Send us a Message



Submit Data |  Help |  Video Tutorials |  News |  Publications |  Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
Parent Terms Term With Siblings Child Terms
polypeptide +     
venom +   
(+)-jasplakinolide V 
(+)-jasplakinolide W 
(+)-jasplakinolide Z1 
(+)-jasplakinolide Z2 
(+)-jasplakinolide Z3 
(+)-jasplakinolide Z5 
(-)-dibromophakellin 
(-)-duryne 
(-)-duryne B 
(-)-duryne C 
(-)-duryne D 
(-)-duryne E 
(-)-duryne F 
(-)-jasplakinolide Z4 
(12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 
(2E)-oct-2-enoic acid 
(2E,6E)-farnesoic acid 
(3R,6E)-nerolidol 
(3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 
(4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 
(4R)-ipsdienol 
(6R,7S,9S)-2-imino-7,9-dimethyl-1,3-diazaspiro[5.5]undecan-4-one 
(E)-10-hydroxydec-2-enoic acid +   
(R)-1-phenylethanol 
(R)-cembrene A 
1-heptadecene 
10,13-dimethyltetradecanoic acid 
12-epi-19-O-methyldeoxoscalarin 
12-epi-19-O-methylscalarin 
12-epi-deoxoscalarin +  
12-epi-scalarin +  
12-O-deacetyl-12-epi-19-deoxy-21-hydroxyscalarin 
12-O-deacetyl-19-O-methyl-12-epi-deoxoscalarin 
16-methyloctadecanoic acid 
17(S)-HDoHE 
2,4-dimethyl-1-heptene 
2-amino-6-(1-hydroxypropyl)-8-methylpteridine-4,7(3H,8H)-dione 
2-dodecylbenzenesulfonic acid 
2-hydroxyhexanoate 
2-hydroxyhexanoic acid +  
2-hydroxytricosanoic acid 
20-hydroxyecdysone  
23-acetoxy-12-epi-deoxoscalarin +  
23-acetoxy-12-O-deacetyl-12-epi-deoxoscalarin 
3-hydroxy-3-methylbut-1-ene 
3-methylvaleric acid 
3-methylxanthine +  
4-hydroxymellein 
5-epi-alpha-selinene 
6-O-alpha-D-glucopyranosyl-D-fructofuranose +  
abarelix 
Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 
Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 
acetophenone +   
adonixanthin 
afamelanotide  
african-1-ene 
albiglutide 
alpha-methylhistamine  
amoxicilloyl polylysine 
amyloid-beta +  
anserine 
anserine zwitterion 
Arthrofactin 
astaxanthin  
astressin  
astressin 2B  
bacitracin A +   
benzylpenicilloyl polylysine 
beta-endorphin  
bivalirudin  
brassicasterol +  
bufalin  
butyl hexadecanoate 
calcitonin  
calcitonin (human synthetic) 
calcitonin (pork natural) 
calpastatin peptide Ac 184-210 
carminic acid 
carperitide 
cathelicidin +   
CIGB-300 
cis-11,14-eicosadienoic acid methyl ester 
civetone 
coniferol +  
coral metabolite +  
corticorelin 
corticotropin  
corticotropin-releasing hormone +   
cosyntropin  
crinosterol 
crustacean metabolite +   
cyanophycin macromolecule +  
cysteic acid +  
D-glucono-1,5-lactone +  
D-octopine 
DASKALRSSGMP 
defensin +  
degarelix 
dehydroluciferin 
Delta(7)-dafachronic acid +  
dermaseptin s3(1-16)-NH2 
desirudin 
dinophysistoxin 1  
divarinol 
DKATIGFEVQEE 
dolastatin 10 
dolichodial 
DSGEGDFLAEGGGVR 
echinenone +  
elcatonin 
elf18 
enfuvirtide  
ENPAVHFFKNIVTPRTP 
ENPVVAFFKNIVTPRTP 
ENPVVHFFFNIVTPRTP 
ENPVVHFFKNIVTPRTP 
ENPVVHFFYNIVTPRTP 
ent-Photinus luciferin +  
exendin-3 
exendin-4 
firefly sulfoluciferin 
fluoren-9-ol 
FPAWFTKLYPRT 
ganirelix  
gastrin +   
ghrelin  
Gonadorelin hydrochloride 
hexyl butyrate 
insulin +   
IPQVWRDWFKLP 
ipsdienone 
isofucosterol 
jaspamide  
jaspamide B 
jaspamide C 
jaspamide D 
jaspamide E 
jaspamide F 
jaspamide G 
jaspamide H 
jaspamide J 
jaspamide M 
jasplakinolide D 
jasplakinolide Q 
jasplakinolide R1 
JNK inhibitor I 
juvenile hormone +   
juvenile hormone III bisepoxide 
juvenile hormone III skipped bisepoxide 
kermesic acid 
KGKGKGKGKGENPAVHFFKNIVTPRTP 
KGKGKGKGKGENPVVAFFKNIVTPRTP 
KGKGKGKGKGENPVVHFFFNIVTPRTP 
KGKGKGKGKGENPVVHFFKNIVTPRTP 
KGKGKGKGKGENPVVHFFYNIVTPRTP 
kisspeptin-54 
koshikamide A2 
L-methionine sulfone +  
L-tryptophanate +  
L-tryptophanium +  
L-tryptophanyl radical +  
LAC dye 
laccaic acid A +  
laccaic acid B +  
laccaic acid C +  
laccaic acid D +  
lantibiotic +  
Latia luciferin +  
lehualide E 
lehualide G 
lehualide H 
lehualide I 
lehualide J 
lehualide K 
lepirudin  
liraglutide  
lissoclibadin 1 
lissoclibadin 2 
lissoclibadin 3 
lixisenatide 
lombricine +  
LSM-37009 
LSM-37015 
LSM-37045 
LSM-37094 
LSM-37129 
LSM-37138 
LSM-37175 
LSM-37192 
LSM-37213 
mammalian metabolite +   
manzamine A +  
massadine 
mastoparans +   
A group of cytoactive tetradecapeptide found in wasp venoms. They cause the degranulation of mast cells.
melezitose 
melittin  
methyl N-methylanthranilate 
Mirabamide C 
Mirabamide G 
Mirabamide H 
N(omega)-phospho-L-arginine 
N-(carboxymethyl)-L-alanine 
N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 
N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 
N-acetyl-L-histidine 
N-acetyloctopamine 
N-acetyltyramine 
N-icosanoylsphingosine-1-phosphocholine 
nematode metabolite +   
nerol oxide 
nesiritide 
Neurokinin A  
Neurokinin B 
nociceptin  
omega-conotoxin GVIA  
P-factor 
p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 
penicilloyl polylysine 
pentacos-1-ene 
pentadecane +  
pentadecanoate 
pentan-3-one +  
peptide YY 
phenylacetonitrile +  
poly(glycyl-L-arginine) 
pramlintide 
protein polypeptide chain +   
QINTAKWWKTHF 
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 
Rac1 Inhibitor W56 
resolvin D5 
royal jelly  
S-methyl-L-ergothioneine 
secretin human 
semaglutide 
sermorelin 
smenospongines C 
STAT3 inhibitor peptide 
Streptomyces coelicolor calcium-dependent antibiotic CDA4b 
strongylophorine-26 
teduglutide 
teriparatide 
terlipressin 
tesamorelin 
tetrahydropentoxyline 
tetrodotoxin  
thymalfasin 
triacontane +  
triacylglycerol 60:0 
trikendiol 
trimethylsulfonium 
tschimganine 
tunaxanthin +  
Vaby A 
Vaby B 
Vaby C 
Vaby D 
Vaby E 
validoxylamine A 
Varv E 
vasotocin  
verongamine 
VSWKTWFPNLAV 
WHWLQLKPGQPMY 
xanthopterin-B2 
xanthurenate 
xanthurenic acid +   
YIIKGLFWDPAC +  
YIIKGVFWDPAC +  
YSPFHKWFPSMH 

Synonyms
Xrefs: PMID:21884742

paths to the root