Send us a Message



Submit Data |  Help |  Video Tutorials |  News |  Publications |  Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
Parent Terms Term With Siblings Child Terms
peptide/protein +     
receptor agonist +     
2,3,7,8-tetrachlorodibenzo-p-dioxin 
2-Chloro-5-hydroxyphenylglycine 
adrenergic receptor agonist +  
antibody +   
bovine serum albumin 
chlorpropamide 
cholinergic agonist +   
cytokine +  
dapagliflozin 
enzyme +   
ipragliflozin +  
JTT-608 
lactotransferrin 
liraglutide 
lixisenatide 
This is any condition in which the main influencing factor is lixisenatide, a 44 amino acid polypeptide and glucagon-like peptide 1 receptor agonist used as an adjunct to diet and exercise for the treatment of adults with type II diabetes.
Medica 16 
metformin +  
methacholine 
MK-0773 
mogroside 
morphine 
myelin oligodendrocyte glycoprotein  
nateglinide 
ovalbumin 
oxandrolone 
oxycodone +  
panadiplon 
peptide hormone +   
peptide/protein antigen +   
pregnenolone 16alpha-carbonitrile 
rosiglitazone 
RU28362 +  
saxagliptin +  
sodium phenobarbital 
sumatriptan 
tolbutamide 
troglitazone 
TRV023 
U46619 
V1-Cal 
vasopressin receptor agonist +  
vildagliptin 
zolpidem 

Synonyms
Exact Synonyms: H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2
Xrefs: CID:90472060 ;   PMID:37423944
Definition Sources: CHEBI:85662, https://en.wikipedia.org/wiki/Lixisenatide

paths to the root