Submit Data |  Help |  Video Tutorials |  News |  Publications |  FTP Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
corticotropin-releasing hormone (CHEBI:65311)
Annotations: Rat: (1) Mouse: (1) Human: (1) Chinchilla: (0) Bonobo: (0) Dog: (0) Squirrel: (0) Pig: (0)
Parent Terms Term With Siblings Child Terms
biomacromolecule +     
peptide hormone +     
polypeptide +     
(12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 
(3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 
(4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 
(R)-noradrenaline  
5-hydroxytryptophan +  
[3)-beta-D-ribosyl-(1->1)-D-ribitol-5-P-(O->]n 
[4)-beta-D-ManpNAc-(1->4)-alpha-D-Glcp-(1->2)-alpha-L-Rhap-1-P-(O->]n 
[4)-beta-D-ManpNAc-(1->4)-alpha-D-Glcp-(1->3)-alpha-L-Rhap-1-P-(O->]n 
[Hyp(3)]-bradykinin 
abarelix 
Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 
Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 
acetylcholine +   
afamelanotide  
albiglutide 
amoxicilloyl polylysine 
amyloid-beta +  
anandamide +   
angiotensin +   
Arthrofactin 
astressin  
astressin 2B  
bacitracin A +   
benzylpenicilloyl polylysine 
beta-alanine +   
beta-endorphin  
bivalirudin  
calcitonin  
calcitonin (human synthetic) 
calcitonin (pork natural) 
calpastatin peptide Ac 184-210 
carbon monoxide  
carperitide 
choline +   
CIGB-300 
corticorelin 
corticotropin  
corticotropin-releasing hormone +   
A family of peptide hormones derived from a 191-membered prehormone, secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. The first full sequence was discovered in sheep, those in rats and humans differ from the ovine sequence by 7 amino acids.
cosyntropin  
cutins 
cyanophycin macromolecule +  
DASKALRSSGMP 
defensin +  
degarelix 
dermaseptin s3(1-16)-NH2 
desirudin 
DKATIGFEVQEE 
DSGEGDFLAEGGGVR 
elcatonin 
elf18 
enfuvirtide  
ENPAVHFFKNIVTPRTP 
ENPVVAFFKNIVTPRTP 
ENPVVHFFFNIVTPRTP 
ENPVVHFFKNIVTPRTP 
ENPVVHFFYNIVTPRTP 
exendin-3 
exendin-4 
exopolysaccharide +   
FPAWFTKLYPRT 
gamma-aminobutyric acid +   
gamma-poly(D-glutamic acid) macromolecule +  
ganirelix  
gastrin +   
ghrelin 
glucagon  
glycine +   
gonadorelin  
Gonadorelin hydrochloride 
histamine +   
information biomacromolecule +   
insulin (human) 
IPQVWRDWFKLP 
JNK inhibitor I 
KGKGKGKGKGENPAVHFFKNIVTPRTP 
KGKGKGKGKGENPVVAFFKNIVTPRTP 
KGKGKGKGKGENPVVHFFFNIVTPRTP 
KGKGKGKGKGENPVVHFFKNIVTPRTP 
KGKGKGKGKGENPVVHFFYNIVTPRTP 
kisspeptin-54 
koshikamide A2 
L-aspartic acid +   
L-glutamic acid +   
lantibiotic +  
lepirudin  
liraglutide  
lixisenatide 
LSM-37009 
LSM-37015 
LSM-37045 
LSM-37094 
LSM-37129 
LSM-37138 
LSM-37175 
LSM-37192 
LSM-37213 
m-tyramine  
mastoparans +   
melittin  
Mirabamide C 
Mirabamide G 
Mirabamide H 
N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 
N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 
Nafarelin 
Nafarelin acetate hydrate 
nesiritide 
Neurokinin A  
Neurokinin B 
neurotensin  
nitric oxide  
nociceptin  
octopamine +   
omega-conotoxin GVIA  
oxytocin  
P-factor 
p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 
pasireotide  
penicilloyl polylysine 
peptide YY 
pneumococcal C-polysaccharide 
pneumococcal strain CSR SCS2 polysaccharide 
poly(glycyl-L-arginine) 
poly-ADP-D-ribose 
polysaccharide +   
polysaccharide derivative +   
PR-39  
pramlintide 
protein polypeptide chain +   
protirelin 
pterostilbene  
QINTAKWWKTHF 
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 
secretin human 
Sermorelin 
serotonin +   
somatostatin +   
somatostatin-28 
STAT3 inhibitor peptide 
Streptomyces coelicolor calcium-dependent antibiotic CDA4b 
teduglutide 
teriparatide 
terlipressin 
tesamorelin 
thymalfasin 
tyramine +   
tyraminium 
Vaby A 
Vaby B 
Vaby C 
Vaby D 
Vaby E 
Varv E 
vasopressin +   
vasotocin  
VSWKTWFPNLAV 
WHWLQLKPGQPMY 
YIIKGLFWDPAC +  
YIIKGVFWDPAC +  
YSPFHKWFPSMH 

Synonyms
Related Synonyms: CRH ;   corticotropin-releasing factor
Xref Mesh: MESH:D003346
Xrefs: PMID:22494987 "Europe PMC" ;   PMID:6267699 "Europe PMC" ;   Wikipedia:Corticotropin-releasing_hormone

paths to the root

NHLBI Logo

RGD is funded by grant HL64541 from the National Heart, Lung, and Blood Institute on behalf of the NIH.