Submit Data |  Help |  Video Tutorials |  News |  Publications |  FTP Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE (CHEBI:60235)
Annotations: Rat: (0) Mouse: (0) Human: (0) Chinchilla: (0) Bonobo: (0) Dog: (0) Squirrel: (0) Pig: (0)
Parent Terms Term With Siblings Child Terms
lipopeptide +     
mimotope +  
monochlorobenzenes +     
polypeptide +     
(12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 
(1E)-1-(4-chlorophenyl)-4,4-dimethyl-2-(1H-1,2,4-triazol-1-yl)pent-1-en-3-ol +  
(1S,2R)-3-(4-chlorophenyl)cyclohexa-3,5-diene-1,2-diol 
(1S,3R)-2,2-dichloro-N-[(1R)-1-(4-chlorophenyl)ethyl]-1-ethyl-3-methylcyclopropanecarboxamide 
(2-chlorophenyl)(4-chlorophenyl)pyrimidin-5-ylmethanol +   
(2-chlorophenyl)(4-fluorophenyl)pyrimidin-5-ylmethanol +  
(2E,4Z)-6-(4-chlorophenyl)-2-hydroxy-6-oxohexa-2,4-dienoic acid 
(2R,3R,4R,5S)-6-\{[3-(4-chlorophenyl)-4-hydroxybutanoyl]oxy\}-3,4,5-trihydroxyoxane-2-carboxylic acid 
(2R,4R)-N(1)-(4-chlorophenyl)-N(2)-[3-fluoro-2'-(methylsulfonyl)biphenyl-4-yl]-4-methoxypyrrolidine-1,2-dicarboxamide 
(3-chloro-4-hydroxyphenyl)acetic acid 
(3S)-N-(3-chloro-2-methylphenyl)-1-cyclohexyl-5-oxopyrrolidine-3-carboxamide 
(3S)-N-(5-chloro-2-methylphenyl)-1-cyclohexyl-5-oxopyrrolidine-3-carboxamide 
(3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 
(4-chloro-2-methylphenoxy)acetic acid  
(4-chlorophenoxy)acetic acid 
(4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 
(5E)-5-(4-chlorobenzylidene)-2,2-dimethyl-1-(1,2,4-triazol-1-ylmethyl)cyclopentanol +  
(5Z)-3-(4-chlorophenyl)-4-hydroxy-5-(naphthalen-1-ylmethylidene)furan-2(5H)-one 
(E)-dimethomorph +   
(Z)-dimethomorph +   
1,1-dichloro-2-(4-chloro-2,3-dihydroxyphenyl)-2-(4-chlorophenyl)ethylene 
1-(3-chlorophenyl)piperazine  
1-(3-tert-butyl-1-methylpyrazol-5-yl)-3-(4-chlorophenyl)urea 
1-(4-chlorobenzenesulfonyl)-3-(2-oxopropyl)urea 
1-(4-chlorophenoxy)-1-(1H-imidazol-1-yl)-3,3-dimethylbutan-2-one +   
1-(4-chlorophenoxy)-3,3-dimethyl-1-(1,2,4-triazol-1-yl)butan-2-one +   
1-(4-chlorophenyl)-1H-pyrazol-4-ol 
1-(4-chlorophenyl)-3-[3-(3-chlorophenyl)-1,5,5-trimethyl-2-oxoimidazolidin-4-yl]urea 
1-(4-chlorophenyl)-3-[3-(5-methyl-1,3-benzoxazol-2-yl)phenyl]thiourea 
1-(4-chlorophenyl)-3-[4-methyl-2-(thiophen-2-yl)-1,3-thiazol-5-yl]urea 
1-(4-chlorophenyl)-4,4-dimethyl-2-(1H-1,2,4-triazol-1-yl)pentan-3-ol +   
1-(4-chlorophenyl)-4,4-dimethyl-3-(1H-1,2,4-triazol-1-ylmethyl)pentan-3-ol +   
1-(butan-2-ylidene)-2-[4-(4-chlorophenyl)thiazol-2-yl]hydrazine 
1-[4-(2-chlorophenoxy)butyl]imidazole 
1-[4-(4-chlorophenyl)thiazol-2-yl]-2-(pentan-3-ylidene)hydrazine 
1-[4-(4-chlorophenyl)thiazol-2-yl]-2-(propan-2-ylidene)hydrazine 
1-\{2-(4-chlorobenzyloxy)-2-(2,4-dichlorophenyl)ethyl\}imidazole +   
1-\{2-[(4-chlorobenzyl)sulfanyl]-2-(2,4-dichlorophenyl)ethyl\}-1H-imidazole +   
1-\{2-[(4-chlorophenyl)amino]-2-oxoethyl\}-N-(1-isopropylpiperidin-4-yl)-1H-indole-2-carboxamide 
1-\{[(E)-2-(4-chlorophenyl)ethenyl]sulfonyl\}-4-[(1-pyridin-4-ylpiperidin-4-yl)methyl]piperazine 
1-\{[3-(2-chlorophenyl)-2-(4-fluorophenyl)oxiran-2-yl]methyl\}-1H-1,2,4-triazole +   
1-chloro-2,2-bis(4'-chlorophenyl)ethylene 
1-chloro-2,2-bis(4-chlorophenyl)ethane 
1-chloro-2,4,6-trinitrobenzene  
1-chloro-2,4-dinitrobenzene  
1-chloro-2-nitrobenzene 
1-chloro-3-nitrobenzene 
2'-Chloro-4-biphenylol 
2'-chlorobiphenyl-2,3-diol 
2'-hydroxytriclocarban 
2'-sulfooxytriclocarban 
2,2',4,5-tetrachlorobiphenyl  
2,2',5-Trichloro-4-hydroxybiphenyl 
2,2-bis(4-chlorophenyl)ethanol 
2,3',5-trichlorobiphenyl  
2,3,3',4,5-pentachlorobiphenyl 
2,3,4,4',5-Pentachlorobiphenyl 
2,3,4,4'-tetrachlorobiphenyl  
2,3-dihydroxy-DDT +  
2,4'-dichlorobiphenyl  
2,4,4',6-tetrachlorobiphenyl  
2-(2-chlorophenyl)-5-(5-methyl-2-thienyl)-1,3,4-oxadiazole 
2-(3-\{(2-chloro-4-fluorophenyl)[1-(2-chlorophenyl)-6-oxo-1,6-dihydropyridazin-3-yl]amino\}propyl)-1H-isoindole-1,3(2H)-dione 
2-(4-chloro-2-methylphenoxy)propanoic acid +   
2-(4-chlorophenyl)-2-(1H-1,2,4-triazol-1-ylmethyl)hexanenitrile +  
2-(4-chlorophenyl)-3,3-dichloropropenoic acid 
2-(4-chlorophenyl)-3-cyclopropyl-1-(1H-1,2,4-triazol-1-yl)butan-2-ol +   
2-(4-chlorophenyl)-3-methylbutyric acid +   
2-(4-chlorophenyl)-N-\{2-[3-methoxy-4-(prop-2-yn-1-yloxy)phenyl]ethyl\}-2-(prop-2-yn-1-yloxy)acetamide +  
2-(5'-chloro-2'-phosphoryloxyphenyl)-6-chloro-4-(3H)-quinazolinone 
2-[1-(p-chlorophenyl)ethyl]-4,6-dinitrophenol 
2-[2-(1-chlorocyclopropyl)-3-(2-chlorophenyl)-2-hydroxypropyl]-1,2-dihydro-1,2,4-triazole-3-thione +   
2-[4-(4-chlorophenoxy)-2-(trifluoromethyl)phenyl]-1-(1H-1,2,4-triazol-1-yl)propan-2-ol +  
2-[5-(but-3-yn-2-yloxy)-4-chloro-2-fluorophenyl]-4,5,6,7-tetrahydro-1H-isoindole-1,3(2H)-dione +  
2-\{(2E)-1-benzyl-3-[2-chloro-5-(2,4-diamino-6-ethylpyrimidin-5-yl)phenyl]triaz-2-en-1-yl\}ethyl acetate 
2-\{2-chloro-4-(methylsulfonyl)-3-[(tetrahydrofuran-2-ylmethoxy)methyl]benzoyl\}cyclohexane-1,3-dione +  
2-\{[2-(2-chlorophenyl)-2-hydroxyethyl]amino\}-N-[(2-fluorophenyl)methyl]acetamide 
2-amino-5-chlorophenol 
2-chloro-1,1'-biphenyl-4,4'-diol 
2-chloro-1,4-phenylenediamine 
2-chloro-3-\{2-chloro-5-[4-(difluoromethyl)-3-methyl-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-yl]-4-fluorophenyl\}propanoic acid +  
2-chloro-4-nitrotoluene 
2-chloro-5-(5-\{(E)-[(2Z)-3-(2-methoxyethyl)-4-oxo-2-(phenylimino)-1,3-thiazolidin-5-ylidene]methyl\}furan-2-yl)benzoic acid 
2-chloro-6-nitrotoluene 
2-chloro-N-(2-nitrophenyl)-5-(1-piperidinylsulfonyl)benzamide 
2-chlorobenzoyl chloride 
2-demethylindomethacin 
2-Hydroxy-2',3',4',5,5'-pentachlorobiphenyl  
2-methyl-4-chlorophenoxybutyric acid 
3,3'-Dichlorobenzidine  
3,4,4',5-Tetrachlorobiphenyl 
3-(2-chlorobenzyl)-1-(2-\{[(1S)-2-hydroxy-1,2-dimethylpropyl]amino\}pyrimidin-4-yl)-1-(4-methoxyphenyl)urea 
3-(2-chlorophenyl)-1-(2-\{[(1S)-2-hydroxy-1,2-dimethylpropyl]amino\}pyrimidin-4-yl)-1-(4-methoxyphenyl)urea 
3-(4-chlorobenzyl)-5-(2-methoxyphenyl)-1,2,4-oxadiazole 
3-(4-chlorophenyl)-2H-1-benzopyran-2-one 
3-[(4-chlorophenylsulfonyloxy)methyl]-5,5-dimethylbutyrolactone 
3-[(5E)-5-\{[5-(4-chlorophenyl)furan-2-yl]methylidene\}-4-oxo-2-thioxo-1,3-thiazolidin-3-yl]propanoic acid 
3-[(\{4-[4-(\{[1-(2-chlorophenyl)ethoxy]carbonyl\}amino)-3-methyl-1,2-oxazol-5-yl]phenyl\}methyl)sulfanyl]propanoic acid +  
3-[2-chloro-4-(methylsulfonyl)benzoyl]-4-(phenylthio)bicyclo[3.2.1]oct-3-en-2-one +  
3-[2-chloro-4-(methylsulfonyl)benzoyl]-4-hydroxybicyclo[3.2.1]oct-3-en-2-one +  
3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid  
3-[4-(3-chlorophenyl)piperazin-1-yl]-1,1-diphenylpropan-2-ol 
3-[4-(4-chlorophenyl)cyclohexyl]naphthalene-1,2,4-trione 
3-[5-(4-chlorophenyl)-2,3-dimethyl-1,2-oxazolidin-3-yl]pyridine +  
3-\{[1-(4-chlorophenylsulfonyl)oxy]ethyl\}-5,5-dimethyldihydro-2(3H)-furanone 
3-chloro-4-[(2-fluorobenzyl)oxy]benzaldehyde oxime 
3-chloro-4-methylcatechol 
3-chloro-L-phenylalanine 
3-chloro-L-tyrosine 
3-chloro-p-toluidine 
3-chlorocatechol 
3-chloroperbenzoic acid  
4'-chlorobiphenyl-2,3-diol +  
4,3',5'-Trichloro-4'-biphenol 
4,4'-dichlorobenzilic acid +   
4,4'-Dichlorobenzophenone  
4,4'-dichlorobiphenyl  
4,4'-dichlorocarbanilide 
4,4'-dichlorodiphenylmethane +   
4-(4-chlorophenyl)-1-\{3-[2-(4-fluorophenyl)-1,3-dithiolan-2-yl]propyl\}piperidin-4-ol 
4-(4-chlorophenyl)-2-phenyl-2-(1,2,4-triazol-1-ylmethyl)butanenitrile +   
4-(4-chlorophenyl)-4-[4-(1H-pyrazol-4-yl)phenyl]piperidine 
4-[3-(4-chlorophenyl)-1H-pyrazol-5-yl]piperidine 
4-\{[(E)-2-(4-chlorophenyl)ethenyl]sulfonyl\}-1-[(1-pyridin-4-ylpiperidin-4-yl)methyl]piperazin-2-one 
4-amino-1-tert-butyl-3-(4-chlorophenyl)-1H-pyrazolo[3,4-d]pyrimidin-2-ium 
4-amino-2-[(3-chlorophenyl)amino]-5-[(4-fluorophenyl)carbonyl]-1,3-thiazol-3-ium 
4-amino-2-chlorobenzoic acid +  
4-bromo-2-chlorophenol +   
4-chloro-2-methylphenol  
4-chloro-3,5-dimethylphenol  
4-chloro-3-methylcatechol 
4-Chloro-4'-biphenylol 
4-chloro-6-\{5-[(2-morpholin-4-ylethyl)amino]-1,2-benzisoxazol-3-yl\}benzene-1,3-diol 
4-chloro-L-phenylalanine 
4-Chloro-meta-phenylenediamine 
4-Chloro-ortho-phenylenediamine  
4-Chloro-ortho-toluidine 
4-chloroacetanilide 
4-chloroacetophenone 
4-chloroaniline  
4-chlorobenzaldehyde 
4-chlorobenzoyl chloride 
4-chlorobenzoyl-CoA 
4-chlorocatechol  
4-chlorochalcone 
4-chlorocinnamic acid +  
4-chlorophenylacetic acid 
4-chlorophenylacetonitrile 
4-chlorophenylhydrazine 
4-Chlorotoluene 
4-hydroxy-2,2',3',4',6'-pentachlorobiphenyl 
4-Hydroxy-2,2',4',6'-tetrachlorobiphenyl 
5-(2-chlorophenyl)-7-(dihydroxyamino)-1,3-dihydro-1,4-benzodiazepin-2-one 
5-(4-chlorophenyl)-6-ethylpyrimidine-2,4-diamine  
5-(5-chloro-2,4-dihydroxyphenyl)-N-ethyl-4-(4-methoxyphenyl)pyrazole-3-carboxamide 
5-\{5-[2-chloro-4-(4,5-dihydro-1,3-oxazol-2-yl)phenoxy]pentyl\}-3-methylisoxazole 
5-\{[(4-amino-3-chloro-5-fluorophenyl)sulfonyl]amino\}-1,3,4-thiadiazole-2-sulfonamide 
5-acetylamido-2-chloroaniline 
5-amino-2-chlorobenzotrifluoride 
5-chloro-1,2,4-trihydroxybenzene 
5-chloro-3-methylcatechol 
5-chloro-N-(2-\{4-[(cyclohexylcarbamoyl)aminosulfonyl]phenyl\}-2-hydroxypropyl)-2-methoxybenzamide 
5-chloro-N-(2-\{4-[(cyclohexylcarbamoyl)aminosulfonyl]phenyl\}propyl)-2-methoxybenzamide 
5-Chloro-ortho-toluidine 
5-chlorosalicylic acid 
6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime  
6-\{4-[4-(4-chlorophenyl)piperidin-4-yl]phenyl\}-9H-purine 
6-amino-1-(4-chlorophenyl)-2-oxo-4-(1,2,4-triazol-1-ylmethyl)-5-pyrimidinecarbonitrile 
6-oxo-2-hydroxy-7-(4'-chlorophenyl)-3,8,8-trichloroocta-2E,4E,7E-trienoic acid 
8-(2-chloro-3,4,5-trimethoxybenzyl)-2-fluoro-9-pent-4-yn-1-yl-9H-purin-6-amine 
8-(3-chlorostyryl)caffeine  
[(2-chloro-5-methylphenyl)\{6-[(4-\{[(2R)-3-(dimethylamino)-2-hydroxypropyl]oxy\}phenyl)amino]pyrimidin-4-yl\}amino]acetonitrile 
\{2-[3-(4-chlorophenyl)propyl]-2,4,4-trimethyl-1,3-oxazolidin-3-yl\}(imidazol-1-yl)methanone +  
abarelix 
Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 
Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 
A mimotope of the pyruvate dehydrogenase E2 component (PDC-E2) comprising a [(2E)-3-(4-chlorophenyl)prop-2-enoyl]-group linked to the lipoated PDC-E2 core dodecapeptide (DKATIGFEVQEE) at N-6 of lysine.
Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 
acemetacin  
aclonifen  
aculeacin A 
afamelanotide  
afatinib +   
albiglutide 
alclofenac  
alpha-Delta(4,5)HexpUA-(1->3)-beta-D-GalpNAc6S-(1->4)-beta-D-GlcpUA-(1->3)-beta-D-GalpNAc6S-(1->4)-beta-D-GlcpUA-(1->3)-beta-D-GalpNAc4S-(1->4)-beta-D-GlcpUA2S-(1->3)-D-GalpNAc6S 
alpha-Delta(4,5)HexpUA2S-(1->3)-beta-D-GalpNAc6S-(1->4)-beta-D-GlcpUA-(1->3)-beta-D-GalpNAc6S-(1->4)-beta-D-GlcpUA-(1->3)-beta-D-GalpNAc6S-(1->4)-beta-D-GlcpUA-(1->3)-D-GalpNAc6S 
alvocidib  
aminopurvalanol 
aminopyrrolnitrin 
amlodipine +   
amoxicilloyl polylysine 
AMPK activator PT 1 
amyloid-beta +  
anilazine 
ansamitocin P3 
Arthrofactin 
astressin  
astressin 2B  
AT7867 
atovaquone  
azelastine +   
azosemide  
bacitracin A +   
baclofen  
BAR0329 
barban 
benoxaprofen  
benzeneboronic acid cyclic [(m-chlorophenoxy)methyl]ethylene ester 
benzeneboronic acid cyclic [(p-chlorophenoxy)methyl]ethylene ester 
benzoximate 
benzylpenicilloyl polylysine 
bepotastine 
beta-endorphin  
bezafibrate  
bis(4-chlorophenyl)acetic acid 
bivalirudin  
boscalid +  
Boscalid Glc ac a and b 
brassinazole 
buclizine  
bupropion +   
butafenacil  
butanilicaine 
butoconazole +   
calcitonin  
calcitonin (human synthetic) 
calcitonin (pork natural) 
calpastatin peptide Ac 184-210 
canertinib  
capsazepine  
Carbanolate 
carbinoxamine +   
carperitide 
carpropamid +  
CCCP  
cetirizine  
chlorantraniliprole 
chlordimeform 
chlorfenapyr 
Chlorfenprop-methyl 
Chlorfensulphide 
chlorflavonin 
chlorhexidine +   
chlormezanone +  
chlorobenzene  
chlorohydroquinone 
Chloromebuform 
chloroprocaine +  
chloropropylate  
chlorotoluron  
chlorphenamine +   
chlorphenesin +   
chlorphenesin carbamate  
chlorphthalim 
chlorpropamide  
chlorpropham  
chlortetracycline  
chlorthalidone  
chondrochloren A 
chondrochloren B 
CIGB-300 
ciliatamide A 
ciliatamide B 
cinidon ethyl 
cisapride  
clemastine +   
clemizole 
clofazimine  
clofencet 
clofentezine 
clofibrate  
clofibric acid +   
clomazone 
clonazepam  
clopidogrel +   
clopidogrel carboxylic acid 
cloransulam +  
cloransulam-methyl 
clotrimazole  
clovoxamine 
corticorelin 
corticotropin  
corticotropin-releasing hormone +   
cosyntropin  
Croconazole 
CTPB 
cyanophycin macromolecule +  
cyclopentylidene-[4-(4-chlorophenyl)thiazol-2-yl]hydrazone 
cyhalodiamide 
dabuzalgron 
dacomitinib 
dafadine B 
daptomycin 
DASKALRSSGMP 
DDD  
DDE  
DDT +   
defensin +  
degarelix 
dermaseptin s3(1-16)-NH2 
desirudin 
desmethyl loperamide 
diacyl lipopeptide +  
dicofol  
diflubenzuron  
DKATIGFEVQEE 
dragomabin 
dragonamide A 
DSGEGDFLAEGGGVR 
echinocandin +   
elcatonin 
elf18 
elvitegravir +  
emericellamide +  
empagliflozin +  
enfuvirtide  
enoxastrobin 
ENPAVHFFKNIVTPRTP 
ENPVVAFFKNIVTPRTP 
ENPVVHFFFNIVTPRTP 
ENPVVHFFKNIVTPRTP 
ENPVVHFFYNIVTPRTP 
eribaxaban 
ethyl 1-[4-(4-chlorobenzenesulfonamido)phenyl]-5-(trifluoromethyl)pyrazole-4-carboxylate 
exendin-3 
exendin-4 
fenofibrate  
fenticlor 
fenvalerate +   
florpyrauxifen +  
florpyrauxifen-benzyl 
fluazaindolizine 
fluazinam  
fluazuron 
flucofuron 
flucycloxuron +  
flufenoxuron 
flufenoxystrobin 
flufenpyr +  
flufenpyr-ethyl 
flumethrin 
fluoxastrobin 
flusulfamide 
fluthiacet +  
fluthiacet-methyl 
fluvalinate +   
fomesafen  
FPAWFTKLYPRT 
ganirelix  
gastrin +   
gefitinib +   
ghrelin 
glyburide  
glycopeptidolipid +  
GNF5343 
Gonadorelin hydrochloride 
halauxifen-methyl 
halocarban  
halofenozide 
haloperidol  
hexythiazox +  
hydroxyzine +   
ICPD-26 
ICPD-47 
imibenconazole 
indometacin +   
insulin (human) 
ipconazole 
IPQVWRDWFKLP 
JNK inhibitor I 
karetazan 
ketamine +   
KGKGKGKGKGENPAVHFFKNIVTPRTP 
KGKGKGKGKGENPVVAFFKNIVTPRTP 
KGKGKGKGKGENPVVHFFFNIVTPRTP 
KGKGKGKGKGENPVVHFFKNIVTPRTP 
KGKGKGKGKGENPVVHFFYNIVTPRTP 
kisspeptin-54 
KN-93  
koshikamide A2 
lantibiotic +  
lenvatinib 
lepirudin  
lipopeptide antibiotic +   
liraglutide  
lixisenatide 
LLP-3 
LM-1685  
lofepramine +   
lonazolac 
loperamide  
LSM-37009 
LSM-37015 
LSM-37045 
LSM-37094 
LSM-37129 
LSM-37138 
LSM-37175 
LSM-37192 
LSM-37213 
lumefantrine 
m-Chlorophenylbiguanide  
malacidin A 
malacidin B 
mastoparans +   
melittin  
Mercapturic conjugation of Boscalid 
metconazole 
methyl (2-chloro-5-\{N-[(6-methylpyridin-2-yl)methoxy]ethanimidoyl\}benzyl)carbamate +  
methyl 2-\{[5-(\{3-chloro-4-[(5S)-1,1-dioxido-3-oxo-1,2-thiazolidin-5-yl]-N-(phenylsulfonyl)-L-phenylalanyl\}amino)pentyl]oxy\}-6-hydroxybenzoate 
methyl 3-(4-chlorophenyl)-3-\{[N-(isopropoxycarbonyl)valyl]amino\}propanoate +  
methyl \{[2-chloro-4-fluoro-5-(1-oxo-3-sulfanylidenetetrahydro-1H-[1,2,4]triazolo[1,2-a]pyridazin-2(3H)-yl)phenyl]sulfanyl\}acetate 
metoclopramide  
metyltetraprole 
MI-63 
Milling yellow 3G (free acid) 
Mirabamide C 
Mirabamide G 
Mirabamide H 
Mirasan 
moclobemide  
monochlorobenzoic acid +  
monochlorobiphenyl +   
monochlorophenol +   
monodechloroaminopyrrolnitrin 
monuron  
MS-417 
MS-566 
N(7)-butyl-N(2)-(5-chloro-2-methylphenyl)-5-methyl[1,2,4]triazolo[1,5-a]pyrimidine-2,7-diamine 
N-(1-benzyl-2-methylpyrrolidin-3-yl)-5-chloro-2-methoxy-4-(methylamino)benzamide +   
N-(2-chlorobenzyl)-1-(2,5-dimethylphenyl)benzimidazole-5-carboxamide 
N-(\{(2S,4R)-4-[(4-chlorobenzyl)oxy]pyrrolidin-2-yl\}methyl)isoquinoline-5-sulfonamide 
N-[(1S)-1-\{[(1S)-4-carbamimidamido-1-(1,3-thiazol-2-ylcarbonyl)butyl]carbamoyl\}-2-methylpropyl]-2-(3-chlorophenyl)-2-oxoacetamide 
N-[(2Z)-5-\{4-chloro-3-[(2-hydroxyethyl)sulfamoyl]phenyl\}-4-methyl-1,3-thiazol-2(3H)-ylidene]acetamide 
N-[(4-chlorophenyl)methyl]-2-(2,4-dioxo-1H-pyrimidin-6-yl)acetamide 
N-[3-(4-\{[1-(5-chloro-2,4-dimethoxyanilino)-1-oxopropan-2-yl]sulfanyl\}anilino)-3-oxo-1-phenylprop-1-en-2-yl]benzamide 
N-\{3-[(E)-(tert-butoxyimino)methyl]-4-chlorophenyl\}-2-methylfuran-3-carbothioamide 
N-\{5-chloro-4-[(4-chlorophenyl)(cyano)methyl]-2-methylphenyl\}-2-hydroxy-3,5-diiodobenzamide +   
N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 
N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 
N-tetradecanoylglycylpeptide 
Nafarelin 
Nafarelin acetate hydrate 
NAV2729 
nefazodone +   
nesiritide 
Neurokinin A  
Neurokinin B 
neurotensin  
nociceptin  
novaluron 
omega-conotoxin GVIA  
orbencarb 
P-factor 
p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 
Para-LP-01 
pelitinib +  
pencycuron  
penicilloyl polylysine 
pentoxazone 
peptide YY 
PF-4800567 
PK-11195  
poly(glycyl-L-arginine) 
polymyxin +   
PP2 
PR-39  
pramlintide 
profenofos  
profoxydim 
proglumetacin +  
proguanil  
protein polypeptide chain +   
pyraclofos 
pyraclostrobin 
pyraflufen +  
pyraflufen-ethyl 
pyraoxystrobin 
pyrimethamine  
pyrrolnitrin 
QINTAKWWKTHF 
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 
R24 
radicicol  
regorafenib +   
RS 39604  
saflufenacil 
sapitinib 
SB 415286  
SC560 
SD-06 
secretin human 
selumetinib  
Sermorelin 
sintofen 
solabegron  
sorafenib +   
Src Inhibitor-5 
STAT3 inhibitor peptide 
Streptomyces coelicolor calcium-dependent antibiotic CDA4b 
strobilurin B 
syringomycin +  
teduglutide 
teicoplanin A2 +   
teicoplanin A3-1 +   
tembotrione 
tepoxalin  
teriparatide 
terlipressin 
tesamorelin 
tetradifon  
Thiobencarb  
thymalfasin 
tiadinil 
ticlopidine +   
tipifarnib  
tralopyril +  
trazodone +   
triacyl lipopeptide +  
triadimenol 
triarathene 
triclocarban  
triclosan  
triflumizole  
triflumuron  
TY 52156 
tyrphostin AG 1478  
Vaby A 
Vaby B 
Vaby C 
Vaby D 
Vaby E 
Varv E 
vatalanib +  
vemurafenib  
venetoclax  
vismodegib  
VSWKTWFPNLAV 
WHWLQLKPGQPMY 
YIIKGLFWDPAC +  
YIIKGVFWDPAC +  
YSPFHKWFPSMH 
zomepirac  

Synonyms
Exact Synonyms: N-acetyl-L-alpha-aspartyl-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-L-lysyl-L-alanyl-L-threonyl-L-isoleucylglycyl-L-phenylalanyl-L-alpha-glutamyl-L-valyl-L-glutaminyl-L-alpha-glutamyl-L-glutamic acid
Related Synonyms: Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu ;   Formula=C70H99ClN14O25 ;   InChI=1S/C70H99ClN14O25/c1-8-36(4)58(84-69(108)59(38(6)86)85-60(99)37(5)75-61(100)43(78-66(105)49(33-56(97)98)76-39(7)87)16-12-13-31-73-51(89)27-19-40-17-20-42(71)21-18-40)67(106)74-34-52(90)77-48(32-41-14-10-9-11-15-41)65(104)80-46(24-29-54(93)94)64(103)83-57(35(2)3)68(107)81-44(22-26-50(72)88)62(101)79-45(23-28-53(91)92)63(102)82-47(70(109)110)25-30-55(95)96/h9-11,14-15,17-21,27,35-38,43-49,57-59,86H,8,12-13,16,22-26,28-34H2,1-7H3,(H2,72,88)(H,73,89)(H,74,106)(H,75,100)(H,76,87)(H,77,90)(H,78,105)(H,79,101)(H,80,104)(H,81,107)(H,82,102)(H,83,103)(H,84,108)(H,85,99)(H,91,92)(H,93,94)(H,95,96)(H,97,98)(H,109,110)/b27-19+/t36-,37-,38+,43-,44-,45-,46-,47-,48-,49-,57-,58-,59-/m0/s1 ;   InChIKey=ZDFSISOZMYQJHF-IFOGSSKMSA-N ;   N-ethanoyl-L-alpha-aspartyl-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-L-lysyl-L-alanyl-L-threonyl-L-isoleucylglycyl-L-phenylalanyl-L-alpha-glutamyl-L-valyl-L-glutaminyl-L-alpha-glutamyl-L-glutamic acid ;   SMILES=CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCCCNC(=O)\\C=C\\c1ccc(Cl)cc1)NC(=O)[C@H](CC(O)=O)NC(C)=O)[C@@H](C)O)C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O
Xrefs: PMID:11509645 "Europe PMC"

paths to the root

NHLBI Logo

RGD is funded by grant HL64541 from the National Heart, Lung, and Blood Institute on behalf of the NIH.