATGATGCTCCAGAAAGTAGACAGACTGATCGCCTACACCCTTCCCCAGCTCAGAGGAG
CACAGCCACACTTAAGTCTCTTCTTCCACAGTGTGCAGTGATTCGTTACTAAGTAAATATTTAA
TGCCAACAGTTCTAACTGGGGAAACAATTAGATCTCACAAACTAAGTATGAACATTCTAACTCA
GGACCGAGAATCAAAATTCTGCTCGGCAGACTTCTCCTTTCAGGATGATCGCTTTGTTCCTGGA
GGACAGAGGAGGGGAATGGCCAGAGTCTTTTTCTAGTTAGTTGTATCTTCCTTGCTCCCTCTGC
TGTCCATAATGTGAGTGGCTGCGGAAGTTGAGATTCACAGGACGAGCTGATGGGGAATTAAGGG
TCTCTGAGGTGTGTCCTTTAGCTGCTGGGAGCCATGTCTGACCTGCTGGTGCCTAGGGCCTGCT
TAGCCCTTGGTGAGGCTGAGAGTCGAGGACTGTGGGAAGCTGGACTTGAGGCTTTCTAACTTGC
ATATTCAAATAGCGACGTTTTAAATAATCCAAGTTACATTTAAATAAAAACTGCATTGCAAATA
TTAAAAAGCCATTCTAGGAGAATTCTAAATTACCCTTACCCATCTCTATTTTGTTTTGTTTTGT
TTTGTTTTCAGAGAAGAGACTTAGAAGTTCATTAAGTCAACTGAACAATGCCTTCGCATAAAAT
AAAAGCATTGTGAAAATTCTCCATCACCACTGAAGAAGAAATAAATATAAAGTACTTGTGAAAA
AAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_033141	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA03075	(Get FASTA)	NCBI Sequence Viewer
	AAH61178	(Get FASTA)	NCBI Sequence Viewer
	BAE22214	(Get FASTA)	NCBI Sequence Viewer
	BAE22413	(Get FASTA)	NCBI Sequence Viewer
	BAE36647	(Get FASTA)	NCBI Sequence Viewer
	EDL31858	(Get FASTA)	NCBI Sequence Viewer
	EDL31859	(Get FASTA)	NCBI Sequence Viewer
	P50114	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_033141 ⟸ NM_009115
- UniProtKB:	P50114 (UniProtKB/Swiss-Prot), Q3UY00 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDED GDGECDFQEFMAFVAMVTTACHEFFEHE hide sequence

RefSeq Acc Id:

ENSMUSP00000047968 ⟸ ENSMUST00000036387

Protein Domains

EF-hand

Promoters

RGD ID:

6819876

Promoter ID:

MM_KWN:4622

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day4, Brain

Transcripts:

NM_009115

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	10	75,716,371 - 75,716,871 (+)	MPROMDB

RGD ID:

8672370

Promoter ID:

EPDNEW_M14215

Type:

initiation region

Name:

S100b_1

Description:

Mus musculus S100 protein, beta polypeptide, neural , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	10	76,253,909 - 76,253,969	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:98217	AgrOrtholog
Ensembl Genes	ENSMUSG00000033208	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000047968	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000036387	ENTREZGENE, UniProtKB/Swiss-Prot
InterPro	EF-hand-dom_pair	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EF_Hand_1_Ca_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EF_hand_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S100-B	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S100/CaBP-9k_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S100_Ca-bd_sub	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:20203	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:98217	ENTREZGENE
NCBI Gene	20203	ENTREZGENE
Pfam	EF-hand_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S_100	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	S100b	PhenoGen
PROSITE	EF_HAND_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EF_HAND_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S100_CABP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	EFh	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S_100	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47473	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	P50114	ENTREZGENE
	Q3UY00	ENTREZGENE, UniProtKB/TrEMBL
	S100B_MOUSE	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations