Send us a Message



Submit Data |  Help |  Video Tutorials |  News |  Publications |  Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE (CHEBI:60229)
Annotations: Rat: (0) Mouse: (0) Human: (0) Chinchilla: (0) Bonobo: (0) Dog: (0) Squirrel: (0) Pig: (0)
Parent Terms Term With Siblings Child Terms
lipopeptide +     
mimotope +  
polypeptide +     
(12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 
(3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 
(4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 
abarelix 
Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 
Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 
A mimotope of the pyruvate dehydrogenase E2 component (PDC-E2) comprising a chloroacetyl group linked to the lipoated PDC-E2 core dodecapeptide (DKATIGFEVQEE) at N-6 of lysine.
Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 
aculeacin A 
afamelanotide  
albiglutide 
alpha-Delta(4,5)HexpUA-(1->3)-beta-D-GalpNAc6S-(1->4)-beta-D-GlcpUA-(1->3)-beta-D-GalpNAc6S-(1->4)-beta-D-GlcpUA-(1->3)-beta-D-GalpNAc4S-(1->4)-beta-D-GlcpUA2S-(1->3)-D-GalpNAc6S 
alpha-Delta(4,5)HexpUA2S-(1->3)-beta-D-GalpNAc6S-(1->4)-beta-D-GlcpUA-(1->3)-beta-D-GalpNAc6S-(1->4)-beta-D-GlcpUA-(1->3)-beta-D-GalpNAc6S-(1->4)-beta-D-GlcpUA-(1->3)-D-GalpNAc6S 
amoxicilloyl polylysine 
amyloid-beta +  
Arthrofactin 
astressin  
astressin 2B  
bacitracin A +   
benzylpenicilloyl polylysine 
beta-endorphin  
bivalirudin  
calcitonin  
calcitonin (human synthetic) 
calcitonin (pork natural) 
calpastatin peptide Ac 184-210 
carperitide 
cathelicidin +   
CIGB-300 
ciliatamide A 
ciliatamide B 
corticorelin 
corticotropin  
corticotropin-releasing hormone +   
cosyntropin  
cyanophycin macromolecule +  
daptomycin 
DASKALRSSGMP 
defensin +  
degarelix 
dermaseptin s3(1-16)-NH2 
desirudin 
diacyl lipopeptide +  
DKATIGFEVQEE 
dragomabin 
dragonamide A 
DSGEGDFLAEGGGVR 
echinocandin +   
elcatonin 
elf18 
emericellamide +  
enfuvirtide  
ENPAVHFFKNIVTPRTP 
ENPVVAFFKNIVTPRTP 
ENPVVHFFFNIVTPRTP 
ENPVVHFFKNIVTPRTP 
ENPVVHFFYNIVTPRTP 
exendin-3 
exendin-4 
FPAWFTKLYPRT 
ganirelix  
gastrin +   
ghrelin  
glycopeptidolipid +  
Gonadorelin hydrochloride 
insulin +   
IPQVWRDWFKLP 
JNK inhibitor I 
KGKGKGKGKGENPAVHFFKNIVTPRTP 
KGKGKGKGKGENPVVAFFKNIVTPRTP 
KGKGKGKGKGENPVVHFFFNIVTPRTP 
KGKGKGKGKGENPVVHFFKNIVTPRTP 
KGKGKGKGKGENPVVHFFYNIVTPRTP 
kisspeptin-54 
koshikamide A2 
lantibiotic +  
lepirudin  
lipopeptide antibiotic +   
liraglutide  
lixisenatide 
LSM-37009 
LSM-37015 
LSM-37045 
LSM-37094 
LSM-37129 
LSM-37138 
LSM-37175 
LSM-37192 
LSM-37213 
malacidin A 
malacidin B 
mastoparans +   
melittin  
Mirabamide C 
Mirabamide G 
Mirabamide H 
N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 
N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 
N-tetradecanoylglycylpeptide 
nesiritide 
Neurokinin A  
Neurokinin B 
nociceptin  
omega-conotoxin GVIA  
P-factor 
p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 
Para-LP-01 
penicilloyl polylysine 
peptide YY 
poly(glycyl-L-arginine) 
polymyxin +   
pramlintide 
protein polypeptide chain +   
QINTAKWWKTHF 
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 
Rac1 Inhibitor W56 
S. pneumoniae serotype 14 capsular oligosaccharide derivative 
secretin human 
semaglutide 
sermorelin 
STAT3 inhibitor peptide 
Streptomyces coelicolor calcium-dependent antibiotic CDA4b 
syringomycin +  
teduglutide 
teriparatide 
terlipressin 
tesamorelin 
thymalfasin 
triacyl lipopeptide +   
Vaby A 
Vaby B 
Vaby C 
Vaby D 
Vaby E 
Varv E 
VSWKTWFPNLAV 
WHWLQLKPGQPMY 
YIIKGLFWDPAC +  
YIIKGVFWDPAC +  
YSPFHKWFPSMH 

Synonyms
Exact Synonyms: N-acetyl-L-alpha-aspartyl-N(6)-(chloroacetyl)-L-lysyl-L-alanyl-L-threonyl-L-isoleucylglycyl-L-phenylalanyl-L-alpha-glutamyl-L-valyl-L-glutaminyl-L-alpha-glutamyl-L-glutamic acid
Related Synonyms: Ac-Asp-N(6)-(chloroacetyl)-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu ;   Formula=C63H95ClN14O25 ;   InChI=1S/C63H95ClN14O25/c1-8-31(4)51(77-62(101)52(33(6)79)78-53(92)32(5)68-54(93)36(16-12-13-25-66-44(82)28-64)71-59(98)42(27-49(90)91)69-34(7)80)60(99)67-29-45(83)70-41(26-35-14-10-9-11-15-35)58(97)73-39(19-23-47(86)87)57(96)76-50(30(2)3)61(100)74-37(17-21-43(65)81)55(94)72-38(18-22-46(84)85)56(95)75-40(63(102)103)20-24-48(88)89/h9-11,14-15,30-33,36-42,50-52,79H,8,12-13,16-29H2,1-7H3,(H2,65,81)(H,66,82)(H,67,99)(H,68,93)(H,69,80)(H,70,83)(H,71,98)(H,72,94)(H,73,97)(H,74,100)(H,75,95)(H,76,96)(H,77,101)(H,78,92)(H,84,85)(H,86,87)(H,88,89)(H,90,91)(H,102,103)/t31-,32-,33+,36-,37-,38-,39-,40-,41-,42-,50-,51-,52-/m0/s1 ;   InChIKey=GCJUPWXYBKQRJZ-JONZXZGTSA-N ;   N-ethanoyl-L-alpha-aspartyl-N(6)-(chloroacetyl)-L-lysyl-L-alanyl-L-threonyl-L-isoleucylglycyl-L-phenylalanyl-L-alpha-glutamyl-L-valyl-L-glutaminyl-L-alpha-glutamyl-L-glutamic acid ;   SMILES=CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCCCNC(=O)CCl)NC(=O)[C@H](CC(O)=O)NC(C)=O)[C@@H](C)O)C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O
Xrefs: PMID:11509645

paths to the root