Advanced Search (OLGA)

Gene: Rrm1 (ribonucleotide reductase M1) Mus musculus

Analyze

Symbol:

Rrm1

Name:

ribonucleotide reductase M1

RGD ID:

11247

MGI Page

MGI

Description:

Enables disordered domain specific binding activity; purine nucleotide binding activity; and ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor. Involved in several processes, including nucleoside phosphate metabolic process; positive regulation of G0 to G1 transition; and protein heterotetramerization. Part of ribonucleoside-diphosphate reductase complex. Is expressed in several structures, including alimentary system; brain; genitourinary system; integumental system; and sensory organ. Human ortholog(s) of this gene implicated in chronic progressive external ophthalmoplegia. Orthologous to human RRM1 (ribonucleotide reductase catalytic subunit M1).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ribonucleoside-diphosphate reductase large subunit; ribonucleoside-diphosphate reductase subunit M1; ribonucleotide reductase large subunit; Rn; RnrM1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RRM1 (ribonucleotide reductase catalytic subunit M1)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):	Rrm1 (ribonucleotide reductase catalytic subunit M1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rrm1 (ribonucleotide reductase catalytic subunit M1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RRM1 (ribonucleotide reductase catalytic subunit M1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RRM1 (ribonucleotide reductase catalytic subunit M1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rrm1 (ribonucleotide reductase catalytic subunit M1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RRM1 (ribonucleotide reductase catalytic subunit M1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RRM1 (ribonucleotide reductase catalytic subunit M1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rrm1 (ribonucleotide reductase catalytic subunit M1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RRM1 (ribonucleotide reductase catalytic subunit M1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Rattus norvegicus (Norway rat):	Rrm1 (ribonucleotide reductase catalytic subunit M1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rrm1 (ribonucleotide reductase M1 polypeptide)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Saccharomyces cerevisiae (baker's yeast):	RNR1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RnrL	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rnr-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RNR3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rrm1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	102,090,902 - 102,118,978 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	102,090,902 - 102,118,978 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	102,441,695 - 102,469,771 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	102,441,695 - 102,469,771 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	109,590,209 - 109,618,285 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	102,315,688 - 102,342,747 (+)	NCBI		MGSCv36	mm8
Celera	7	102,809,638 - 102,837,567 (+)	NCBI		Celera
Cytogenetic Map	7	E3	NCBI
cM Map	7	54.72	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rrm1	Mouse	Experimental Liver Neoplasms		ISO	RGD:1592569	2316863		RGD
Rrm1	Mouse	Experimental Seizures		ISO	RGD:1592569	5133692	protein:increased expression:dentate gyrus (rat)	RGD
Rrm1	Mouse	lung non-small cell carcinoma	treatment	ISO	RGD:737409	127229933		RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rrm1	Mouse	Autosomal Recessive Progressive External Ophthalmoplegia with Mitochondrial DNA Deletions 6		ISO	RGD:737409	8554872	ClinVar Annotator: match by term: Progressive external ophthalmoplegia with mitochondrial dna deletions, autosomal recessive 6 more ...	ClinVar	PMID:25741868\|PMID:35617047
Rrm1	Mouse	delta beta-thalassemia		ISO	RGD:737409	8554872	ClinVar Annotator: match by term: Thalassemia, gamma-delta-beta	ClinVar	PMID:2798417

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rrm1	Mouse	adrenocortical carcinoma		ISO	RGD:737409	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:22547773
Rrm1	Mouse	Animal Disease Models		ISO	RGD:737409	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:27602772
Rrm1	Mouse	Disease Progression		ISO	RGD:737409	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21496433
Rrm1	Mouse	hepatocellular carcinoma		ISO	RGD:737409	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18230555
Rrm1	Mouse	lung adenocarcinoma		ISO	RGD:737409	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:27602772
Rrm1	Mouse	lung non-small cell carcinoma		ISO	RGD:737409	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21496433
Rrm1	Mouse	neural tube defect		ISO	RGD:737409	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:10716750

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rrm1	Mouse	Autosomal Recessive Progressive External Ophthalmoplegia with Mitochondrial DNA Deletions 6		ISO	RGD:737409	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rrm1	Mouse	1,1-dichloroethene	increases expression	EXP		6480464	vinylidene chloride results in increased expression of RRM1 mRNA	CTD	PMID:26682919
Rrm1	Mouse	1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene	multiple interactions	EXP		6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Rrm1	Mouse	1,2-dimethylhydrazine	multiple interactions	EXP		6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RRM1 mRNA	CTD	PMID:22206623
Rrm1	Mouse	1-chloro-2,4-dinitrobenzene	increases expression	EXP		6480464	Dinitrochlorobenzene results in increased expression of RRM1 mRNA	CTD	PMID:21404309
Rrm1	Mouse	17beta-estradiol	affects expression	EXP		6480464	Estradiol affects the expression of RRM1 mRNA	CTD	PMID:15598610\|PMID:16684588
Rrm1	Mouse	17beta-estradiol	affects expression	ISO	RGD:1592569	6480464	Estradiol affects the expression of RRM1 mRNA	CTD	PMID:32145629
Rrm1	Mouse	17beta-estradiol	increases expression	ISO	RGD:737409	6480464	Estradiol results in increased expression of RRM1 mRNA	CTD	PMID:16514628\|PMID:19167446
Rrm1	Mouse	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	EXP		6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Rrm1	Mouse	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	RGD:737409	6480464	2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of RRM1 protein	CTD	PMID:31675489
Rrm1	Mouse	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	EXP		6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Rrm1	Mouse	2,2'-Methylenebis(4-methyl-6-tert-butylphenol)	multiple interactions	ISO	RGD:737409	6480464	[CYP3A4 protein affects the susceptibility to 2,2'-methylenebis(4-methyl-6-tert-butylphenol)] which affects the expression of RRM1 mRNA	CTD	PMID:38160208
Rrm1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of RRM1 mRNA	CTD	PMID:21570461
Rrm1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1592569	6480464	Tetrachlorodibenzodioxin results in increased expression of RRM1 mRNA	CTD	PMID:34747641
Rrm1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	EXP		6480464	AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of RRM1 mRNA]	CTD	PMID:15034205
Rrm1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of RRM1 mRNA	CTD	PMID:15034205
Rrm1	Mouse	2,4,4'-trichlorobiphenyl	multiple interactions	EXP		6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Rrm1	Mouse	2,4,6-tribromophenol	decreases expression	ISO	RGD:737409	6480464	2,4,6-tribromophenol results in decreased expression of RRM1 mRNA	CTD	PMID:31675489
Rrm1	Mouse	2,6-dinitrotoluene	affects expression	ISO	RGD:1592569	6480464	2,6-dinitrotoluene affects the expression of RRM1 mRNA	CTD	PMID:21346803
Rrm1	Mouse	2-acetamidofluorene	increases expression	EXP		6480464	2-Acetylaminofluorene results in increased expression of RRM1 mRNA	CTD	PMID:17317680
Rrm1	Mouse	2-bromohexadecanoic acid	multiple interactions	ISO	RGD:737409	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ...	CTD	PMID:38195004
Rrm1	Mouse	3,3',4,4',5-pentachlorobiphenyl	increases expression	ISO	RGD:1592569	6480464	3,4,5,3',4'-pentachlorobiphenyl results in increased expression of RRM1 mRNA	CTD	PMID:23196670
Rrm1	Mouse	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	RGD:737409	6480464	tetrabromobisphenol A results in decreased expression of RRM1 protein	CTD	PMID:31675489
Rrm1	Mouse	3,4-methylenedioxymethamphetamine	increases expression	EXP		6480464	N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of RRM1 mRNA	CTD	PMID:20188158
Rrm1	Mouse	3-methylcholanthrene	multiple interactions	EXP		6480464	[Methylcholanthrene co-treated with Nanotubes, Carbon] results in decreased expression of RRM1 mRNA	CTD	PMID:25926378
Rrm1	Mouse	4-(ethoxymethylene)-2-phenyloxazol-5-one	increases expression	EXP		6480464	Oxazolone results in increased expression of RRM1 mRNA	CTD	PMID:21404309
Rrm1	Mouse	4-hydroxyphenyl retinamide	increases expression	EXP		6480464	Fenretinide results in increased expression of RRM1 mRNA	CTD	PMID:28973697
Rrm1	Mouse	5-fluorouracil	increases expression	ISO	RGD:737409	6480464	Fluorouracil results in increased expression of RRM1 protein	CTD	PMID:15331170
Rrm1	Mouse	6-propyl-2-thiouracil	increases expression	ISO	RGD:1592569	6480464	Propylthiouracil results in increased expression of RRM1 mRNA	CTD	PMID:30047161
Rrm1	Mouse	acetamide	increases expression	ISO	RGD:1592569	6480464	acetamide results in increased expression of RRM1 mRNA	CTD	PMID:31881176
Rrm1	Mouse	actinomycin D	multiple interactions	ISO	RGD:737409	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of RRM1 protein	CTD	PMID:38460933
Rrm1	Mouse	afimoxifene	decreases expression	ISO	RGD:737409	6480464	afimoxifene results in decreased expression of RRM1 mRNA	CTD	PMID:16514628
Rrm1	Mouse	aflatoxin B1	affects expression	ISO	RGD:737409	6480464	Aflatoxin B1 affects the expression of RRM1 protein	CTD	PMID:20106945
Rrm1	Mouse	all-trans-retinoic acid	decreases expression	ISO	RGD:737409	6480464	Tretinoin results in decreased expression of RRM1 mRNA	CTD	PMID:33167477
Rrm1	Mouse	amitrole	increases expression	ISO	RGD:1592569	6480464	Amitrole results in increased expression of RRM1 mRNA	CTD	PMID:30047161
Rrm1	Mouse	Aroclor 1254	decreases expression	EXP		6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of RRM1 mRNA	CTD	PMID:23650126
Rrm1	Mouse	arsenite(3-)	multiple interactions	ISO	RGD:737409	6480464	arsenite inhibits the reaction [G3BP1 protein binds to RRM1 protein]; arsenite promotes the reaction [G3BP1 more ...	CTD	PMID:32406909
Rrm1	Mouse	arsenous acid	decreases expression	ISO	RGD:737409	6480464	Arsenic Trioxide results in decreased expression of RRM1 protein	CTD	PMID:25174355\|PMID:25335113
Rrm1	Mouse	arsenous acid	multiple interactions	ISO	RGD:737409	6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to RRM1 protein]	CTD	PMID:26598702
Rrm1	Mouse	arsenous acid	increases expression	ISO	RGD:737409	6480464	Arsenic Trioxide results in increased expression of RRM1 protein	CTD	PMID:25419056
Rrm1	Mouse	azathioprine	decreases expression	ISO	RGD:737409	6480464	Azathioprine results in decreased expression of RRM1 mRNA	CTD	PMID:22623647
Rrm1	Mouse	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of RRM1 mRNA	CTD	PMID:20504355\|PMID:22228805\|PMID:22610609
Rrm1	Mouse	benzo[a]pyrene	increases expression	ISO	RGD:737409	6480464	Benzo(a)pyrene results in increased expression of RRM1 mRNA	CTD	PMID:32234424
Rrm1	Mouse	benzo[a]pyrene	increases methylation	ISO	RGD:737409	6480464	Benzo(a)pyrene results in increased methylation of RRM1 promoter	CTD	PMID:27901495
Rrm1	Mouse	benzo[a]pyrene	multiple interactions	EXP		6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:15034205\|PMID:27858113
Rrm1	Mouse	benzo[a]pyrene	decreases expression	EXP		6480464	Benzo(a)pyrene results in decreased expression of RRM1 mRNA	CTD	PMID:15034205\|PMID:17942131
Rrm1	Mouse	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RGD:737409	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of RRM1 mRNA	CTD	PMID:20382639
Rrm1	Mouse	benzo[b]fluoranthene	multiple interactions	EXP		6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Rrm1	Mouse	beta-carotene	multiple interactions	EXP		6480464	[BCO1 protein affects the susceptibility to beta Carotene] which affects the expression of RRM1 mRNA	CTD	PMID:24657404
Rrm1	Mouse	beta-lapachone	increases expression	ISO	RGD:737409	6480464	beta-lapachone results in increased expression of RRM1 mRNA	CTD	PMID:38218311
Rrm1	Mouse	bis(2-chloroethyl) sulfide	decreases expression	ISO	RGD:737409	6480464	Mustard Gas results in decreased expression of RRM1 mRNA	CTD	PMID:25102026
Rrm1	Mouse	bis(2-ethylhexyl) phthalate	increases expression	EXP		6480464	Diethylhexyl Phthalate results in increased expression of RRM1 mRNA	CTD	PMID:34319233
Rrm1	Mouse	bisphenol A	affects expression	ISO	RGD:1592569	6480464	bisphenol A affects the expression of RRM1 mRNA	CTD	PMID:25181051\|PMID:32145629
Rrm1	Mouse	bisphenol A	decreases expression	ISO	RGD:1592569	6480464	bisphenol A results in decreased expression of RRM1 mRNA	CTD	PMID:34947998
Rrm1	Mouse	bisphenol A	multiple interactions	ISO	RGD:1592569	6480464	[bisphenol A co-treated with tributyltin] results in increased expression of RRM1 mRNA	CTD	PMID:31129395
Rrm1	Mouse	bisphenol A	affects expression	ISO	RGD:737409	6480464	bisphenol A affects the expression of RRM1 mRNA	CTD	PMID:30903817
Rrm1	Mouse	bisphenol A	decreases expression	ISO	RGD:737409	6480464	bisphenol A results in decreased expression of RRM1 mRNA; bisphenol A results in decreased expression more ...	CTD	PMID:29275510\|PMID:31675489\|PMID:37567409
Rrm1	Mouse	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of RRM1 promoter	CTD	PMID:27312807
Rrm1	Mouse	bisphenol AF	increases expression	ISO	RGD:737409	6480464	bisphenol AF results in increased expression of RRM1 protein	CTD	PMID:34186270
Rrm1	Mouse	bisphenol F	increases expression	EXP		6480464	bisphenol F results in increased expression of RRM1 mRNA	CTD	PMID:38685157
Rrm1	Mouse	cadmium atom	multiple interactions	ISO	RGD:737409	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ...	CTD	PMID:38195004
Rrm1	Mouse	cadmium atom	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RRM1 more ...	CTD	PMID:37325564
Rrm1	Mouse	cadmium dichloride	multiple interactions	ISO	RGD:737409	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ...	CTD	PMID:38195004
Rrm1	Mouse	cadmium dichloride	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RRM1 more ...	CTD	PMID:37325564
Rrm1	Mouse	caffeine	increases phosphorylation	ISO	RGD:737409	6480464	Caffeine results in increased phosphorylation of RRM1 protein	CTD	PMID:35688186
Rrm1	Mouse	carbon nanotube	increases expression	ISO	RGD:737409	6480464	Nanotubes, Carbon results in increased expression of RRM1 protein	CTD	PMID:22157353
Rrm1	Mouse	carbon nanotube	multiple interactions	EXP		6480464	[Methylcholanthrene co-treated with Nanotubes, Carbon] results in decreased expression of RRM1 mRNA	CTD	PMID:25926378
Rrm1	Mouse	carbon nanotube	increases expression	EXP		6480464	Nanotubes, Carbon analog results in increased expression of RRM1 mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681
Rrm1	Mouse	chlorpyrifos	decreases expression	EXP		6480464	Chlorpyrifos results in decreased expression of RRM1 mRNA	CTD	PMID:37019170
Rrm1	Mouse	chromium(6+)	multiple interactions	ISO	RGD:737409	6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ...	CTD	PMID:38479592
Rrm1	Mouse	chrysene	multiple interactions	EXP		6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Rrm1	Mouse	cisplatin	increases expression	ISO	RGD:737409	6480464	Cisplatin results in increased expression of RRM1 mRNA	CTD	PMID:27392435\|PMID:27594783
Rrm1	Mouse	cobalt dichloride	decreases expression	ISO	RGD:737409	6480464	cobaltous chloride results in decreased expression of RRM1 mRNA	CTD	PMID:19376846
Rrm1	Mouse	copper atom	multiple interactions	ISO	RGD:737409	6480464	[NSC 689534 binds to Copper] which results in decreased expression of RRM1 mRNA	CTD	PMID:20971185
Rrm1	Mouse	copper atom	increases expression	ISO	RGD:1592569	6480464	Copper results in increased expression of RRM1 mRNA	CTD	PMID:30556269
Rrm1	Mouse	copper(0)	multiple interactions	ISO	RGD:737409	6480464	[NSC 689534 binds to Copper] which results in decreased expression of RRM1 mRNA	CTD	PMID:20971185
Rrm1	Mouse	copper(0)	increases expression	ISO	RGD:1592569	6480464	Copper results in increased expression of RRM1 mRNA	CTD	PMID:30556269
Rrm1	Mouse	corosolic acid	decreases expression	ISO	RGD:737409	6480464	corosolic acid results in decreased expression of RRM1 mRNA; corosolic acid results in decreased expression more ...	CTD	PMID:37939859
Rrm1	Mouse	corticosterone	decreases expression	ISO	RGD:1592569	6480464	Corticosterone results in decreased expression of RRM1 mRNA	CTD	PMID:15755911
Rrm1	Mouse	coumestrol	multiple interactions	ISO	RGD:737409	6480464	[Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of RRM1 mRNA; [Coumestrol co-treated with resveratrol] more ...	CTD	PMID:19167446
Rrm1	Mouse	coumestrol	increases expression	ISO	RGD:737409	6480464	Coumestrol results in increased expression of RRM1 mRNA	CTD	PMID:19167446
Rrm1	Mouse	crocidolite asbestos	decreases expression	EXP		6480464	Asbestos, Crocidolite results in decreased expression of RRM1 mRNA	CTD	PMID:19446018
Rrm1	Mouse	cyclophosphamide	decreases expression	EXP		6480464	Cyclophosphamide results in decreased expression of RRM1 mRNA	CTD	PMID:21041162
Rrm1	Mouse	cyclosporin A	decreases expression	EXP		6480464	Cyclosporine results in decreased expression of RRM1 mRNA	CTD	PMID:17942131
Rrm1	Mouse	cyclosporin A	affects expression	ISO	RGD:737409	6480464	Cyclosporine affects the expression of RRM1 mRNA	CTD	PMID:25562108
Rrm1	Mouse	cyclosporin A	decreases expression	ISO	RGD:737409	6480464	Cyclosporine results in decreased expression of RRM1 mRNA	CTD	PMID:20106945\|PMID:21632981
Rrm1	Mouse	DDE	increases expression	ISO	RGD:737409	6480464	Dichlorodiphenyl Dichloroethylene results in increased expression of RRM1 mRNA	CTD	PMID:38568856
Rrm1	Mouse	decabromodiphenyl ether	decreases expression	ISO	RGD:737409	6480464	decabromobiphenyl ether results in decreased expression of RRM1 protein	CTD	PMID:31675489
Rrm1	Mouse	dexamethasone	decreases expression	EXP		6480464	Dexamethasone results in decreased expression of RRM1 mRNA	CTD	PMID:21041162
Rrm1	Mouse	diarsenic trioxide	increases expression	ISO	RGD:737409	6480464	Arsenic Trioxide results in increased expression of RRM1 protein	CTD	PMID:25419056
Rrm1	Mouse	diarsenic trioxide	multiple interactions	ISO	RGD:737409	6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to RRM1 protein]	CTD	PMID:26598702
Rrm1	Mouse	diarsenic trioxide	decreases expression	ISO	RGD:737409	6480464	Arsenic Trioxide results in decreased expression of RRM1 protein	CTD	PMID:25174355\|PMID:25335113
Rrm1	Mouse	diazinon	decreases expression	ISO	RGD:737409	6480464	Diazinon results in decreased expression of RRM1 mRNA	CTD	PMID:16539210
Rrm1	Mouse	dibenz[a,h]anthracene	increases expression	EXP		6480464	1,2,5,6-dibenzanthracene results in increased expression of RRM1 mRNA	CTD	PMID:26377693
Rrm1	Mouse	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of RRM1 mRNA	CTD	PMID:21266533
Rrm1	Mouse	dicrotophos	decreases expression	ISO	RGD:737409	6480464	dicrotophos results in decreased expression of RRM1 mRNA	CTD	PMID:28302478
Rrm1	Mouse	diethylstilbestrol	decreases expression	EXP		6480464	Diethylstilbestrol results in decreased expression of RRM1 mRNA	CTD	PMID:21041162
Rrm1	Mouse	dorsomorphin	multiple interactions	ISO	RGD:737409	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Rrm1	Mouse	doxorubicin	decreases expression	ISO	RGD:737409	6480464	Doxorubicin results in decreased expression of RRM1 mRNA	CTD	PMID:29803840
Rrm1	Mouse	Enterolactone	multiple interactions	ISO	RGD:737409	6480464	[Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of RRM1 mRNA	CTD	PMID:19167446
Rrm1	Mouse	enzyme inhibitor	multiple interactions	ISO	RGD:737409	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ...	CTD	PMID:23301498
Rrm1	Mouse	epoxiconazole	decreases expression	EXP		6480464	epoxiconazole results in decreased expression of RRM1 mRNA	CTD	PMID:35436446
Rrm1	Mouse	fenvalerate	decreases expression	ISO	RGD:1592569	6480464	fenvalerate results in decreased expression of RRM1 mRNA	CTD	PMID:30307764
Rrm1	Mouse	folic acid	multiple interactions	EXP		6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RRM1 mRNA	CTD	PMID:22206623
Rrm1	Mouse	fulvestrant	decreases expression	ISO	RGD:737409	6480464	fulvestrant results in decreased expression of RRM1 mRNA	CTD	PMID:16514628
Rrm1	Mouse	furan	increases expression	ISO	RGD:1592569	6480464	furan results in increased expression of RRM1 mRNA	CTD	PMID:25539665
Rrm1	Mouse	gamma-tocopherol	increases expression	EXP		6480464	Tocopherols results in increased expression of RRM1 mRNA	CTD	PMID:17056531
Rrm1	Mouse	gefitinib	affects response to substance	ISO	RGD:737409	6480464	RRM1 gene polymorphism affects the susceptibility to gefitinib	CTD	PMID:21264830
Rrm1	Mouse	gemcitabine	affects response to substance	ISO	RGD:737409	6480464	RRM1 protein affects the susceptibility to Gemcitabine	CTD	PMID:26894857
Rrm1	Mouse	gemcitabine	multiple interactions	ISO	RGD:737409	6480464	[Gemcitabine results in decreased susceptibility to Gemcitabine] which results in increased expression of RRM1 mRNA; more ...	CTD	PMID:25189999
Rrm1	Mouse	graphite	decreases expression	ISO	RGD:737409	6480464	Graphite results in decreased expression of RRM1 protein	CTD	PMID:22157353
Rrm1	Mouse	hydrogen peroxide	affects expression	ISO	RGD:737409	6480464	Hydrogen Peroxide affects the expression of RRM1 mRNA	CTD	PMID:20044591\|PMID:23410634
Rrm1	Mouse	indometacin	increases expression	ISO	RGD:1592569	6480464	Indomethacin results in increased expression of RRM1 mRNA	CTD	PMID:36868495
Rrm1	Mouse	ivermectin	decreases expression	ISO	RGD:737409	6480464	Ivermectin results in decreased expression of RRM1 protein	CTD	PMID:32959892
Rrm1	Mouse	lead(0)	decreases expression	ISO	RGD:737409	6480464	Lead results in decreased expression of RRM1 mRNA	CTD	PMID:19921347
Rrm1	Mouse	lidocaine	increases expression	ISO	RGD:1592569	6480464	Lidocaine results in increased expression of RRM1 mRNA	CTD	PMID:35283115
Rrm1	Mouse	menadione	affects expression	ISO	RGD:737409	6480464	Vitamin K 3 affects the expression of RRM1 mRNA	CTD	PMID:20044591\|PMID:23410634
Rrm1	Mouse	methimazole	increases expression	ISO	RGD:1592569	6480464	Methimazole results in increased expression of RRM1 mRNA	CTD	PMID:30047161
Rrm1	Mouse	methylseleninic acid	affects expression	ISO	RGD:737409	6480464	methylselenic acid affects the expression of RRM1 mRNA	CTD	PMID:14617803
Rrm1	Mouse	Mitotane	increases expression	ISO	RGD:737409	6480464	Mitotane results in increased expression of RRM1 mRNA	CTD	PMID:22547773
Rrm1	Mouse	Mitotane	decreases response to substance	ISO	RGD:737409	6480464	RRM1 protein results in decreased susceptibility to Mitotane	CTD	PMID:22547773
Rrm1	Mouse	mono(2-ethylhexyl) phthalate	decreases expression	EXP		6480464	mono-(2-ethylhexyl)phthalate results in decreased expression of RRM1 mRNA	CTD	PMID:33162236
Rrm1	Mouse	N-nitrosodiethylamine	increases expression	EXP		6480464	Diethylnitrosamine results in increased expression of RRM1 mRNA	CTD	PMID:17854601
Rrm1	Mouse	nitrates	multiple interactions	EXP		6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of RRM1 more ...	CTD	PMID:35964746
Rrm1	Mouse	Nutlin-3	multiple interactions	ISO	RGD:737409	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of RRM1 protein	CTD	PMID:38460933
Rrm1	Mouse	oxaliplatin	multiple interactions	ISO	RGD:1592569	6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of RRM1 mRNA	CTD	PMID:25729387
Rrm1	Mouse	oxaliplatin	decreases expression	ISO	RGD:1592569	6480464	oxaliplatin results in decreased expression of RRM1 mRNA	CTD	PMID:25729387
Rrm1	Mouse	ozone	increases expression	EXP		6480464	Ozone results in increased expression of RRM1 mRNA	CTD	PMID:12763052\|PMID:19555225
Rrm1	Mouse	ozone	multiple interactions	EXP		6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ...	CTD	PMID:34911549
Rrm1	Mouse	palbociclib	decreases expression	ISO	RGD:737409	6480464	palbociclib results in decreased expression of RRM1 mRNA	CTD	PMID:22869556
Rrm1	Mouse	paracetamol	affects expression	EXP		6480464	Acetaminophen affects the expression of RRM1 mRNA	CTD	PMID:17562736
Rrm1	Mouse	paracetamol	increases expression	ISO	RGD:1592569	6480464	Acetaminophen results in increased expression of RRM1 mRNA	CTD	PMID:33387578
Rrm1	Mouse	paracetamol	increases expression	ISO	RGD:737409	6480464	Acetaminophen results in increased expression of RRM1 mRNA	CTD	PMID:22230336
Rrm1	Mouse	paracetamol	decreases expression	ISO	RGD:737409	6480464	Acetaminophen results in decreased expression of RRM1 mRNA	CTD	PMID:21420995\|PMID:29067470
Rrm1	Mouse	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of RRM1 mRNA	CTD	PMID:17942131
Rrm1	Mouse	PCB138	multiple interactions	EXP		6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Rrm1	Mouse	pentachlorophenol	decreases expression	EXP		6480464	Pentachlorophenol results in decreased expression of RRM1 mRNA	CTD	PMID:23892564
Rrm1	Mouse	perfluorononanoic acid	decreases expression	ISO	RGD:737409	6480464	perfluoro-n-nonanoic acid results in decreased expression of RRM1 mRNA	CTD	PMID:32588087
Rrm1	Mouse	perfluorooctanoic acid	decreases expression	ISO	RGD:737409	6480464	perfluorooctanoic acid results in decreased expression of RRM1 protein	CTD	PMID:26879310
Rrm1	Mouse	phenobarbital	affects expression	ISO	RGD:737409	6480464	Phenobarbital affects the expression of RRM1 mRNA	CTD	PMID:19159669
Rrm1	Mouse	phenobarbital	affects expression	EXP		6480464	Phenobarbital affects the expression of RRM1 mRNA	CTD	PMID:19136022\|PMID:23091169
Rrm1	Mouse	phenylmercury acetate	decreases expression	ISO	RGD:737409	6480464	Phenylmercuric Acetate results in decreased expression of RRM1 mRNA	CTD	PMID:26272509
Rrm1	Mouse	phenylmercury acetate	multiple interactions	ISO	RGD:737409	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Rrm1	Mouse	picoxystrobin	increases expression	ISO	RGD:737409	6480464	picoxystrobin results in increased expression of RRM1 mRNA	CTD	PMID:33512557
Rrm1	Mouse	pirinixic acid	multiple interactions	EXP		6480464	PPARA protein promotes the reaction [pirinixic acid results in increased expression of RRM1 mRNA]	CTD	PMID:17950772
Rrm1	Mouse	pirinixic acid	increases expression	EXP		6480464	pirinixic acid results in increased expression of RRM1 mRNA	CTD	PMID:17950772\|PMID:20813756\|PMID:23811191
Rrm1	Mouse	pirinixic acid	affects expression	EXP		6480464	pirinixic acid affects the expression of RRM1 mRNA	CTD	PMID:19136022
Rrm1	Mouse	progesterone	affects expression	EXP		6480464	Progesterone affects the expression of RRM1 mRNA	CTD	PMID:17251523
Rrm1	Mouse	quercetin	increases expression	ISO	RGD:737409	6480464	Quercetin results in increased expression of RRM1 mRNA	CTD	PMID:21632981
Rrm1	Mouse	quinoline	decreases expression	ISO	RGD:737409	6480464	quinoline analog results in decreased expression of RRM1 protein	CTD	PMID:18645022
Rrm1	Mouse	raloxifene	decreases expression	ISO	RGD:737409	6480464	Raloxifene Hydrochloride results in decreased expression of RRM1 mRNA	CTD	PMID:16514628
Rrm1	Mouse	resveratrol	multiple interactions	ISO	RGD:737409	6480464	[Coumestrol co-treated with Resveratrol] results in increased expression of RRM1 mRNA; [Plant Extracts co-treated with more ...	CTD	PMID:19167446\|PMID:23557933
Rrm1	Mouse	SB 431542	multiple interactions	ISO	RGD:737409	6480464	[LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of RRM1 more ...	CTD	PMID:27188386\|PMID:37664457
Rrm1	Mouse	senecionine	increases expression	ISO	RGD:1592569	6480464	senecionine results in increased expression of RRM1 mRNA	CTD	PMID:32419051
Rrm1	Mouse	sodium arsenite	decreases methylation	ISO	RGD:737409	6480464	sodium arsenite results in decreased methylation of RRM1 gene	CTD	PMID:25199682
Rrm1	Mouse	sodium arsenite	increases expression	ISO	RGD:737409	6480464	sodium arsenite results in increased expression of RRM1 mRNA	CTD	PMID:34032870
Rrm1	Mouse	sodium dichromate	affects expression	ISO	RGD:1592569	6480464	sodium bichromate affects the expression of RRM1 mRNA	CTD	PMID:22110744
Rrm1	Mouse	sodium dichromate	decreases expression	EXP		6480464	sodium bichromate results in decreased expression of RRM1 mRNA	CTD	PMID:31558096
Rrm1	Mouse	sunitinib	decreases expression	ISO	RGD:737409	6480464	Sunitinib results in decreased expression of RRM1 mRNA	CTD	PMID:31533062
Rrm1	Mouse	tert-butyl hydroperoxide	decreases expression	ISO	RGD:737409	6480464	tert-Butylhydroperoxide results in decreased expression of RRM1 mRNA	CTD	PMID:15336504
Rrm1	Mouse	tert-butyl hydroperoxide	affects expression	ISO	RGD:737409	6480464	tert-Butylhydroperoxide affects the expression of RRM1 mRNA	CTD	PMID:23410634
Rrm1	Mouse	tetrachloromethane	affects expression	EXP		6480464	Carbon Tetrachloride affects the expression of RRM1 mRNA	CTD	PMID:17484886
Rrm1	Mouse	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of RRM1 mRNA	CTD	PMID:31919559
Rrm1	Mouse	tetraphene	multiple interactions	EXP		6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Rrm1	Mouse	thapsigargin	decreases expression	ISO	RGD:737409	6480464	Thapsigargin results in decreased expression of RRM1 mRNA	CTD	PMID:22378314
Rrm1	Mouse	thioacetamide	increases expression	ISO	RGD:1592569	6480464	Thioacetamide results in increased expression of RRM1 mRNA	CTD	PMID:34492290
Rrm1	Mouse	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of RRM1 mRNA	CTD	PMID:23557971
Rrm1	Mouse	titanium dioxide	decreases methylation	EXP		6480464	titanium dioxide results in decreased methylation of RRM1 gene	CTD	PMID:35295148
Rrm1	Mouse	tocopherol	increases expression	EXP		6480464	Tocopherols results in increased expression of RRM1 mRNA	CTD	PMID:17056531
Rrm1	Mouse	toluene 2,4-diisocyanate	increases expression	EXP		6480464	Toluene 2,4-Diisocyanate results in increased expression of RRM1 mRNA	CTD	PMID:21404309
Rrm1	Mouse	topotecan	multiple interactions	ISO	RGD:1592569	6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of RRM1 mRNA	CTD	PMID:25729387
Rrm1	Mouse	tributylstannane	multiple interactions	ISO	RGD:1592569	6480464	[bisphenol A co-treated with tributyltin] results in increased expression of RRM1 mRNA	CTD	PMID:31129395
Rrm1	Mouse	Tributyltin oxide	decreases expression	EXP		6480464	bis(tri-n-butyltin)oxide results in decreased expression of RRM1 mRNA	CTD	PMID:17942131
Rrm1	Mouse	trimellitic anhydride	increases expression	EXP		6480464	trimellitic anhydride results in increased expression of RRM1 mRNA	CTD	PMID:19042947
Rrm1	Mouse	triphenyl phosphate	affects expression	ISO	RGD:737409	6480464	triphenyl phosphate affects the expression of RRM1 mRNA	CTD	PMID:37042841
Rrm1	Mouse	troglitazone	decreases expression	ISO	RGD:737409	6480464	troglitazone results in decreased expression of RRM1 mRNA	CTD	PMID:19140230
Rrm1	Mouse	trovafloxacin	decreases expression	EXP		6480464	trovafloxacin results in decreased expression of RRM1 mRNA	CTD	PMID:35537566
Rrm1	Mouse	urethane	decreases expression	ISO	RGD:737409	6480464	Urethane results in decreased expression of RRM1 mRNA	CTD	PMID:28818685
Rrm1	Mouse	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of RRM1 mRNA	CTD	PMID:17292431
Rrm1	Mouse	valproic acid	decreases expression	ISO	RGD:737409	6480464	Valproic Acid results in decreased expression of RRM1 mRNA	CTD	PMID:23179753\|PMID:28001369
Rrm1	Mouse	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of RRM1 mRNA	CTD	PMID:10716750
Rrm1	Mouse	vancomycin	decreases expression	EXP		6480464	Vancomycin results in decreased expression of RRM1 mRNA	CTD	PMID:18930951
Rrm1	Mouse	vorinostat	increases expression	ISO	RGD:737409	6480464	vorinostat results in increased expression of RRM1 mRNA	CTD	PMID:27188386

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rrm1	Mouse	2'-deoxyribonucleotide biosynthetic process	involved_in	ISO	ComplexPortal:CPX-369	2290270		ComplexPortal	GO_REF:0000114
Rrm1	Mouse	2'-deoxyribonucleotide biosynthetic process	involved_in	IDA		2290270	PMID:12578384	ComplexPortal	PMID:12578384
Rrm1	Mouse	2'-deoxyribonucleotide biosynthetic process	involved_in	ISO	UniProtKB:P23921	2290270		GO_Central	GO_REF:0000119
Rrm1	Mouse	cell proliferation in forebrain		ISO	RGD:1592569	9068941		RGD	PMID:12834878\|REF_RGD_ID:5133694
Rrm1	Mouse	cell proliferation in forebrain	involved_in	IEA	UniProtKB:A0A8I5Y915\|ensembl:ENSRNOP00000076633	2290270		Ensembl	GO_REF:0000107
Rrm1	Mouse	deoxyribonucleotide biosynthetic process	involved_in	IBA	PANTHER:PTN000171388\|SGD:S000000872\|MGI:98180\|UniProtKB:P23921\|UniProtKB:P9WH75\|UniProtKB:P39452\|dictyBase:DDB_G0284071\|UniProtKB:P00452\|SGD:S000001328\|PomBase:SPAC1F7.05	2290270		GO_Central	GO_REF:0000033
Rrm1	Mouse	deoxyribonucleotide biosynthetic process	involved_in	IDA		2290270	PMID:19176520	UniProt	PMID:19176520
Rrm1	Mouse	DNA repair	involved_in	ISO	UniProtKB:P23921	2290270		GO_Central	GO_REF:0000119
Rrm1	Mouse	DNA repair	involved_in	ISO	ComplexPortal:CPX-369	2290270		ComplexPortal	GO_REF:0000114
Rrm1	Mouse	DNA synthesis involved in DNA repair	involved_in	NAS		2290270	PMID:10716435	ComplexPortal	PMID:10716435
Rrm1	Mouse	male gonad development	involved_in	IEA	UniProtKB:A0A8I5Y915\|ensembl:ENSRNOP00000076633	2290270		Ensembl	GO_REF:0000107
Rrm1	Mouse	male gonad development		ISO	RGD:1592569	9068941		RGD	PMID:2775821\|REF_RGD_ID:5133698
Rrm1	Mouse	mitochondrial DNA replication	involved_in	IMP		2290270	PMID:17486094	ComplexPortal	PMID:17486094
Rrm1	Mouse	mitochondrial DNA replication	involved_in	ISO	UniProtKB:P23921	2290270		GO_Central	GO_REF:0000119
Rrm1	Mouse	positive regulation of G0 to G1 transition	involved_in	IDA		2290270	PMID:11517226	ComplexPortal	PMID:11517226
Rrm1	Mouse	positive regulation of G0 to G1 transition	involved_in	ISO	UniProtKB:P23921	2290270		GO_Central	GO_REF:0000119
Rrm1	Mouse	positive regulation of G1/S transition of mitotic cell cycle	involved_in	ISO	UniProtKB:P23921	2290270		GO_Central	GO_REF:0000119
Rrm1	Mouse	positive regulation of G1/S transition of mitotic cell cycle	involved_in	ISO	ComplexPortal:CPX-2194	2290270		ComplexPortal	GO_REF:0000114
Rrm1	Mouse	positive regulation of G2/M transition of mitotic cell cycle	involved_in	ISO	UniProtKB:P23921	2290270		GO_Central	GO_REF:0000119
Rrm1	Mouse	positive regulation of G2/M transition of mitotic cell cycle	involved_in	ISO	ComplexPortal:CPX-369	2290270		ComplexPortal	GO_REF:0000114
Rrm1	Mouse	protein heterotetramerization	involved_in	IPI	UniProtKB:P11157	2290270	PMID:19176520	UniProt	PMID:19176520
Rrm1	Mouse	pyrimidine nucleobase metabolic process		ISO	RGD:1592569	9068941	orotic acid	RGD	PMID:10204803\|REF_RGD_ID:5133695
Rrm1	Mouse	pyrimidine nucleobase metabolic process	involved_in	IEA	UniProtKB:A0A8I5Y915\|ensembl:ENSRNOP00000076633	2290270		Ensembl	GO_REF:0000107
Rrm1	Mouse	response to ionizing radiation	involved_in	IEA	UniProtKB:A0A8I5Y915\|ensembl:ENSRNOP00000076633	2290270		Ensembl	GO_REF:0000107
Rrm1	Mouse	response to ionizing radiation		ISO	RGD:1592569	9068941		RGD	PMID:19444910\|REF_RGD_ID:2314410
Rrm1	Mouse	retina development in camera-type eye		ISO	RGD:1592569	9068941		RGD	PMID:2647502\|REF_RGD_ID:5133699
Rrm1	Mouse	retina development in camera-type eye	involved_in	IEA	UniProtKB:A0A8I5Y915\|ensembl:ENSRNOP00000076633	2290270		Ensembl	GO_REF:0000107
Rrm1	Mouse	ribonucleoside diphosphate metabolic process	involved_in	IDA		2290270	PMID:12578384	ComplexPortal	PMID:12578384
Rrm1	Mouse	ribonucleoside diphosphate metabolic process	involved_in	ISO	UniProtKB:P23921	2290270		GO_Central	GO_REF:0000119
Rrm1	Mouse	ribonucleoside diphosphate metabolic process	involved_in	ISO	ComplexPortal:CPX-369	2290270		ComplexPortal	GO_REF:0000114

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rrm1	Mouse	cell projection	located_in	ISO	RGD:1592569	2290270		GO_Central	GO_REF:0000096
Rrm1	Mouse	cell projection		ISO	RGD:1592569	9068941		RGD	PMID:15725396\|REF_RGD_ID:5133692
Rrm1	Mouse	centriolar satellite	located_in	IEA	UniProtKB:P23921\|ensembl:ENSP00000300738	2290270		Ensembl	GO_REF:0000107
Rrm1	Mouse	ciliary basal body	located_in	IEA	UniProtKB:P23921\|ensembl:ENSP00000300738	2290270		Ensembl	GO_REF:0000107
Rrm1	Mouse	cytosol	located_in	ISO	ComplexPortal:CPX-2194	2290270		ComplexPortal	GO_REF:0000114
Rrm1	Mouse	cytosol	located_in	ISO	UniProtKB:P23921	2290270		GO_Central	GO_REF:0000119
Rrm1	Mouse	mitochondrion	located_in	IEA	GO:0006264	2290270		GOC	GO_REF:0000108
Rrm1	Mouse	neuronal cell body		ISO	RGD:1592569	9068941		RGD	PMID:12834878\|REF_RGD_ID:5133694
Rrm1	Mouse	neuronal cell body	located_in	ISO	RGD:1592569	2290270		GO_Central	GO_REF:0000096
Rrm1	Mouse	neuronal cell body	located_in	IEA	UniProtKB:A0A8I5Y915\|ensembl:ENSRNOP00000076633	2290270		Ensembl	GO_REF:0000107
Rrm1	Mouse	nuclear envelope	located_in	IEA	UniProtKB:A0A8I5Y915\|ensembl:ENSRNOP00000076633	2290270		Ensembl	GO_REF:0000107
Rrm1	Mouse	nuclear envelope	located_in	ISO	RGD:1592569	2290270		GO_Central	GO_REF:0000096
Rrm1	Mouse	nuclear envelope		ISO	RGD:1592569	9068941		RGD	PMID:2205248\|REF_RGD_ID:5133697
Rrm1	Mouse	ribonucleoside-diphosphate reductase complex	part_of	ISO	UniProtKB:P23921	2290270		GO_Central	GO_REF:0000119
Rrm1	Mouse	ribonucleoside-diphosphate reductase complex	part_of	IDA		2290270	PMID:19176520	MGI	PMID:19176520
Rrm1	Mouse	ribonucleoside-diphosphate reductase complex	part_of	ISO	ComplexPortal:CPX-2194	2290270		ComplexPortal	GO_REF:0000114
Rrm1	Mouse	ribonucleoside-diphosphate reductase complex	part_of	ISS	ComplexPortal:CPX-2194	2290270		ComplexPortal	GO_REF:0000114
Rrm1	Mouse	ribonucleoside-diphosphate reductase complex	part_of	IMP		2290270	PMID:8130196	CAFA	PMID:8130196
Rrm1	Mouse	ribonucleoside-diphosphate reductase complex	part_of	IBA	PANTHER:PTN000171388\|PomBase:SPAC1F7.05\|UniProtKB:P00452\|UniProtKB:P39452\|dictyBase:DDB_G0284071\|UniProtKB:P9WH75\|UniProtKB:P23921\|UniProtKB:Q9I4I1\|MGI:98180\|SGD:S000000872	2290270		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rrm1	Mouse	ATP binding	enables	IBA	PANTHER:PTN000171388\|UniProtKB:P9WH75\|UniProtKB:P00452	2290270		GO_Central	GO_REF:0000033
Rrm1	Mouse	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	2290270		UniProt	GO_REF:0000043
Rrm1	Mouse	disordered domain specific binding	enables	IPI	UniProtKB:P11157	2290270	PMID:8130196	CAFA	PMID:8130196
Rrm1	Mouse	identical protein binding	enables	IEA	UniProtKB:P23921\|ensembl:ENSP00000300738	2290270		Ensembl	GO_REF:0000107
Rrm1	Mouse	identical protein binding	enables	ISO	UniProtKB:P23921	2290270		GO_Central	GO_REF:0000119
Rrm1	Mouse	protein binding	enables	IPI	PR:P11157	2290270	PMID:16829694, PMID:16861739	MGI	PMID:16829694\|PMID:16861739
Rrm1	Mouse	purine nucleotide binding	enables	IDA		2290270	PMID:16861739	MGI	PMID:16861739
Rrm1	Mouse	ribonucleoside-diphosphate reductase activity	enables	ISO	UniProtKB:P23921	2290270		GO_Central	GO_REF:0000119
Rrm1	Mouse	ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	enables	IBA	PANTHER:PTN000171388\|PomBase:SPAC1F7.05\|UniProtKB:P9WH75\|UniProtKB:P50620\|dictyBase:DDB_G0284071	2290270		GO_Central	GO_REF:0000033
Rrm1	Mouse	ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	enables	IDA		2290270	PMID:19176520	UniProt	PMID:19176520
Rrm1	Mouse	ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	contributes_to	IDA		2290270	PMID:16861739	MGI	PMID:16861739

Molecular Pathway Annotations Click to see Annotation Detail View

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rrm1	Mouse	adenine phoshoribosyltransferase deficiency pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00535
Rrm1	Mouse	adenosine monophosphate deaminase deficiency pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00537
Rrm1	Mouse	adenylosuccinate lyase deficiency pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00167
Rrm1	Mouse	AICA-ribosuria pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00168
Rrm1	Mouse	azathioprine pharmacodynamics pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00427
Rrm1	Mouse	gemcitabine pharmacodynamics pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00446
Rrm1	Mouse	gemcitabine pharmacokinetics pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00603
Rrm1	Mouse	Kelley-Seegmiller syndrome pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00365
Rrm1	Mouse	Lesch-Nyhan syndrome pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00364
Rrm1	Mouse	mercaptopurine pharmacodynamics pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00428
Rrm1	Mouse	molybdenum cofactor deficiency pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00203
Rrm1	Mouse	purine metabolic pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00050
Rrm1	Mouse	purine nucleoside phosphorylase deficiency pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00210
Rrm1	Mouse	tioguanine pharmacodynamics pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00430
Rrm1	Mouse	xanthinuria type I pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00512
Rrm1	Mouse	xanthinuria pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00220
Rrm1	Mouse	xanthinuria type II pathway		ISO	RGD:737409	10402751		SMPDB	SMP:00513

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rrm1	Mouse	glutathione metabolic pathway		IEA		6907045		KEGG	mmu:00480
Rrm1	Mouse	purine metabolic pathway		IEA		6907045		KEGG	mmu:00230
Rrm1	Mouse	pyrimidine metabolic pathway		IEA		6907045		KEGG	mmu:00240

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rrm1	Mouse	embryonic lethality before implantation, complete penetrance		IAGP		5509061		MGI	PMID:26077802
Rrm1	Mouse	preweaning lethality, complete penetrance		IEA		5509061		MGI
Rrm1	Mouse	preweaning lethality, incomplete penetrance		IEA		5509061		MGI

Disease Annotations Click to see Annotation Detail View

adrenocortical carcinoma (ISO)

Animal Disease Models (ISO)

Autosomal Recessive Progressive External Ophthalmoplegia with Mitochondrial DNA Deletions 6 (ISO)

delta beta-thalassemia (ISO)

Disease Progression (ISO)

Experimental Liver Neoplasms (ISO)

Experimental Seizures (ISO)

hepatocellular carcinoma (ISO)

lung adenocarcinoma (ISO)

lung non-small cell carcinoma (ISO)

neural tube defect (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (EXP)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (EXP)

1,2-dimethylhydrazine (EXP)

1-chloro-2,4-dinitrobenzene (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,2'-Methylenebis(4-methyl-6-tert-butylphenol) (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (EXP)

2,4,6-tribromophenol (ISO)

2,6-dinitrotoluene (ISO)

2-acetamidofluorene (EXP)

2-bromohexadecanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,4-methylenedioxymethamphetamine (EXP)

3-methylcholanthrene (EXP)

4-(ethoxymethylene)-2-phenyloxazol-5-one (EXP)

4-hydroxyphenyl retinamide (EXP)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (ISO)

acetamide (ISO)

actinomycin D (ISO)

afimoxifene (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (ISO)

Aroclor 1254 (EXP)

arsenite(3-) (ISO)

arsenous acid (ISO)

azathioprine (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (EXP)

beta-carotene (EXP)

beta-lapachone (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (EXP)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

carbon nanotube (EXP,ISO)

chlorpyrifos (EXP)

chromium(6+) (ISO)

chrysene (EXP)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

corosolic acid (ISO)

corticosterone (ISO)

coumestrol (ISO)

crocidolite asbestos (EXP)

cyclophosphamide (EXP)

cyclosporin A (EXP,ISO)

DDE (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (EXP)

diarsenic trioxide (ISO)

diazinon (ISO)

dibenz[a,h]anthracene (EXP)

dibutyl phthalate (EXP)

dicrotophos (ISO)

diethylstilbestrol (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

Enterolactone (ISO)

enzyme inhibitor (ISO)

epoxiconazole (EXP)

fenvalerate (ISO)

folic acid (EXP)

fulvestrant (ISO)

furan (ISO)

gamma-tocopherol (EXP)

gefitinib (ISO)

gemcitabine (ISO)

graphite (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

ivermectin (ISO)

lead(0) (ISO)

lidocaine (ISO)

menadione (ISO)

methimazole (ISO)

methylseleninic acid (ISO)

Mitotane (ISO)

mono(2-ethylhexyl) phthalate (EXP)

N-nitrosodiethylamine (EXP)

nitrates (EXP)

Nutlin-3 (ISO)

oxaliplatin (ISO)

ozone (EXP)

palbociclib (ISO)

paracetamol (EXP,ISO)

PCB138 (EXP)

pentachlorophenol (EXP)

perfluorononanoic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (EXP,ISO)

phenylmercury acetate (ISO)

picoxystrobin (ISO)

pirinixic acid (EXP)

progesterone (EXP)

quercetin (ISO)

quinoline (ISO)

raloxifene (ISO)

resveratrol (ISO)

SB 431542 (ISO)

senecionine (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP,ISO)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP)

tetraphene (EXP)

thapsigargin (ISO)

thioacetamide (ISO)

titanium dioxide (EXP)

tocopherol (EXP)

toluene 2,4-diisocyanate (EXP)

topotecan (ISO)

tributylstannane (ISO)

Tributyltin oxide (EXP)

trimellitic anhydride (EXP)

triphenyl phosphate (ISO)

troglitazone (ISO)

trovafloxacin (EXP)

urethane (ISO)

valproic acid (EXP,ISO)

vancomycin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

2'-deoxyribonucleotide biosynthetic process (IDA,ISO)

cell proliferation in forebrain (IEA,ISO)

deoxyribonucleotide biosynthetic process (IBA,IDA)

DNA repair (ISO)

DNA synthesis involved in DNA repair (NAS)

male gonad development (IEA,ISO)

mitochondrial DNA replication (IMP,ISO)

positive regulation of G0 to G1 transition (IDA,ISO)

positive regulation of G1/S transition of mitotic cell cycle (ISO)

positive regulation of G2/M transition of mitotic cell cycle (ISO)

protein heterotetramerization (IPI)

pyrimidine nucleobase metabolic process (IEA,ISO)

response to ionizing radiation (IEA,ISO)

retina development in camera-type eye (IEA,ISO)

ribonucleoside diphosphate metabolic process (IDA,ISO)

Cellular Component

cell projection (ISO)

centriolar satellite (IEA)

ciliary basal body (IEA)

cytosol (ISO)

mitochondrion (IEA)

neuronal cell body (IEA,ISO)

nuclear envelope (IEA,ISO)

ribonucleoside-diphosphate reductase complex (IBA,IDA,IMP,ISO,ISS)

Molecular Function

ATP binding (IBA,IEA)

disordered domain specific binding (IPI)

identical protein binding (IEA,ISO)

protein binding (IPI)

purine nucleotide binding (IDA)

ribonucleoside-diphosphate reductase activity (ISO)

ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor (IBA,IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

adenine phoshoribosyltransferase deficiency pathway (ISO)

adenosine monophosphate deaminase deficiency pathway (ISO)

adenylosuccinate lyase deficiency pathway (ISO)

AICA-ribosuria pathway (ISO)

azathioprine pharmacodynamics pathway (ISO)

gemcitabine pharmacodynamics pathway (ISO)

gemcitabine pharmacokinetics pathway (ISO)

glutathione metabolic pathway (IEA)

Kelley-Seegmiller syndrome pathway (ISO)

Lesch-Nyhan syndrome pathway (ISO)

mercaptopurine pharmacodynamics pathway (ISO)

molybdenum cofactor deficiency pathway (ISO)

purine metabolic pathway (IEA,ISO)

purine nucleoside phosphorylase deficiency pathway (ISO)

pyrimidine metabolic pathway (IEA)

tioguanine pharmacodynamics pathway (ISO)

xanthinuria type I pathway (ISO)

xanthinuria pathway (ISO)

xanthinuria type II pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

embryonic lethality before implantation, complete penetrance (IAGP)

preweaning lethality, complete penetrance (IEA)

preweaning lethality, incomplete penetrance (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Tumor BRCA1, RRM1 and RRM2 mRNA expression levels and clinical response to first-line gemcitabine plus docetaxel in non-small-cell lung cancer patients.	Boukovinas I, etal., PLoS One. 2008;3(11):e3695. doi: 10.1371/journal.pone.0003695. Epub 2008 Nov 11.
2.	Alterations in specific gene expression and focal neoplastic growth during spontaneous hepatocarcinogenesis in albumin-SV40 T antigen transgenic rats.	Dragan YP, etal., Mol Carcinog. 2004 Jul;40(3):150-9.
3.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
4.	MGDs mouse GO annotations	MGD data from the GO Consortium
5.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
8.	Identification and analysis of genes from the mouse otic vesicle and their association with developmental subprocesses through in situ hybridization.	Powles N, etal., Dev Biol 2004 Apr 1;268(1):24-38.
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Characterization of cell proliferation in the adult dentate under normal conditions and after kainate induced seizures using ribonucleotide reductase and BrdU.	Zhu H, etal., Brain Res. 2005 Mar 2;1036(1-2):7-17.

Additional References at PubMed

PMID:1311843	PMID:2581962	PMID:3025593	PMID:3043191	PMID:3146546	PMID:3275546	PMID:7557993	PMID:8130196	PMID:8248246	PMID:8530424	PMID:9021149	PMID:10349636
PMID:10660063	PMID:10716435	PMID:10922068	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11389549	PMID:11517226	PMID:12477932	PMID:12520002	PMID:12578384	PMID:12687015
PMID:12904583	PMID:14610273	PMID:14681479	PMID:15782199	PMID:15890332	PMID:16141072	PMID:16141073	PMID:16420439	PMID:16829694	PMID:16861739	PMID:17486094	PMID:18554416
PMID:18799693	PMID:19114063	PMID:19176520	PMID:20159953	PMID:20724444	PMID:21267068	PMID:21873635	PMID:22785206	PMID:23530224	PMID:23665500	PMID:24154525	PMID:24194600
PMID:24457600	PMID:26077802	PMID:26178733	PMID:26296893	PMID:27064654	PMID:30389914	PMID:31693903	PMID:32325033	PMID:37352351	PMID:37442135	PMID:38355793	PMID:39360631

Genomics

Comparative Map Data

Rrm1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	102,090,902 - 102,118,978 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	102,090,902 - 102,118,978 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	102,441,695 - 102,469,771 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	102,441,695 - 102,469,771 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	109,590,209 - 109,618,285 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	102,315,688 - 102,342,747 (+)	NCBI		MGSCv36	mm8
Celera	7	102,809,638 - 102,837,567 (+)	NCBI		Celera
Cytogenetic Map	7	E3	NCBI
cM Map	7	54.72	NCBI

RRM1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	4,094,685 - 4,138,932 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	4,094,707 - 4,138,932 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	4,115,915 - 4,160,162 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	4,072,500 - 4,116,682 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	4,072,586 - 4,116,681	NCBI
Celera	11	4,120,880 - 4,164,701 (+)	NCBI		Celera
Cytogenetic Map	11	p15.4	NCBI
HuRef	11	3,849,345 - 3,893,165 (+)	NCBI		HuRef
CHM1_1	11	4,115,391 - 4,159,561 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	4,159,950 - 4,204,024 (+)	NCBI		T2T-CHM13v2.0

Rrm1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	166,235,904 - 166,260,206 (+)	NCBI		GRCr8
mRatBN7.2	1	156,823,960 - 156,848,262 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	156,823,960 - 156,848,261 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	164,801,707 - 164,826,040 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	171,981,799 - 172,006,127 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	164,859,508 - 164,883,799 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	167,538,387 - 167,562,688 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	167,538,263 - 167,562,688 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	173,726,994 - 173,751,295 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	159,930,994 - 159,937,860 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	154,890,871 - 154,915,173 (+)	NCBI		Celera
Cytogenetic Map	1	q32	NCBI

Rrm1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955414	19,850,530 - 19,905,266 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955414	19,850,523 - 19,904,879 (+)	NCBI	ChiLan1.0	ChiLan1.0

RRM1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	6,348,683 - 6,392,806 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	5,588,407 - 5,632,547 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	3,956,528 - 3,999,205 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	4,068,119 - 4,110,474 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	4,068,119 - 4,110,474 (+)	Ensembl	panpan1.1		panPan2

RRM1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	26,595,838 - 26,631,476 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	21	26,595,914 - 26,631,135 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	26,365,162 - 26,400,602 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	26,805,233 - 26,840,936 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	21	26,805,323 - 26,840,930 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	21	26,595,614 - 26,630,876 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	26,811,885 - 26,847,337 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	26,714,390 - 26,749,830 (+)	NCBI		UU_Cfam_GSD_1.0

Rrm1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	59,215,865 - 59,249,179 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936498	815,399 - 848,793 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936498	815,401 - 848,749 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RRM1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	6,025,073 - 6,065,143 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	6,026,151 - 6,065,211 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	6,818,979 - 6,880,069 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RRM1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	62,606,112 - 62,649,979 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	62,604,486 - 62,650,200 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666043	63,252,138 - 63,296,602 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rrm1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624817	5,523,665 - 5,568,994 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624817	5,523,648 - 5,568,997 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rrm1
1753 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	368
Count of miRNA genes:	279
Interacting mature miRNAs:	312
Transcripts:	ENSMUST00000033283
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357460	Vtbt4_m	vertebral trabecular bone trait 4 (mouse)			Not determined		7	101693381	135693530	Mouse
25314307	Mlh1fc2_m	MLH1 foci count 2 (mouse)					7	6502999	133501729	Mouse
27226781	Tibl3_m	tibia length 3, 5 week (mouse)					7	74849748	122199223	Mouse
25314305	Vmm6_m	variable multisystem mineralization 6, eye (mouse)					7	61849748	102749207	Mouse
27226778	Femd11_m	femur midshaft diameter 11, 16 week (mouse)					7	56949748	134001729	Mouse
1301781	Capsq3_m	capsaicin sensitivity related QTL 3 (mouse)			Not determined		7	87143137	119485380	Mouse
14746989	Manh62_m	mandible shape 62 (mouse)					7	75742528	109742528	Mouse
11039524	Tbbr3_m	Trypanosoma brucei brucei response 3 (mouse)					7	100750722	134750843	Mouse
27226769	Tibl12_m	tibia length 12, 10 week (mouse)					7	87249208	126499172	Mouse
10043926	Bw1n_m	body weight 1 in NSY (mouse)			Not determined		7	45161966	118693530	Mouse
27226765	Tibl18_m	tibia length 18, 16 week (mouse)					7	81849748	126499172	Mouse
27226763	Feml20_m	femur length 20, 16 week (mouse)					7	85049208	124199223	Mouse
4142500	Morq1_m	modifier of Rs1 QTL 1 (mouse)			Not determined			80551681	114551791	Mouse
1301647	Elpt_m	elevated leptin (mouse)			Not determined		7	86500186	120500329	Mouse
13208555	Lgth10_m	body length 10 (mouse)					7	51649748	125599172	Mouse
26884408	Bzwq13_m	bi-zygomatic width QTL 13, 16 week (mouse)					7	61749748	121399223	Mouse
1301937	Skull10_m	skull morphology 10 (mouse)			Not determined		7	91482996	125483156	Mouse
1300528	Ssial3_m	susceptibility to sialadenitis 3 (mouse)			Not determined		7	93391848	127392041	Mouse
1300791	Abbp3_m	A/J and C57BL/6 blood pressure 3 (mouse)			Not determined		7	39673887	103510010	Mouse
1301566	Adip3_m	adiposity 3 (mouse)			Not determined		7	75394215	109394346	Mouse
26884404	Huml1_m	humerus length 1, 5 week (mouse)					7	30199425	108999207	Mouse
1301155	Bpq7_m	blood pressure QTL 7 (mouse)			Not determined		7	70143137	104143379	Mouse
26884398	Humsd6_m	humerus midshaft diameter 6, 16 week (mouse)					7	78649748	136901729	Mouse
1301158	Eae4_m	susceptibility to experimental allergic encephalomyelitis 4 (mouse)			Not determined		7	19147398	141919804	Mouse
10412199	Sst2_m	susceptibility to tuberculosis 2 (mouse)			Not determined		7	18728794	119485380	Mouse
27226790	Feml15_m	femur length 15, 10 week (mouse)					7	87249208	126499172	Mouse
13524850	Asrq7_m	acoustic startle response 7 (mouse)					7	98394974	132394974	Mouse
1300654	Bomd1_m	bone mineral density 1 (mouse)			Not determined		7	68365595	102365702	Mouse
1302062	Stheal6_m	soft tissue heal 6 (mouse)			Not determined		7	87043932	121044066	Mouse
26884440	Sklq4_m	skull length QTL 4, 5 week (mouse)					7	65249748	126499172	Mouse
27095903	Scvln10_m	sacral vertebrae length 2, 10 week (mouse)					7	81449748	126499172	Mouse
27226715	Metcl3_m	metatarsal-calcaneal length 3, 5 week (mouse)					7	67849748	119499223	Mouse
26884444	Sklq8_m	skull length QTL 8, 10 week (mouse)					7	67849748	124199223	Mouse
25823170	Hrsq7_m	host response to SARS QTL 7, log titer (mouse)					7	54819589	116822815	Mouse
1301082	Bbaa16_m	B.burgdorferi-associated arthritis 16 (mouse)			Not determined		7	36280015	116416877	Mouse
10412110	Cctq1_m	central corneal thickness QTL 1 (mouse)			Not determined		7	80551681	114551791	Mouse
12792978	Fbmd3_m	femoral bone mineral density 3, females only (mouse)					7	7050288	142367832	Mouse
1301447	Fembm3_m	femoral bone morphometry 3 (mouse)			Not determined		7	100993261	134993342	Mouse
10412104	Tons2_m	tongue size 2 (mouse)			Not determined		7	99837716	133837716	Mouse
1301188	Heal6_m	wound healing/regeneration 6 (mouse)			Not determined		7	87043932	121044066	Mouse
26884418	Bzwq7_m	bi-zygomatic width QTL 7, 10 week (mouse)					7	67849748	105449207	Mouse
10043973	Obq29_m	obesity QTL 29 (mouse)			Not determined		7	72263372	106263372	Mouse
27226751	Femd5_m	femur midshaft diameter 5, 10 week (mouse)					7	53249748	143153737	Mouse
27095933	Ulnl3_m	ulna length 3, 5 week (mouse)					7	73149748	143153737	Mouse
1301105	Cfld4_m	cystic fibrosis lung disease 4 (mouse)			Not determined		7	101693381	135693530	Mouse
1300721	Cfbw3_m	cystic fibrosis body weight 3 (mouse)			Not determined		7	101693381	135693530	Mouse
27095929	Pglq8_m	pelvic girdle length QTL 8, 10 week (mouse)					7	87849208	108099207	Mouse
27226745	Metcl9_m	metatarsal-calcaneal length 9, 10 week (mouse)					7	74849748	122199223	Mouse
27095930	Ulnl10_m	ulna length 10, 16 week (mouse)					7	80849748	126699172	Mouse
27095923	Pglq3_m	pelvic girdle length QTL 3, 5 week (mouse)					7	81249748	124199223	Mouse
27095916	Scvln15_m	sacral vertebrae length 2, 16 week (mouse)					7	61749748	123699223	Mouse
13464255	Ifvrq2_m	influenza virus resistance QTL 2 (mouse)					7	92500698	106455693	Mouse
1357664	Nba3_m	New Zealand Black autoimmunity 3 (mouse)			Not determined		7	91482996	125483156	Mouse
1301478	Eae26_m	susceptibility to experimental allergic encephalomyelitis 26 (mouse)			Not determined		7	98164922	132165010	Mouse
26884451	Sklq14_m	skull length QTL 14, 16 week (mouse)					7	67849748	124999172	Mouse
27095910	Pglq13_m	pelvic girdle length QTL 13, 16 week (mouse)					7	73049748	125699172	Mouse
13463473	Hbbcq4_m	hemoglobin concentration QTL 4 (mouse)					7	87043932	121044066	Mouse
11553869	Stmm2b_m	skin tumor modifier of MSM 2a (mouse)					7	73725965	107725965	Mouse
27095907	Scvln4_m	sacral vertebrae length 2, 5 week (mouse)					7	69949748	120499223	Mouse
1301997	Cia7_m	collagen induced arthritis QTL 7 (mouse)			Not determined		7	85365595	112533819	Mouse

Markers in Region

K02927

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	102,468,551 - 102,468,682	UniSTS	GRCm38
MGSCv37	7	109,617,065 - 109,617,196	UniSTS	GRCm37
Celera	7	102,836,338 - 102,836,469	UniSTS
Cytogenetic Map	7	E3	UniSTS
cM Map	7	69.0	UniSTS
Whitehead/MRC_RH	7	1042.3	UniSTS

Rrm1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	7	E3	UniSTS
cM Map	7	69.0	UniSTS

px-59h6

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	7	E3	UniSTS
cM Map	7	69.0	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_009103	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC102535	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC132096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK049601	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK082135	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK088043	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK137075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK168586	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK184394	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK186518	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK190098	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK192878	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK199985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK200772	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK203165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK207585	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK209545	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK209968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK210911	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK211012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK211974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK213192	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK213243	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK215962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK215988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK218206	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK218683	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK219452	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK220063	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC003299	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC016450	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC066217	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466531	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	K02927	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M14224	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X72306	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000033283 ⟹ ENSMUSP00000033283

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	7	102,090,902 - 102,118,978 (+)	Ensembl
GRCm38.p6 Ensembl	7	102,441,695 - 102,469,771 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000209630 ⟹ ENSMUSP00000147865

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	7	102,112,929 - 102,117,889 (+)	Ensembl
GRCm38.p6 Ensembl	7	102,463,722 - 102,468,682 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000210543

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	7	102,111,900 - 102,114,986 (+)	Ensembl
GRCm38.p6 Ensembl	7	102,462,693 - 102,465,779 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000210751

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	7	102,091,250 - 102,096,724 (+)	Ensembl
GRCm38.p6 Ensembl	7	102,442,043 - 102,447,517 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000211493

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	7	102,109,180 - 102,109,756 (+)	Ensembl
GRCm38.p6 Ensembl	7	102,459,973 - 102,460,549 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000211720 ⟹ ENSMUSP00000147692

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	7	102,091,090 - 102,095,934 (+)	Ensembl
GRCm38.p6 Ensembl	7	102,441,883 - 102,446,727 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000211786

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	7	102,105,677 - 102,106,174 (+)	Ensembl
GRCm38.p6 Ensembl	7	102,456,470 - 102,456,967 (+)	Ensembl

RefSeq Acc Id:

NM_009103 ⟹ NP_033129

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	7	102,090,902 - 102,118,978 (+)	NCBI
GRCm38	7	102,441,695 - 102,469,771 (+)	ENTREZGENE
MGSCv37	7	109,590,209 - 109,618,285 (+)	RGD
Celera	7	102,809,638 - 102,837,567 (+)	RGD
cM Map	7		ENTREZGENE

Sequence:

show sequence

TCAATATGGCGGCCAAGGGACTCGTGTGCTGTCTGTCTACTGCTCAGTTTCCGCCCATTCAACT
CCCGGCGTTGAAACGTCAAGAACGTCATTCGAATTCCGTCCGTCGCGTTGCTCTGCACGTCACG
GGTGGCGGGAGCGGGAAGGAGTTCGTAATTCGGTTAGTCTGCTCTGGTGAGGAAAGTGCTGTCT
ATCGCGCAGCTTCCATCCCTCCGTCCGAGCAGCCTCTCGGAGTCCAACCCTTCACATCTGACAG
TCGTCTCTGTCCCTTCTTCGCCTCGGAGCTGCTAACTGGTCTCGAACCTCTCAGCACTTCAGCT
TCTAGCGGCGATGCATGTGATCAAGCGAGATGGCCGCCAAGAGCGAGTTATGTTTGACAAAATT
ACATCACGAATCCAGAAACTCTGTTATGGACTCAACATGGACTTTGTTGATCCTGCTCAGATCA
CCATGAAAGTAATCCAAGGCCTATATAGTGGGGTCACCACAGTGGAACTGGACACCCTGGCTGC
TGAGACAGCCGCGACCTTGACCACGAAGCACCCTGACTATGCCATCCTGGCAGCAAGGATAGCC
GTCTCTAACTTGCACAAAGAAACAAAGAAAGTGTTCAGTGATGTGATGGAGGATCTCTACAACT
ACATAAATCCGCACAACGGCAGACACTCTCCCATGGTGGCCAGCTCAACACTCGACATTGTTAT
GGCCAATAAGGATCGCCTGAATTCTGCCATTATCTATGACCGAGATTTCTCTTATAACTACTTT
GGCTTTAAGACACTGGAACGGTCATATTTGTTGAAGATCAATGGTAAAGTGGCTGAAAGACCAC
AGCATATGTTGATGAGGGTTTCTGTGGGGATTCACAAAGAAGATATTGATGCTGCAATTGAAAC
CTACAACCTACTTTCTGAGAAGTGGTTCACTCATGCCTCTCCTACTCTCTTCAATGCTGGGACC
AACCGCCCACAGCTGTCTAGCTGTTTCCTCTTGAGTATGAAAGATGACAGCATTGAAGGAATTT
ATGATACTCTGAAGCAGTGTGCCTTGATTTCTAAGTCCGCTGGGGGAATTGGTGTTGCTGTGAG
TTGTATTCGGGCCACTGGTAGCTACATCGCTGGGACTAATGGCAATTCTAATGGCCTTGTGCCA
ATGCTGAGAGTATATAACAACACAGCTCGCTATGTGGATCAAGGTGGAAACAAGCGCCCAGGCG
CGTTTGCTATTTACCTGGAGCCTTGGCACTTAGACATCTTTGAGTTCCTTGACTTGAAGAAGAA
CACAGGCAAGGAAGAACAGCGAGCACGCGATCTCTTCTTTGCACTTTGGATCCCAGATCTCTTC
ATGAAGCGAGTGGAGACTAACCAGGACTGGTCATTGATGTGTCCCAATGAGTGTCCTGGTCTGG
ACGAGGTCTGGGGAGAGGAGTTTGAGAAGTTATATGAAAGTTACGAGAAGCAGGGTCGTGTCCG
AAAAGTTGTAAAAGCTCAGCAGCTTTGGTATGCCATCATTGAGTCCCAGACGGAGACCGGTACC
CCATACATGCTCTACAAAGATTCCTGTAACCGGAAGAGCAACCAGCAGAACCTGGGAACCATCA
AATGCAGCAACCTGTGTACAGAAATAGTAGAGTACACCAGTAAAGATGAGGTTGCAGTTTGTAA
CTTGGCTTCTCTGGCTCTGAATATGTATGTCACACCGGAACATACGTATGACTTTGAGAAACTG
GCAGAAGTCACTAAAGTCATTGTCCGAAATCTGAATAAAATAATTGATATAAACTACTACCCTA
TTCCAGAGGCACACTTATCAAATAAACGCCATCGGCCCATTGGAATTGGGGTACAAGGTTTAGC
AGATGCTTTCATCCTGATGAGATACCCCTTTGAGAGCCCAGAAGCCCAGTTATTAAATAAGCAG
ATCTTTGAAACCATTTACTATGGAGCCCTGGAAGCCAGCTGTGAACTAGCCAAGGAGTATGGCC
CCTATGAAACGTATGAGGGATCTCCAGTCAGCAAGGGTATTCTTCAGTATGACATGTGGAATGT
TGCTCCTACAGACCTGTGGGACTGGAAGCCTCTCAAGGAGAAGATTGCAAAGTATGGTATAAGG
AACAGTTTACTTATTGCCCCAATGCCTACTGCTTCAACTGCCCAGATTCTGGGGAATAATGAGT
CCATTGAGCCTTATACCAGTAACATCTACACTCGAAGAGTCTTGTCAGGGGAATTTCAGATTGT
GAATCCTCACTTACTGAAAGATCTTACTGAGCGGGGCTTGTGGAATGAAGAGATGAAAAATCAG
ATTATTGCATGCAATGGCTCCATTCAGAGCATACCAGAAATTCCTGATGACCTGAAGCAACTCT
ATAAGACCGTGTGGGAAATCTCTCAGAAGACTGTTCTCAAGATGGCAGCCGAGAGAGGTGCTTT
CATCGATCAGAGCCAGTCTTTAAACATCCATATTGCTGAGCCCAACTACGGCAAACTCACTAGT
ATGCACTTCTACGGTTGGAAGCAGGGTTTAAAGACTGGAATGTATTACTTAAGGACGAGGCCTG
CCGCTAATCCAATCCAGTTCACTCTGAACAAGGAAAAACTGAAAGATAAGGAAAAGGCACTGAA
GGAGGAGGAGGAGAAGGAGAGGAACACAGCAGCCATGGTGTGCTCTTTGGAGAACAGAGAGGAG
TGCCTGATGTGTGGATCCTGAGAAAATCAGGGCCTGGGAGACGCAGCGGGCTCTCCTGCCCGCC
GAGGCAGACGATTTGAGCATAGATAGGATAGTGGGTTTGCTTGGTTATCAGCAGCTCTGCTTGG
ACGTGCCTGCCAGGACAGGGAGCCACGACTTACAGTACTGTTTCTACACAGTGTAAATATCATT
TTTAACAAACAGAAAACCAAAGCCAGCTTTGATATTAGGAATCAAAGTAGAGGCTTTGGGAATA
CTAAAGAGCCTTCCTGCAAATTAGTGAGGAGACTTAGGAAGTCTCGTCTCTCCAGCTTTCCCTG
CCTGGCCATTCTCAGTTTGGGCAAAGAGATTTAGTTTGATTTGACTGATTGCCTAGAAGTAAAA
TCAAGCAATTACTCATCAGCTAAAGACCTTTGTCTAGACAAACTTCTATAGGTCATTTTGAAAT
AAACATTTCTAAGTGATTGTGTGGTACTAAACTTGTCATCTATTATCATACAAGACAGTTTAGG
GGAAAAAACCCAAAAACCCAACATTTTCTGTTGAGTTCAGAGAGACAAACTTTAAAGACATTTA
GATTGTATAGATATCTAGTGTTAACATATGCCCTTTCCTGCCCCAGGATGAAATCTTGTTAACA
TAAAATTGACAGTTTCTTTCATTTATAATTTGATTCTGTGGCATTTAGTTCATTCACACTGTTG
TATAAACTGTCATCCACACCATTTCCAAAACATTCCATCATTCCAAATAGAGACTCTACTCATA
ACCACACTTCTTACACCTTTTTGAATATGTATTCCTCATACACATAATGCAGTATTTGCACTTG
TATGGCTTGCATGATATCTAGATACATCACAGTGTGATACGCTGTCCCTCCATATGTGCACACC
ATCTTGTATCCATCCTGTCATCTGTTCATGAAACTTGGTTGTTTCCTCCCTTTAGATAGGGAGA
ATAATGGCTGCCATGAACATTGGTCTACAAATATCTATTGGATTCCTGCTTTTAGGTTTGGTGG
TTCTATACAGCAAAGAATTGCTGGACTATATAATTCTGTTTGACTTTGAGGAGCTATATTTGCA
GCACCATTATATTTCTATAAAAGTACTAAAAGGCCTTATTCTGTCTTCATACCTTATAACACTC
GATTTTCATATTTTTGATAAAGCCCTTCTATGAGTGGGGAATTTCCTGGTCTTGTAGATTGACT
TGTTTCGTTAAACCCGAGTTTTGGGGCATTTTCTCCCTTTAGTCATCACATCCTTTTTTTCCCT
TATGAAACTCATAATAAATCTGCTTTACG

hide sequence

Protein Sequences


Protein RefSeqs	NP_033129	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40061	(Get FASTA)	NCBI Sequence Viewer
	AAH03299	(Get FASTA)	NCBI Sequence Viewer
	AAH16450	(Get FASTA)	NCBI Sequence Viewer
	AAH66217	(Get FASTA)	NCBI Sequence Viewer
	BAC40112	(Get FASTA)	NCBI Sequence Viewer
	BAE23230	(Get FASTA)	NCBI Sequence Viewer
	BAE40455	(Get FASTA)	NCBI Sequence Viewer
	EDL16601	(Get FASTA)	NCBI Sequence Viewer
	EDL16602	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000033283
	ENSMUSP00000033283.10
GenBank Protein	P07742	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_033129 ⟸ NM_009103

- UniProtKB:

Q91YM8 (UniProtKB/Swiss-Prot), P07742 (UniProtKB/Swiss-Prot), Q6NZB3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETA
ATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGRHSPMVASSTLDIVMANK
DRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIDAAIETYNL
LSEKWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIR
ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGK
EEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYESYEKQGRVRKVV
KAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLAS
LALNMYVTPEHTYDFEKLAEVTKVIVRNLNKIIDINYYPIPEAHLSNKRHRPIGIGVQGLADAF
ILMRYPFESPEAQLLNKQIFETIYYGALEASCELAKEYGPYETYEGSPVSKGILQYDMWNVAPT
DLWDWKPLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPH
LLKDLTERGLWNEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQ
SQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKALKEEE
EKERNTAAMVCSLENREECLMCGS

hide sequence

Ensembl Acc Id:

ENSMUSP00000147692 ⟸ ENSMUST00000211720

Ensembl Acc Id:

ENSMUSP00000033283 ⟸ ENSMUST00000033283

Ensembl Acc Id:

ENSMUSP00000147865 ⟸ ENSMUST00000209630

Protein Domains

ATP-cone Ribonucleotide reductase large subunit C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P07742-F1-model_v2	AlphaFold	P07742	1-792	view protein structure

Promoters

RGD ID:

8665033

Promoter ID:

EPDNEW_M10548

Type:

initiation region

Name:

Rrm1_1

Description:

Mus musculus ribonucleotide reductase M1 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	7	102,441,850 - 102,441,910	EPDNEW

RGD ID:

6841964

Promoter ID:

MM_KWN:51840

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

NM_009103

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	7	109,589,841 - 109,590,427 (+)	MPROMDB

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:98180	AgrOrtholog
Ensembl Genes	ENSMUSG00000030978	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000033283	ENTREZGENE
	ENSMUST00000033283.10	UniProtKB/Swiss-Prot
Gene3D-CATH	3.20.70.20	UniProtKB/Swiss-Prot
InterPro	ATP-cone_dom	UniProtKB/Swiss-Prot
	NrdE_NrdA	UniProtKB/Swiss-Prot
	RNR_lg_C	UniProtKB/Swiss-Prot
	RNR_lsu_N	UniProtKB/Swiss-Prot
	RNR_R1-su_N	UniProtKB/Swiss-Prot
	Rrm1	UniProtKB/Swiss-Prot
KEGG Report	mmu:20133	UniProtKB/Swiss-Prot
MGD	MGI:98180	ENTREZGENE
NCBI Gene	20133	ENTREZGENE
PANTHER	PTHR11573	UniProtKB/Swiss-Prot
	RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE SUBUNIT	UniProtKB/Swiss-Prot
Pfam	ATP-cone	UniProtKB/Swiss-Prot
	Ribonuc_red_lgC	UniProtKB/Swiss-Prot
	Ribonuc_red_lgN	UniProtKB/Swiss-Prot
PharmGKB	RRM1	RGD
PhenoGen	Rrm1	PhenoGen
PRINTS	RIBORDTASEM1	UniProtKB/Swiss-Prot
PROSITE	ATP_CONE	UniProtKB/Swiss-Prot
	RIBORED_LARGE	UniProtKB/Swiss-Prot
Superfamily-SCOP	PFL-like glycyl radical enzymes	UniProtKB/Swiss-Prot
	SSF48168	UniProtKB/Swiss-Prot
UniProt	A0A1B0GRW5_MOUSE	UniProtKB/TrEMBL
	A0A1B0GSB1_MOUSE	UniProtKB/TrEMBL
	P07742	ENTREZGENE
	Q05DU8_MOUSE	UniProtKB/TrEMBL
	Q6NZB3	ENTREZGENE, UniProtKB/TrEMBL
	Q91YM8	ENTREZGENE
	RIR1_MOUSE	UniProtKB/Swiss-Prot
UniProt Secondary	Q91YM8	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Mammalian Phenotype