Submit Data |  Help |  Video Tutorials |  News |  Publications |  FTP Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
Parent Terms Term With Siblings Child Terms
(+)-pinoresinol 
(+)-schisandrin B  
(+)-sesamin +   
(-)-epigallocatechin 3-gallate  
(12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 
(25R)-cholest-5-ene-3beta,26-diol +   
(3R,4S,1'R)-3-(1'-hydroxyethyl)-4-methyldihydrofuran-2(3H)-one 
(3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 
(4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 
(E)-cinnamaldehyde +   
(Z)-3-butylidenephthalide  
1-hydroxy-5-phenyl-3-pentanone 
1-isothiocyanato-6-(methylsulfanyl)hexane 
10-PAHSA 
10-PAHSA(1-) 
11-PAHSA 
11-PAHSA(1-) 
12-PAHSA 
12-PAHSA(1-) 
13-PAHSA 
13-PAHSA(1-) 
3-guanidinopropanoic acid  
3-hydroxymethyl-4-methyl-furan-2(5H)-one 
5,5-dimethyl-1-pyrroline N-oxide  
5-methoxyindole-2-carboxylic acid  
5-PAHSA 
5-PAHSA(1-) 
6alpha-methylprednisolone +   
7-chlorokynurenic acid  
7-ketocholesterol  
7-PAHSA 
7-PAHSA(1-) 
8-PAHSA 
8-PAHSA(1-) 
9-PAHSA 
9-PAHSA(1-) 
abarelix 
Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 
Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 
acarbose +   
acetohexamide  
acteoside  
afamelanotide  
ajugaciliatin B 
ajugamarin A1 chlorohydrin 
ajugamarin A2 chlorohydrin 
albiflorin +   
albiglutide 
alliin +   
alliin zwitterion 
alogliptin  
alogliptin benzoate 
alpha-tocotrienol  
ambrein 
amburoside A 
amoxicilloyl polylysine 
amyloid-beta +  
ananolignan F 
ananolignan L 
apelin-12 
apelin-13 
argon(0) 
Arthrofactin 
AS1842856 
Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 
aspalathin  
aspernigrin B 
aspirin-triggered protectin D1 
astragaloside IV  
astressin  
astressin 2B  
auraptene  
bacitracin A +   
bellidifolin +  
benzylpenicilloyl polylysine 
berberine  
beta-endorphin  
biguanides +   
bis(7)-tacrine 
bis-(4-hydroxybenzyl)sulfide 
bivalirudin  
cafestol  
calcitonin  
calcitonin (human synthetic) 
calcitonin (pork natural) 
calpastatin peptide Ac 184-210 
canagliflozin +   
canagliflozin hydrate 
cannabigerol  
capsiate  
carperitide 
CDP-choline  
CGP-42112A  
chlorpropamide  
choline alfoscerate 
CIGB-300 
cilostazol  
CORM 3 
corticorelin 
corticotropin  
corticotropin-releasing hormone +   
corticotropin-releasing hormone (human) 
corticotropin-releasing hormone (ovine) 
cosyntropin  
creatine +   
curcumin +   
cyanidin cation +   
cyanophycin macromolecule +  
cycloheximide  
D-psicose +  
dantrolene  
dapagliflozin +  
dapagliflozin propanediol monohydrate 
DASKALRSSGMP 
defensin +  
degarelix 
Delta(9)-tetrahydrocannabinolic acid  
dermaseptin s3(1-16)-NH2 
desirudin 
dihydrolipoic acid +   
dimethyloxalylglycine 
DKATIGFEVQEE 
DSGEGDFLAEGGGVR 
duvoglustat +   
ebselen  
elcatonin 
elf18 
empagliflozin +  
enfuvirtide  
ENPAVHFFKNIVTPRTP 
ENPVVAFFKNIVTPRTP 
ENPVVHFFFNIVTPRTP 
ENPVVHFFKNIVTPRTP 
ENPVVHFFYNIVTPRTP 
etazolate  
ethoxyquin  
ethylisopropylamiloride  
exendin-3 
exendin-4 
fangchinoline  
felbamate  
flavalin A 
flavalin B 
FPAWFTKLYPRT 
fraxetin +   
fucodiphloroethol G 
fucoidan  
fucoxanthin  
galgravin 
ganirelix  
gastrin +   
gastrin-14 
ghrelin  
ginkgolide B  
ginsenoside Rb1  
ginsenoside Rb2  
ginsenoside Rb3 
ginsenoside Rc  
ginsenoside Rd +   
ginsenoside Re  
ginsenoside Rg1  
gliclazide  
glimepiride  
glipizide  
Glu-Asp-Arg 
glyburide  
glycoursodeoxycholic acid  
glymidine 
glymidine sodium 
Gonadorelin hydrochloride 
gossypin 
hinokiflavone  
huperzine A  
hydroxysafflor yellow A  
ilomastat  
indirubin-3'-monoxime  
insulin +   
insulin (human)  
insulin-sensitizing drug +   
interiotherin C 
IPQVWRDWFKLP 
isonitramine 
JNK inhibitor I 
juglanin A 
kaempferol 3,7-di-O-alpha-L-rhamnoside 
ketone body +   
KGKGKGKGKGENPAVHFFKNIVTPRTP 
KGKGKGKGKGENPVVAFFKNIVTPRTP 
KGKGKGKGKGENPVVHFFFNIVTPRTP 
KGKGKGKGKGENPVVHFFKNIVTPRTP 
KGKGKGKGKGENPVVHFFYNIVTPRTP 
kisspeptin-54 
koshikamide A2 
kynurenic acid +   
lantibiotic +  
lepirudin  
linagliptin  
liraglutide  
lixisenatide 
A forty-four membered polypeptide consisting of L-His, Gly, L-Glu, Gly, L-Thr, L-Phe, L-Thr, L-Ser, L-Asp, L-Leu, L-Ser, L-Lys, L-Gln, L-Met, L-Glu, L-Glu, L-Glu, L-Ala, L-Val, L-Arg, L-Leu, L-Phe, L-Ile, L-Glu, L-Trp, L-Leu, L-Lys, L-Asn, Gly, Gly, LPro, L-Ser, L-Ser, Gly, L-Ala, L-Pro, L-Pro, L-Ser, L-Lys, L-Lys, L-Lys, L-Lys, L-Lys, and L-Lys-NH2 residues joined in sequence. Used as an adjunct to diet and exercise for the treatment of adults with type II diabetes.
loganin +   
LSM-37009 
LSM-37015 
LSM-37045 
LSM-37094 
LSM-37129 
LSM-37138 
LSM-37175 
LSM-37192 
LSM-37213 
mangiferin  
marsupsin 
masoprocol  
mastoparan  
mastoparan-A 
mastoparan-AF 
mastoparan-B 
mastoparan-D 
mastoparan-M 
mastoparan-V 
mastoparans +   
maysin 
MEDICA 16 
meldonium  
melittin  
memantine  
memantine hydrochloride 
metformin  
metformin hydrochloride +  
methanol extract of Sorbus alnifolia 
methyl 3,4-dihydroxybenzoate 
methylene blue  
methylparaben  
Mirabamide C 
Mirabamide G 
Mirabamide H 
morin  
myricetin +   
N(5)-ethyl-L-glutamine 
N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 
N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 
N-arachidonoyl-L-serine 
N-benzoyl-D-phenylalanine +  
N-benzylhexadecanamide 
N-palmitoyl-S-[2,3-bis(palmitoyloxy)propyl]-Cys-Ser-Lys-Lys-Lys-Lys  
N-tert-butyl(3,5,6-trimethylpyrazin-2-yl)methanimine N-oxide 
Nafarelin 
Nafarelin acetate hydrate 
naringenin 7-O-beta-D-glucoside 
nateglinide  
neriifolin +  
nerolidol glycoside 
nesiritide 
Neurokinin A  
Neurokinin B 
nicotinamide +   
nociceptin  
notoginsenoside R1  
octyl gallate  
oleocanthal 
oleuropein aglycone 
omega-conotoxin GVIA  
P-factor 
p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 
paliperidone 
paliperidone palmitate  
palmitoyl ethanolamide  
penicilloyl polylysine 
peptide YY 
phenethyl caffeate  
piceatannol +  
pinitol +   
pinocembrin +   
poly(glycyl-L-arginine) 
PR-39  
pramlintide 
protectin D1 +  
protein polypeptide chain +   
pyrrolidine dithiocarbamate  
QINTAKWWKTHF 
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 
rasagiline  
rifampicin +   
rivastigmine  
rivastigmine tartrate 
rubimaillin  
S-methyl-L-thiocitrulline  
salsalate  
salvianolic acid B  
saroglitazar 
saxagliptin +   
saxagliptin hydrate 
SB 203580  
SB 415286  
secretin human 
senegasaponin a +  
senegasaponin b +  
senegin II 
senegin III 
Sermorelin 
sitagliptin +  
SL-327  
sodium phenylbutyrate 
STAT3 inhibitor peptide 
stevioside +   
Streptomyces coelicolor calcium-dependent antibiotic CDA4b 
sunitinib +   
swerchirin 
swertisin 
Synjardy 
synthalin 
synthalin A 
syringaldehyde +  
tauroursodeoxycholic acid  
TDZD-8 
teduglutide 
tenocyclidine 
teprenone  
terbutaline +   
teriparatide 
terlipressin 
tesamorelin 
tetragastrin 
tetramethylpyrazine  
thymalfasin 
tideglusib 
tolazamide 
tolbutamide  
troglitazone  
tropisetron  
tropisetron hydrochloride 
uridine triacetate 
Vaby A 
Vaby B 
Vaby C 
Vaby D 
Vaby E 
valproic acid +   
vanadyl sulfate trihydrate 
Varv E 
VSWKTWFPNLAV 
WHWLQLKPGQPMY 
WIN 55212-2  
YIIKGLFWDPAC +  
YIIKGVFWDPAC +  
YSPFHKWFPSMH 
Z-DEVD-FMK 

Synonyms
Exact Synonyms: L-histidylglycyl-L-alpha-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-alpha-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparaginylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-prolyl-L-seryl-L-lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysinamide
Related Synonyms: AQVE-10010 ;   AVE 0010 ;   AVE0010 ;   Adlyxin ;   DesPro38Exendin-4(1-39)-Lys6-NH2 ;   Formula=C215H347N61O65S ;   H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 ;   H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2 ;   H-L-His-Gly-L-Glu-Gly-L-Thr-L-Phe-L-Thr-L-Ser-L-Asp-L-Leu-L-Ser-L-Lys-L-Gln-L-Met-L-Glu-L-Glu-L-Glu-L-Ala-L-Val-L-Arg-L-Leu-L-Phe-L-Ile-L-Glu-L-Trp-L-Leu-L-Lys-L-Asn-Gly-Gly-L-Pro-L-Ser-L-Ser-Gly-L-Ala-L-Pro-L-Pro-L-Ser-L-Lys-L-Lys-L-Lys-L-Lys-L-Lys-L-Lys-NH2 ;   InChI=1S/C215H347N61O65S/c1-16-115(10)173(210(337)256-141(68-74-170(299)300)194(321)261-148(94-122-98-232-126-50-24-23-49-124(122)126)199(326)258-143(89-111(2)3)196(323)247-134(58-32-40-83-223)189(316)262-149(96-160(226)285)180(307)235-100-161(286)233-104-165(290)274-85-42-60-156(274)207(334)267-154(108-280)206(333)265-151(105-277)181(308)237-101-162(287)239-117(12)213(340)276-87-44-62-158(276)214(341)275-86-43-61-157(275)208(335)268-153(107-279)204(331)249-132(56-30-38-81-221)187(314)246-131(55-29-37-80-220)186(313)245-130(54-28-36-79-219)185(312)244-129(53-27-35-78-218)184(311)243-128(52-26-34-77-217)183(310)242-127(176(227)303)51-25-33-76-216)272-201(328)146(92-120-45-19-17-20-46-120)260-197(324)144(90-112(4)5)257-190(317)135(59-41-84-231-215(228)229)255-209(336)172(114(8)9)271-177(304)116(11)240-182(309)138(65-71-167(293)294)251-192(319)139(66-72-168(295)296)252-193(320)140(67-73-169(297)298)253-195(322)142(75-88-342-15)254-191(318)137(63-69-159(225)284)250-188(315)133(57-31-39-82-222)248-203(330)152(106-278)266-198(325)145(91-113(6)7)259-200(327)150(97-171(301)302)263-205(332)155(109-281)269-212(339)175(119(14)283)273-202(329)147(93-121-47-21-18-22-48-121)264-211(338)174(118(13)282)270-164(289)103-236-179(306)136(64-70-166(291)292)241-163(288)102-234-178(305)125(224)95-123-99-230-110-238-123/h17-24,45-50,98-99,110-119,125,127-158,172-175,232,277-283H,16,25-44,51-97,100-109,216-224H2,1-15H3,(H2,225,284)(H2,226,285)(H2,227,303)(H,230,238)(H,233,286)(H,234,305)(H,235,307)(H,236,306)(H,237,308)(H,239,287)(H,240,309)(H,241,288)(H,242,310)(H,243,311)(H,244,312)(H,245,313)(H,246,314)(H,247,323)(H,248,330)(H,249,331)(H,250,315)(H,251,319)(H,252,320)(H,253,322)(H,254,318)(H,255,336)(H,256,337)(H,257,317)(H,258,326)(H,259,327)(H,260,324)(H,261,321)(H,262,316)(H,263,332)(H,264,338)(H,265,333)(H,266,325)(H,267,334)(H,268,335)(H,269,339)(H,270,289)(H,271,304)(H,272,328)(H,273,329)(H,291,292)(H,293,294)(H,295,296)(H,297,298)(H,299,300)(H,301,302)(H4,228,229,231)/t115-,116-,117-,118+,119+,125-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,172-,173-,174-,175-/m0/s1 ;   InChIKey=XVVOERDUTLJJHN-IAEQDCLQSA-N ;   Lyxumia ;   SMILES=CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)Cc1c[nH]cn1)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O ;   ZP 10 ;   ZP10A peptide ;   des-38-proline-exendine-4 (Heloderma suspectum)-(1-39)-peptidylpenta-L-lysyl-L-lysinamide ;   lixisenatida ;   lixisenatidum
Xrefs: CAS:320367-13-3 ;   Drug_Central:4815 ;   KEGG:D09729 ;   PMID:19629885 ;   PMID:21391833 ;   PMID:23537041 ;   PMID:23558600 ;   PMID:23825925 ;   PMID:23992745 ;   PMID:24086950 ;   PMID:24122776 ;   PMID:24363554 ;   PMID:24373190 ;   PMID:24476092 ;   PMID:24583037 ;   PMID:24641271 ;   PMID:24683832 ;   PMID:24876548 ;   PMID:25012990 ;   PMID:25027491 ;   PMID:25055456 ;   PMID:25066229 ;   PMID:25107586 ;   PMID:25115916 ;   PMID:25119443 ;   PMID:25130920 ;   PMID:25195184 ;   PMID:25773712 ;   PMID:25802728 ;   PMID:25853868 ;   PMID:25887358 ;   PMID:25965710 ;   PMID:26342556 ;   PMID:26423184 ;   PMID:26537183 ;   PMID:26594250 ;   PMID:26630143 ;   PMID:26701217 ;   PMID:26770666 ;   PMID:26787264 ;   PMID:26981945 ;   PMID:26981946 ;   PMID:26981947 ;   PMID:27092017 ;   PMID:27222510 ;   PMID:27252787 ;   PMID:27267268 ;   PMID:27284114 ;   PMID:27310712 ;   PMID:27311491 ;   PMID:27319011 ;   PMID:27341040 ;   Reaxys:23952540 ;   Wikipedia:Lixisenatide

paths to the root

NHLBI Logo

RGD is funded by grant HL64541 from the National Heart, Lung, and Blood Institute on behalf of the NIH.