Oxt (oxytocin) - Rat Genome Database

Name: Oxt
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Oxt (oxytocin) Mus musculus

Analyze

Symbol:

Oxt

Name:

oxytocin

RGD ID:

11040

MGI Page

MGI

Description:

Predicted to enable neuropeptide hormone activity and oxytocin receptor binding activity. Involved in positive regulation of cold-induced thermogenesis. Located in cytoplasm and extracellular region. Is expressed in brain. Orthologous to human OXT (oxytocin/neurophysin I prepropeptide).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

neurophysin 1; OT; OT-NPI; Ox; Oxy; oxytocin-neurophysin 1

RGD Orthologs

Human

Rat

Bonobo

Dog

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OXT (oxytocin/neurophysin I prepropeptide)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Oxt (oxytocin/neurophysin I prepropeptide)	HGNC	Treefam, EggNOG, NCBI, OMA, HomoloGene, Inparanoid, Panther, PhylomeDB, OrthoDB, Ensembl
Pan paniscus (bonobo/pygmy chimpanzee):	OXT (oxytocin/neurophysin I prepropeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OXT (oxytocin/neurophysin I prepropeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	OXT (oxytocin/neurophysin I prepropeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OXT (oxytocin/neurophysin I prepropeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Oxt (oxytocin/neurophysin I prepropeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	AVP (arginine vasopressin)	HGNC	OrthoDB
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Oxt (oxytocin/neurophysin I prepropeptide)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	OXT (oxytocin/neurophysin I prepropeptide)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	oxt (oxytocin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid\|ZFIN)
Caenorhabditis elegans (roundworm):	ntc-1	Alliance	DIOPT (PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	130,416,432 - 130,418,974 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	2	130,418,093 - 130,418,974 (+)	Ensembl
GRCm38	2	130,574,519 - 130,577,054 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	130,576,173 - 130,577,054 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	130,401,909 - 130,402,724 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	2	130,267,614 - 130,268,429 (+)	NCBI			mm8
Celera	2	131,800,597 - 131,801,412 (+)	NCBI		Celera
Cytogenetic Map	2	F1	NCBI
cM Map	2	63.24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

anxiety disorder (ISO)

autistic disorder (ISO)

Burns (ISO)

carcinoma (ISO)

Colonic Neoplasms (ISO)

Coma (ISO)

Dehydration (ISO)

disseminated intravascular coagulation (ISO)

Dysmenorrhea (ISO)

Edema (ISO)

epilepsy with generalized tonic-clonic seizures (ISO)

Fetal Death (ISO)

Fetal Distress (ISO)

Flushing (ISO)

gastric ulcer (ISO)

Headache (ISO)

Hyperkinesis (ISO)

hypertension (ISO)

Hyponatremia (ISO)

Hypotension (ISO)

Inflammation (ISO)

ischemia (ISO)

Mammary Neoplasms, Experimental (ISO)

Muscle Hypertonia (ISO)

Myocardial Reperfusion Injury (ISO)

Neurodevelopmental Disorders (ISO)

Pain (ISO)

Polyuria (ISO)

prostate disease (ISO)

Reperfusion Injury (ISO)

Spasm (ISO)

Taste Disorders (ISO)

visual epilepsy (ISO)

Water Intoxication (ISO)

Weight Gain (ISO)

Weight Loss (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,4-D (ISO)

3,5,6-trichloro-2-pyridinol (EXP)

3,5,6-trichloropyridine-2-one (EXP)

3-phenoxybenzoic acid (EXP)

4-tert-Octylphenol (ISO)

5'-phosphopyridoxal-6-azobenzene-2,4-disulfonic acid (ISO)

8-OH-DPAT (ISO)

AM-251 (ISO)

ammonium chloride (ISO)

arachidonyl-2'-chloroethylamide (ISO)

ATP (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (EXP)

Butylparaben (ISO)

butyric acid (EXP)

calcium atom (ISO)

calcium(0) (ISO)

chlorpyrifos (EXP)

clofibrate (EXP)

clozapine (ISO)

colforsin daropate hydrochloride (ISO)

copper atom (ISO)

copper(0) (ISO)

cortisol (ISO)

DDE (EXP,ISO)

decabromodiphenyl ether (ISO)

dibutyl phthalate (EXP)

diethyl phthalate (EXP)

diethylstilbestrol (ISO)

Diisodecyl phthalate (EXP)

diprotium oxide (ISO)

enzacamene (ISO)

flavonoids (ISO)

fluoxetine (ISO)

folic acid (EXP)

linuron (ISO)

lithium atom (ISO)

lithium hydride (ISO)

methamphetamine (ISO)

Nonylphenol (ISO)

p-tert-Amylphenol (ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

phenylephrine (ISO)

prazosin (ISO)

progesterone (EXP,ISO)

pyridaben (EXP)

resveratrol (ISO)

SCH 23390 (ISO)

serotonin (EXP)

thapsigargin (ISO)

trichloroethene (ISO)

triptonide (EXP)

valproic acid (EXP,ISO)

water (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

drinking behavior (ISO)

eating behavior (ISO)

female pregnancy (ISO)

grooming behavior (ISO)

heart development (ISO)

hyperosmotic salinity response (ISO)

male mating behavior (ISO)

maternal aggressive behavior (ISO)

maternal behavior (ISO)

memory (ISO)

negative regulation of blood pressure (ISO)

negative regulation of gastric acid secretion (ISO)

negative regulation of urine volume (ISO)

positive regulation of blood pressure (ISO)

positive regulation of cold-induced thermogenesis (IMP)

positive regulation of cytosolic calcium ion concentration (ISO)

positive regulation of female receptivity (ISO)

positive regulation of hindgut contraction (ISO)

positive regulation of norepinephrine secretion (ISO)

positive regulation of ossification (ISO)

positive regulation of penile erection (ISO)

positive regulation of prostaglandin secretion (ISO)

positive regulation of renal sodium excretion (ISO)

positive regulation of synapse assembly (ISO)

positive regulation of synaptic transmission (ISO)

positive regulation of uterine smooth muscle contraction (ISO)

regulation of digestive system process (ISO)

regulation of heart rate (ISO)

regulation of sensory perception of pain (ISO)

response to activity (ISO)

response to amphetamine (ISO)

response to cAMP (ISO)

response to cocaine (ISO)

response to electrical stimulus (ISO)

response to estradiol (ISO)

response to ether (ISO)

response to food (ISO)

response to glucocorticoid (ISO)

response to organic cyclic compound (ISO)

response to peptide hormone (ISO)

response to progesterone (ISO)

response to prostaglandin E (ISO)

response to retinoic acid (ISO)

response to steroid hormone (ISO)

response to sucrose (ISO)

sleep (ISO)

social behavior (ISO)

sperm ejaculation (ISO)

Cellular Component

cytoplasm (IDA,ISO)

extracellular region (IDA)

extracellular space (IBA,ISO)

secretory granule (IBA,ISO)

terminal bouton (ISO)

Molecular Function

hormone activity (IEA)

neurohypophyseal hormone activity (IEA)

neuropeptide hormone activity (IBA,ISO)

oxytocin receptor binding (IBA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

oxytocin signaling pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal anxiety-related response (IAGP)

abnormal baroreceptor physiology (IAGP)

abnormal cardiovascular system physiology (IAGP)

abnormal circadian behavior (IAGP)

abnormal defecation (IAGP)

abnormal drinking behavior (IAGP)

abnormal food intake (IAGP)

abnormal food preference (IAGP)

abnormal lactation (IAGP)

abnormal mammary gland growth during lactation (IAGP)

abnormal milk ejection (IAGP)

abnormal nursing (IAGP)

abnormal olfactory discrimination memory (IAGP)

abnormal parturition (IAGP)

abnormal social investigation (IAGP)

abnormal social/conspecific interaction behavior (IAGP)

decreased aggression (IAGP)

decreased compensatory feeding amount (IAGP)

decreased grooming behavior (IAGP)

decreased oxygen consumption (IAGP)

decreased prostaglandin level (IAGP)

delayed parturition (IAGP)

galactostasis (IAGP)

hypotension (IAGP)

increased aggression towards mice (IAGP)

increased susceptibility to diet-induced obesity (IAGP)

increased total body fat amount (IAGP)

lactation failure (IAGP)

obese (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Gastric antisecretory and antiulcer activity of oxytocin in rats and guinea pigs.	Asad M, etal., Life Sci. 2001 Nov 21;70(1):17-24.
2.	Time course of c-fos, vasopressin and oxytocin mRNA expression in the hypothalamus following long-term dehydration.	da Silveira LT, etal., Cell Mol Neurobiol. 2007 Aug;27(5):575-84.
3.	Oxytocin alleviates hepatic ischemia-reperfusion injury in rats.	Dusunceli F, etal., Peptides. 2008 Jul;29(7):1216-22. Epub 2008 Feb 26.
4.	Science review: Vasopressin and the cardiovascular system part 1--receptor physiology.	Holmes CL, etal., Crit Care. 2003 Dec;7(6):427-34. Epub 2003 Jun 26.
5.	Vasopressin and oxytocin excite distinct neuronal populations in the central amygdala.	Huber D, etal., Science. 2005 Apr 8;308(5719):245-8.
6.	Oxytocin ameliorates skin damage and oxidant gastric injury in rats with thermal trauma.	Iseri SO, etal., Burns. 2008 May;34(3):361-9. Epub 2007 Sep 10.
7.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
8.	Hypertension and exercise training differentially affect oxytocin and oxytocin receptor expression in the brain.	Martins AS, etal., Hypertension. 2005 Oct;46(4):1004-9. Epub 2005 Sep 12.
9.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
10.	MGDs mouse GO annotations	MGD data from the GO Consortium
11.	MGD IEA	MGD IEA
12.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
13.	Oxytocin exerts protective effects on in vitro myocardial injury induced by ischemia and reperfusion.	Ondrejcakova M, etal., Can J Physiol Pharmacol. 2009 Feb;87(2):137-42.
14.	Postnatal oxytocin treatment of spontaneously hypertensive male rats decreases blood pressure and body weight in adulthood.	Petersson M and Uvnas-Moberg K, Neurosci Lett. 2008 Aug 1;440(2):166-9. Epub 2008 Jun 16.
15.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Effect of oxytocin on acupuncture analgesia in the rat.	Yang J, etal., Neuropeptides. 2007 Oct;41(5):285-92. Epub 2007 Jul 30.

Additional References at PubMed

PMID:2176709	PMID:7830793	PMID:8432536	PMID:8543156	PMID:8863731	PMID:8876199	PMID:8889548	PMID:8933362	PMID:9118797	PMID:9181490	PMID:9678638	PMID:9751758
PMID:9784500	PMID:9924185	PMID:10026810	PMID:10195900	PMID:10349636	PMID:10557207	PMID:10753584	PMID:10888874	PMID:10956266	PMID:11042159	PMID:11071765	PMID:11076861
PMID:11089561	PMID:11318878	PMID:11471062	PMID:11573985	PMID:11588199	PMID:11641104	PMID:11869373	PMID:11956346	PMID:12093924	PMID:12124945	PMID:12383972	PMID:12477932
PMID:12508235	PMID:12531518	PMID:12531722	PMID:12730370	PMID:12746288	PMID:12834440	PMID:12907752	PMID:12944509	PMID:12953013	PMID:12953788	PMID:14557235	PMID:14962074
PMID:14988428	PMID:15089969	PMID:15112106	PMID:15184356	PMID:15307217	PMID:15319220	PMID:15718385	PMID:15924555	PMID:15964694	PMID:16141072	PMID:16141073	PMID:16150836
PMID:16168966	PMID:16249339	PMID:16374801	PMID:16537524	PMID:16594980	PMID:16602821	PMID:16677726	PMID:16930592	PMID:17010099	PMID:17272659	PMID:17287729	PMID:17356169
PMID:17420046	PMID:17433558	PMID:17504245	PMID:17596329	PMID:17895964	PMID:17947352	PMID:18063939	PMID:18071238	PMID:18451093	PMID:18625285	PMID:18926879	PMID:19120108
PMID:19228979	PMID:19247273	PMID:19369205	PMID:19531157	PMID:19653998	PMID:19675071	PMID:19695304	PMID:19889866	PMID:20092567	PMID:20495559	PMID:20554879	PMID:20685878
PMID:20700536	PMID:20732312	PMID:20876615	PMID:20969650	PMID:21046478	PMID:21048978	PMID:21139074	PMID:21247964	PMID:21439349	PMID:21514276	PMID:21741363	PMID:21832120
PMID:21873635	PMID:22079582	PMID:22107910	PMID:22227279	PMID:22262306	PMID:22761429	PMID:22784207	PMID:22865874	PMID:22945632	PMID:22950040	PMID:23028821	PMID:23376700
PMID:23386640	PMID:23403283	PMID:23441222	PMID:23674600	PMID:23906766	PMID:24025838	PMID:24059452	PMID:24205344	PMID:24464043	PMID:24487620	PMID:24893201	PMID:24915299
PMID:24952961	PMID:25071457	PMID:25157144	PMID:25392498	PMID:25605713	PMID:25863961	PMID:25864637	PMID:25874674	PMID:25915476	PMID:25943916	PMID:26139372	PMID:26163772
PMID:26375004	PMID:26611327	PMID:26635729	PMID:26911697	PMID:26926566	PMID:27059771	PMID:27143105	PMID:27187722	PMID:27558735	PMID:28228269	PMID:28288114	PMID:28625488
PMID:28654087	PMID:28669546	PMID:28715127	PMID:28801574	PMID:28807898	PMID:28889007	PMID:28912554	PMID:28963257	PMID:29043563	PMID:29056294	PMID:29184212	PMID:29186377
PMID:29231812	PMID:29277701	PMID:29676731	PMID:29688375	PMID:29991705	PMID:30076862	PMID:30192229	PMID:30240706	PMID:30293821	PMID:30389922	PMID:30472090	PMID:30545636
PMID:30756300	PMID:30820471	PMID:30944474	PMID:31371721	PMID:31517984	PMID:31537381	PMID:31781038	PMID:31843930	PMID:31845417	PMID:32024781	PMID:32325033	PMID:32420597
PMID:32531419	PMID:32640184	PMID:32760004	PMID:32962418	PMID:33113347	PMID:33319747	PMID:33359697	PMID:33504846	PMID:33705350	PMID:33846232	PMID:33869166	PMID:33878523
PMID:33887203	PMID:33903690	PMID:33990685	PMID:34250900	PMID:34381215	PMID:34528509	PMID:34705510	PMID:34932941	PMID:35192674	PMID:35197315	PMID:35241668	PMID:35451958

Genomics

Comparative Map Data

Oxt
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	130,416,432 - 130,418,974 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	2	130,418,093 - 130,418,974 (+)	Ensembl
GRCm38	2	130,574,519 - 130,577,054 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	130,576,173 - 130,577,054 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	130,401,909 - 130,402,724 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	2	130,267,614 - 130,268,429 (+)	NCBI			mm8
Celera	2	131,800,597 - 131,801,412 (+)	NCBI		Celera
Cytogenetic Map	2	F1	NCBI
cM Map	2	63.24	NCBI

OXT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	3,071,620 - 3,072,517 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	20	3,071,620 - 3,072,517 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	3,052,266 - 3,053,163 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	3,000,266 - 3,001,162 (+)	NCBI	NCBI36		hg18	NCBI36
Build 34	20	3,000,265 - 3,001,162	NCBI
Celera	20	3,114,251 - 3,115,147 (+)	NCBI
Cytogenetic Map	20	p13	NCBI
HuRef	20	2,998,607 - 2,999,505 (+)	NCBI		HuRef
CHM1_1	20	3,046,806 - 3,047,704 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	3,102,517 - 3,103,415 (+)	NCBI

Oxt
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	117,782,650 - 117,783,490 (+)	NCBI	mRatBN7.2
mRatBN7.2 Ensembl	3	117,782,650 - 117,783,490 (+)	Ensembl
Rnor_6.0	3	123,106,694 - 123,107,534 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	123,106,694 - 123,107,534 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	129,604,822 - 129,605,662 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	118,194,219 - 118,195,056 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	3	118,097,303 - 118,100,512 (+)	NCBI
Celera	3	116,593,509 - 116,594,349 (+)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

OXT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Mhudiblu_PPA_v0	20	3,157,246 - 3,159,013 (+)	NCBI	Mhudiblu_PPA_v0		panPan3

OXT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	18,193,381 - 18,194,232 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	18,193,339 - 18,194,170 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	18,021,790 - 18,022,393 (-)	NCBI
ROS_Cfam_1.0	24	18,612,328 - 18,612,968 (-)	NCBI
ROS_Cfam_1.0 Ensembl	24	18,612,281 - 18,613,193 (-)	Ensembl
UMICH_Zoey_3.1	24	18,205,647 - 18,206,253 (-)	NCBI
UNSW_CanFamBas_1.0	24	18,318,339 - 18,318,942 (-)	NCBI
UU_Cfam_GSD_1.0	24	18,646,119 - 18,646,759 (-)	NCBI

OXT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	32,605,588 - 32,606,483 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	32,605,586 - 32,606,449 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	36,975,726 - 36,976,589 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OXT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	33,749,520 - 33,750,981 (+)	NCBI	ChlSab1.1		chlSab2
ChlSab1.1 Ensembl	2	33,750,108 - 33,750,968 (+)	Ensembl	ChlSab1.1		chlSab2
Vero_WHO_p1.0	NW_023666071	10,763,922 - 10,764,819 (-)	NCBI	Vero_WHO_p1.0

Oxt
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	4,200,478 - 4,201,580 (+)	Ensembl	HetGla_female_1.0		hetGla2
HetGla 1.0	NW_004624741	4,200,594 - 4,201,416 (+)	NCBI	HetGla_female_1.0		hetGla2

Position Markers

UniSTS:492254

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	2	130,576,190 - 130,576,971	UniSTS	GRCm38
MGSCv37	2	130,401,926 - 130,402,707	UniSTS	GRCm37
Celera	2	131,800,614 - 131,801,395	UniSTS
Cytogenetic Map	2	F1	UniSTS
cM Map	2	73.5	UniSTS

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1302174	Dssc2_m	dextran sodium sulfate induced colitis QTL2 (mouse)			Not determined		2	24224632	148700377	Mouse
4141854	T2dm2sa_m	type 2 diabetes mellitus 2 in SMXA RI mice (mouse)			Not determined		2	29307947	148374934	Mouse
1301344	Lith1_m	lithogenic gene 1 (mouse)			Not determined		2	45347635	145312647	Mouse
13824983	Vclq1_m	curvilinear velocity QTL 1 (mouse)					2	61830344	136841920	Mouse
5491197	Mobq5_m	multigenic obesity QTL 5 (mouse)			Not determined		2	65269746	162518926	Mouse
4141155	Plast2b_m	plasma plant sterol 2b (mouse)			Not determined		2	84013198	148522175	Mouse
10412082	Hylaq1_m	Hyperlocomotor activity related QTL 1 (mouse)			Not determined		2	84013198	148667470	Mouse
5491196	Mobq6_m	multigenic obesity QTL 6 (mouse)			Not determined		2	85724269	180896594	Mouse
27226761	Feml18_m	femur length 18, 16 week (mouse)					2	94230345	154241920	Mouse
11049569	Lmr28d_m	leishmaniasis resistance 28d (mouse)					2	97123370	131123532	Mouse
11049568	Lmr28c_m	leishmaniasis resistance 28c (mouse)					2	97123370	131123532	Mouse
12904935	Edlmmq2_m	extensor digitorum longus muscle mass QTL 2 (mouse)					2	97210364	131210364	Mouse
12904954	Gmmq2_m	gastrocnemius muscle mass QTL 2 (mouse)					2	97210364	131210364	Mouse
4141802	Ignpq1_m	IgA nephropathy QTL 1 (mouse)			Not determined		2	100824060	134824269	Mouse
1302203	Gvhd3_m	graft-versus host disease 3 (mouse)			Not determined		2	100942930	134943090	Mouse
1301330	Tbbmd2_m	total body bone mineral density 2 (mouse)			Not determined		2	100942930	134943090	Mouse
1302071	Fembrs1_m	femur breaking strength 1 (mouse)			Not determined		2	100942930	134943090	Mouse
27226788	Feml13_m	femur length 13, 10 week (mouse)					2	102630345	159941920	Mouse
11038702	Ltpr2_m	Leishmania tropica response 2 (mouse)					2	103095716	167212356	Mouse
1301825	Pbrgcsf1_m	peripheral blood stem cell response to granulocyte colony stimulating factor 1 (mouse)			Not determined		2	106233580	140233729	Mouse
10043875	Bw25_m	body weight QTL 25 (mouse)			Not determined		2	107255676	141255676	Mouse
1301087	Bbaa15_m	B.burgdorferi-associated arthritis 15 (mouse)			Not determined		2	110489658	144489807	Mouse
10045885	Cplaq15_m	circadian period of locomotor activity 15 (mouse)			Not determined		2	110916118	154354667	Mouse
1558990	Skmw9_m	skeletal muscle weight 9 (mouse)			Not determined		2	111173704	145173821	Mouse
1300793	Pcfm2_m	periosteal circumference and femur length 2 (mouse)			Not determined		2	111173704	145173821	Mouse
1301905	Lgth2_m	body length 2 (mouse)			Not determined		2	111173704	145173821	Mouse
1301755	Hrq1_m	heart rate quantitative locus 1 (mouse)			Not determined		2	111173704	145173821	Mouse
1301201	Chab1_m	cholesterol absorption 1 (mouse)			Not determined		2	111551028	145551163	Mouse
1302033	Nsv1_m	Neuroadapted Sindbis viral RNA level 1 (mouse)			Not determined		2	111623386	145623526	Mouse
11039520	Ltpr2h_m	Leishmania tropica response 2h (mouse)					2	112212746	146213005	Mouse
11038699	Ltpr2b_m	Leishmania tropica response 2b (mouse)					2	112212746	146213005	Mouse
11038700	Ltpr2a_m	Leishmania tropica response 2a (mouse)					2	112212746	146213005	Mouse
1301029	T2dm3_m	type 2 diabetes mellitus 3 (mouse)			Not determined		2	114288075	132714157	Mouse
11039521	Ltpr2g_m	Leishmania tropica response 2g (mouse)					2	115212857	149212994	Mouse
11038696	Ltpr2f_m	Leishmania tropica response 2f (mouse)					2	115212857	149212994	Mouse
1301295	Prdt1_m	prion disease incubation time 1 (mouse)			Not determined		2	116077623	150077741	Mouse
1558881	Ses7_m	salmonella enteritidis susceptibility 7 (mouse)			Not determined		2	116306330	150306474	Mouse
1301618	Bglu1_m	blood glucose level 1 (mouse)			Not determined		2	117942930	174324863	Mouse
12910795	Pwbwq5_m	post-weaning body weight QTL 5 (mouse)					2	118589253	160611165	Mouse
12910799	Pwgrq2_m	pre-weaning growth rate QTL 2 (mouse)					2	118589253	160611165	Mouse
12910812	Pwgrq1_m	pre-weaning growth rate QTL 1 (mouse)					2	118589253	160611165	Mouse
12910814	Pwbwq1_m	pre-weaning body weight QTL 1 (mouse)					2	118589253	160611165	Mouse
1300712	El2_m	epilepsy 2 (mouse)			Not determined		2	122207146	142532135	Mouse
1301294	Hrtfm5_m	heart failure modifier 5 (mouse)			Not determined		2	122883015	156883131	Mouse
1301066	Otx2m2_m	orthodenticle homolog 2 (Drosophila) modifier 2 (mouse)			Not determined		2	123231973	148700377	Mouse
1301822	Pgia2_m	proteoglycan induced arthritis 2 (mouse)			Not determined		2	123937311	157937424	Mouse
27226749	Femd10_m	femur midshaft diameter 10, 16 week (mouse)					2	124441920	168241920	Mouse
13506763	Tbvq1_m	trabecular bone volume QTL 1 (mouse)					2	126041920	135441920	Mouse
1302143	Bwq5_m	body weight (mouse)			Not determined		2	127664019	161664118	Mouse
1301031	Bdln3_m	body length 3 (mouse)			Not determined		2	127664019	161664118	Mouse
1558989	Gnf4_m	growth and fatness 4 (mouse)			Not determined		2	128173704	132714157	Mouse
12880427	V25Dq3_m	vitamin D inactive form serum level QTL 3 (mouse)					2	129341920	163341920	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	90
Count of miRNA genes:	89
Interacting mature miRNAs:	89
Transcripts:	ENSMUST00000028764
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_011025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006498910	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF483508	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF483509	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK003042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL731707	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AW455577	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC117030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC117032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HQ679943	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HQ679944	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M88355	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U38901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000028764 ⟹ ENSMUSP00000028764

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	2	130,418,093 - 130,418,974 (+)	Ensembl
GRCm38.p6 Ensembl	2	130,576,173 - 130,577,054 (+)	Ensembl

RefSeq Acc Id:

NM_011025 ⟹ NP_035155

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	2	130,418,089 - 130,418,974 (+)	NCBI
GRCm38	2	130,576,169 - 130,577,054 (+)	NCBI
MGSCv37	2	130,401,909 - 130,402,724 (+)	RGD
Celera	2	131,800,593 - 131,801,478 (+)	NCBI
cM Map	2		ENTREZGENE

Sequence:

show sequence

AACCATCACCTACAGCGGATCTCAGACTGAGCACCATCGCCATGGCCTGCCCCAGTCTCGCTTG
CTGCCTGCTTGGCTTACTGGCTCTGACCTCGGCCTGCTACATCCAGAACTGCCCCCTGGGCGGC
AAGAGGGCTGTGCTGGACCTGGATATGCGCAAGTGTCTCCCCTGCGGCCCGGGCGGCAAAGGAC
GCTGCTTCGGACCAAGCATCTGCTGCGCGGACGAGCTGGGCTGCTTCGTGGGCACCGCCGAGGC
GCTGCGCTGCCAGGAGGAGAACTACCTGCCTTCGCCCTGCCAGTCTGGCCAGAAGCCCTGCGGG
AGCGGAGGCCGCTGCGCCGCCACAGGCATCTGCTGCAGCCCGGATGGCTGCCGCACAGACCCCG
CCTGCGACCCTGAGTCTGCCTTCTCGGAGCGCTGAGCCCACTTTCTGGGAATACCTTTAGCGCG
CTTCCTTCGTTCCCCATGGCCACTGCCAGAAAAAAAAAAAAAAAAGAAAAGAAAAGAAAAGAAA
AGAAAAATAAAGTAGATTTCCTCTTCAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006498910 ⟹ XP_006498973

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	2	130,416,432 - 130,418,788 (+)	NCBI
GRCm38	2	130,574,519 - 130,576,868 (+)	NCBI

Sequence:

show sequence

TTTTAGATCTATTTATTTTATTTTACGTGTCTGAATGATCTGCCTGCATGTGAGTAATGCACTA
TTCGTGTGCCGGCTGCTAGGTCAGAATAAGTCCCTGGCTCCACTGGAATTGTTGTAAGTGGTTG
TGAGCCACCCTGTGGGTGCTGGGAATCAAACCTGGGTCTTCTGCAAGAGTAACTCTCAGCCCCA
AGATAGCAAGATATTTAACATGAGGCCCAGTGGATGATCTTCAGGTCATTGAGGGCAAGCCCTT
GAAGTGAGTAGTGAGACCTTCATCTCCTCTGGAGAGGTTTTTGATTTCTCAGCCATAAAATGAA
GGGGTTGAGTCTTCCGTGTCTTCCTGCTATGCTTTGTCTGTCTGTCTTTCTTTTGTTTTGGTTG
ATTTTGGTTTTAGTTTGAAGCCCTGGCTGTCCTGGAACTAACAGAAATTCTCCTGCCTCTGTCT
CCTGAGTTCTGGGATTAAAGGTGTGCACCCCCAGCACCCTCTCTTGATATGTATTTCATTTTAA
GGGGCTGGAGAGATGATTAGCCTGCACACTGCTCTTTCAGAGAACCAAATTTTGTCCTGGGCAC
CCACATAGGCCTACCCATGATCCCCTTTAATGACAGCTCCTGGGGATCCAGCACCCTCTTCTGG
TCGCCAAGGAAACCTGCGTGCACAAATGTACACACACAAAATTAAAATTGAAATGCAAAAACTG
TTCCCAAAATGTACTGCTACCATCATGCGGGGGACTTGCCCCACCCAACGTCGCTCACACACTA
GGCAAGTACTCTGCTACTGGGCTGCATGTAACACCCTTCCCATGCAGACCTATGCAGACCTGCA
GCCCAAACCTGAAATGTACCCAGAGCTGCCCAATTGATTGCACCAAAATGGGCCAACCATTATA
TGTGGCCACCTGAGAAGGGTATGACCTTGGCACAAATGGCTTGCTGTAGCTGAGGCCACCTGTT
GGCCACACTCCAGCAGCTGATGGCCACTGTTTTCTCAAACAGGAGTCTAGGCACCTAGTGTGGT
AGTGGATAACTAAACTCAGCATTTGGGAGACAGAAGCAGATGGAGCGCTGTGAGTTCAAGGCCA
GCCTGGTCTACACAGCAGGTTCTAATACAGAGTTTTAAATACTAGTGTAATTTTCCTTTTGCTG
TAATTTTTCTTTCTTTTTATTTTAATTTGGTCTGTTAACTGTGTTTTGGTTTTGATCTCTACTG
AGACTTTGTTTTACGGGCTAGTTAGAAGAGCTGAGGTGCATTCAGAGATTGAACAAGACGCCAT
CTTTTTCCCCATCTAAGTTTCAGGTCCATGTAAGGGCTCCCTCACTCACTTGCCCTATCCTGCC
TTATTCTGAGATATTGGATATCTGTGAAAAACAGCTCCTGGCTAGGGCGCACCTCCAACCCCTC
CCAAGTCTCTCTAGCCTCTTGTAGCCTAGGCCACCCCTTCCAGGCTGCTTCTCTTTTGAGTTCC
AGGTCATTAGCAGAGACGATGACCTTGACCCTAGCCCAGACCCTGCAAATGAAGGGCCTGCCTC
TAAACAGCGTGGAACAATTTGACCCAAGAGACCTTCTGTGACCAGTCATGCTGTCACCCTCTTT
AGACAGTGCTCCACCATGGCAGTGCCCAGACATAAAAAGGTCGGTCTGGGCCGGAGAAACCATC
ACCTACAGCGGATCTCAGACTGAGCACCATCGCCATGGCCTGCCCCAGTCTCGCTTGCTGCCTG
CTTGGCTTACTGGCTCTGACCTCGGCCTGCTACATCCAGAACTGCCCCCTGGGCGGCAAGAGGG
CTGTGCTGGACCTGGATATGCGCAAGTGTCTCCCCTGCGGCCCGGGCGGCAAAGGACGCTGCTT
CGGACCAAGCATCTGCTGCGCGGACGAGCTGGGCTGCTTCGTGGGCACCGCCGAGGCGCTGCGC
TGCCAGGAGGAGAACTACCTGCCTTCGCCCTGCCAGTCTGGCCAGAAGCCCTGCGGGAGCGGAG
GCCGCTGCGCCGCCACAGGCATCTGCTGCAGCCCGGGTGAGCAGGAGGGGGCCCAGCAGGGTGA
CCCGGCAAGGAGCCGTCGGGTTTGCAGCTCAGAACACTGACCCATTTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_035155	(Get FASTA)	NCBI Sequence Viewer
	XP_006498973	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC42024	(Get FASTA)	NCBI Sequence Viewer
	AAI17031	(Get FASTA)	NCBI Sequence Viewer
	AAI17033	(Get FASTA)	NCBI Sequence Viewer
	AAL90782	(Get FASTA)	NCBI Sequence Viewer
	AAL90783	(Get FASTA)	NCBI Sequence Viewer
	AEX30310	(Get FASTA)	NCBI Sequence Viewer
	AEX30311	(Get FASTA)	NCBI Sequence Viewer
	BAB22527	(Get FASTA)	NCBI Sequence Viewer
	EDL28279	(Get FASTA)	NCBI Sequence Viewer
	P35454	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_035155 ⟸ NM_011025
- Peptide Label:	preproprotein
- UniProtKB:	P35454 (UniProtKB/Swiss-Prot), Q545V4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MACPSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDMRKCLPCGPGGKGRCFGPSICCADELG CFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAATGICCSPDGCRTDPACDPESAFSER hide sequence

RefSeq Acc Id:	XP_006498973 ⟸ XM_006498910
- Peptide Label:	isoform X1
- Sequence:	show sequence MACPSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDMRKCLPCGPGGKGRCFGPSICCADELG CFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAATGICCSPGEQEGAQQGDPARSRRVCSSE H hide sequence

RefSeq Acc Id:

ENSMUSP00000028764 ⟸ ENSMUST00000028764

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P35454-F1-model_v2	AlphaFold	P35454	1-125	view protein structure

Promoters

RGD ID:

6878760

Promoter ID:

EPDNEW_M2831

Type:

single initiation site

Name:

Oxt_1

Description:

Mus musculus oxytocin , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	2	130,576,173 - 130,576,233	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:97453	AgrOrtholog
Ensembl Genes	ENSMUSG00000027301	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000028764	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000028764	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.9.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Neurhyp_horm	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Neurhyp_horm_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Neurohypophysial_hormone_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:18429	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:97453	ENTREZGENE
NCBI Gene	18429	ENTREZGENE
PANTHER	PTHR11681	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Hormone_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Hormone_5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Oxt	PhenoGen
PIRSF	Nonapeptide_hormone_precursor	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	NEUROPHYSIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	NEUROHYPOPHYS_HORM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SM00003	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF49606	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	I3PGM0_MOUSE	UniProtKB/TrEMBL
	I3PGM1_MOUSE	UniProtKB/TrEMBL
	NEU1_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q545V4	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations