Send us a Message



Submit Data |  Help |  Video Tutorials |  News |  Publications |  Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
phenolic phthiocerol (CHEBI:59237)
Annotations: Rat: (0) Mouse: (0) Human: (0) Chinchilla: (0) Bonobo: (0) Dog: (0) Squirrel: (0) Pig: (0)
Parent Terms Term With Siblings Child Terms
epitope +   
lipid +     
phenols +     
triol +     
(+)-(1R)-1,12-dihydroxy-20-norabieta-5(10),8,11,13-tetraene 
(+)-(3R)-1,7-bis(4-hydroxyphenyl)-(6E)-6-hepten-3-ol 
(+)-(5S)-12-hydroxy-2-oxo-20-norabieta-1(10),8,11,13-tetraene 
(+)-(5S,10R)-10,12-dihydroxy-7-oxo-20-norabieta-8,11,13-triene 
(+)-(5S,7R)-7-ethoxy-12-hydroxy-2-oxo-20-norabieta-1(10),8,11,13-tetraene 
(+)-(7''S,8S,8'R,8''R)-4,4''-dihydroxy-3,3',3'',5'-tetramethoxy-4',8''-oxy-8,8'-sesquineolignan-7''-ol 
(+)-(7R,7'R,7''R,7'''R,8S,8'S,8''S,8'''S)-4'',4'''-dihydroxy-3,3',3'',3''',5,5'-hexamethoxy-7,9':7',9-diepoxy-4,8'':4',8'''-bisoxy-8,8'-dineolignan-7'',7''',9'',9'''-tetraol 
(+)-(7R,7'R,8S,8'S)-4'-hydroxy-3,3',4,5,5'-pentamethoxy-7,7'-epoxylignan-9,9'-diol 
(+)-(7S,8R,8'R)-5,5'-dimethoxylariciresinol 
(+)-(7S,8S)-1',4-dihydroxy-3,3',5'-trimethoxy-7',8',9'-trinor-8,4'-oxyneolignan-7,9-diol 
(+)-(7S,8S)-4-hydroxy-3,3',5'-trimethoxy-8',9'-dinor-8,4'-oxyneolignan-7,9-diol-7'-oic acid 
(+)-(7S,8S)-guaiacylglycerol-beta-vanillic acid ether 
(+)-(8R,8'R)-4-hydroxy-5-methoxy-1',2',3',4',5',6'-hexanor-2,7'-cyclolignan-7'-one 
(+)-(8S,8'R)-4,4'-dihydroxy-3,3',5'-trimethoxylignan 
(+)-(8S,8'R)-4-hydroxy-3,3',4',5'-tetramethoxylignan 
(+)-(8S,8'R)-9'-acetoxy-4,4'-dihydroxy-3,3',5'-trimethoxylignan 
(+)-(8S,8'R)-9-acetoxy-4,4'-dihydroxy-3,3',5'-trimethoxylignan 
(+)-5'-methoxylariciresinol 
(+)-conocarpan  
(+)-diversonol 
(+)-geodin 
(+)-jasplakinolide Z1 
(+)-jasplakinolide Z2 
(+)-jasplakinolide Z3 
(+)-lariciresinol +   
(+)-larreatricin 
(+)-N-(methoxycarbonyl)-N-norboldine 
(+)-phytocassane B 
(+)-pisiferal 
(+)-pisiferic acid 
(+)-tephrosone 
(-)-(3S)-1,7-bis(4-hydroxyphenyl)-(6E)-6-hepten-3-ol 
(-)-(4S,5S,10R)-10,12,18-trihydroxy-7-oxo-20-norabieta-8,11,13-triene 
(-)-(5R,10S)-12-hydroxy-7-oxo-20-norabieta-8,11,13-triene 
(-)-(7R,7'R,7''R,8S,8'S,8''S)-4',4''-dihydroxy-3,3',3'',5,5',5''-hexamethoxy-7,9':7',9-diepoxy-4,8''-oxy-8,8'-sesquineolignan-7'',9''-diol 
(-)-(7R,7'R,7''R,8S,8'S,8''S)-4',4''-dihydroxy-3,3',3'',5,5'-pentamethoxy-7,9':7',9-diepoxy-4,8''-oxy-8,8'-sesquineolignan-7'',9''-diol 
(-)-(7R,7'R,7''R,8S,8'S,8''S)-4',4''-dihydroxy-3,3',3'',5-tetramethoxy-7,9':7',9-diepoxy-4,8''-oxy-8,8'-sesquineolignan-7'',9''-diol 
(-)-(7R,7'R,7''S,8S,8'S,8''S)-4',4''-dihydroxy-3,3',3'',5,5',5''-hexamethoxy-7,9':7',9-diepoxy-4,8''-oxy-8,8'-sesquineolignan-7'',9''-diol 
(-)-(7R,7'R,7''S,8S,8'S,8''S)-4',4''-dihydroxy-3,3',3'',5,5'-pentamethoxy-7,9':7',9-diepoxy-4,8''-oxy-8,8'-sesquineolignan-7'',9''-diol 
(-)-(7R,7'R,7''S,8S,8'S,8''S)-4',4''-dihydroxy-3,3',3'',5-tetramethoxy-7,9':7',9-diepoxy-4,8''-oxy-8,8'-sesquineolignan-7'',9''-diol 
(-)-(7R,7'R,8S,8'S)-4'-hydroxy-3,3',4,5,5'-pentamethoxy-7,9':7',9-diepoxylignane 
(-)-(7R,8R,8'R)-4,4'-dihydroxy-3,3',5'-trimethoxy-7,9'-epoxylignan 
(-)-5'-desmethylyatein 
(-)-gynuraone 
(-)-lariciresinol  
(-)-larreatricin 
(-)-marinopyrrole A 
(-)-marinopyrrole B 
(-)-microdiplodiasolol 
(-)-phaseolin 
(-)-pluviatolide +  
(10)-Gingerol 
(10E,12E,14E)-9-hydroxy-16-oxo-10,12,14-octadecatrienoic acid 
(11E)-13-hydroxy-10-oxo-11-octadecenoic acid 
(13S)-13-hydroxyoctadeca-9,11-dienoic acid 
(15:1)-Cardanol 
(18S)-resolvin E1 
(1R,2R,4S,5S,6R,7S)4,5-epoxygermacra-9Z-en-1,2,6-triol 
(2-hydroxyphenyl)acetic acid 
(20S,23)-dihydroxyvitamin D3 
(20S,24R)-dihydroxyvitamin D3 
(20S,24S)-dihydroxyvitamin D3 
(24R)-1alpha,24-dihydroxy-22-oxavitamin D3 
(2E)-3-(4-\{[1-hydroxy-1-(4-hydroxy-3-methoxyphenyl)-3-(sulfooxy)propan-2-yl]oxy\}-3-methoxyphenyl)prop-2-enoic acid 
(2E)-4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
(2E)-4-hydroxy-3-methylbut-2-enyl diphosphate(3-) 
(2E,4E)-N-[(4-hydroxy-3-methoxyphenyl)ethyl]-2,4-decadienamide 
(2E,6Z)-13-hydroxy-1-(2-hydroxy-5-methoxy-3-methylphenyl)-3,7,11,15-tetramethylhexadeca-2,6,14-triene-5,12-dione 
(2R*,3R*)-2,3-dihydro-7-hydroxy-2,3-dimethyl-2-[4,8-dimethyl-3(E)-7-nonadien-6-onyl]furo[3,2-c]coumarin 
(2R,3S,2'R)-nadolol +   
(2R,3S,2'S)-nadolol +   
(2S)-2-amino-3-[[5-(2-aminoethyl)-2,3-dihydroxyphenyl]thio]propanoic acid 
(2S*,3R*)-2,3-dihydro-7-hydroxy-2,3-dimethyl-2-[4,8-dimethyl-3(E),7-nonadien-6-onyl]-furo[3,2-c]coumarin 
(2S,3R)-3-(4-hydroxyphenyl)-2-[4-(2-piperidin-1-ylethoxy)phenyl]-2,3-dihydro-1,4-benzoxathiin-6-ol 
(2S,3R,2'R)-nadolol +   
(2S,3R,2'S)-nadolol +   
(2S,3S)-2,3-dihydro-3-hydroxymethyl-2-(4-hydroxyphenyl)-5-(E)-propenylbenzofuran 
(3-chloro-4-hydroxyphenyl)acetic acid 
(3beta,16alpha)-13,28-epoxyoleanane-3,16,30-triol +  
(3R)-3,8,9,10-tetrahydroxy-6-methyl-1,2,3,4-tetrahydroanthracen-1-one 
(3S)-3-(1,3-benzodioxol-5-yl)-1-(3,5-dimethyl-1-piperidinyl)-3-(2-hydroxy-4,6-dimethoxyphenyl)-1-propanone 
(3S)-9,10-dihydroxy-7-methoxy-3-(2-oxopropyl)-1H,3H,4H-naphtho[2,3-c]pyran-1-one 
(3S,11aS)-3-(4-hydroxybenzyl)-2-[(1S)-1-\{[2-(4-hydroxyphenyl)ethyl]carbamoyl\}butyl]-4-oxo-3,6,11,11a-tetrahydro-4H-pyrazino[1,2-b]isoquinolin-2-ium-1-olate 
(4-Hydroxy-3-methoxyphenyl)ethanol 
(4aR,10bS)-noroxomaritidine 
(4aS,10bR)-noroxomaritidine 
(4S)-2-methylpentane-2,4-diol 
(4S)-4-butyl-1-(4-hydroxyphenyl)-2-phenylpyrazolidine-3,5-dione 
(4Z)-2,8:7,12:11,15:14,18:17,22-pentaanhydro-4,5,6,9,10,13,19,20,21-nonadeoxy-L-arabino-L-allo-L-allo-docosa-4,9,20-trienitol 
(5R)-5-hydroxy-1-(4-hydroxy-3-methoxyphenyl)tetradecan-3-one 
(5R,6S,7S)-5,6-dihydroxy-8-(alpha-D-galactosyloxy)-7-hexacosanamido-N-(4-pentylphenyl)octanamide 
(5R,6S,7S)-5,6-dihydroxy-8-(alpha-D-galactosyloxy)-7-hexacosanamido-N-(6-phenylhexyl)octanamide 
(5R,6S,7S)-5,6-dihydroxy-8-(alpha-D-galactosyloxy)-7-icosanamido-N-(6-phenylhexyl)octanamide 
(5R,6S,7S)-5,6-dihydroxy-8-(alpha-D-galactosyloxy)-7-octanamido-N-(3-pentylphenyl)octanamide 
(5R,6S,7S)-5,6-dihydroxy-8-(alpha-D-galactosyloxy)-7-octanamido-N-(4-pentylphenyl)octanamide 
(5R,6S,7S)-5,6-dihydroxy-8-(alpha-D-galactosyloxy)-7-octanamido-N-(4-phenylbutyl)octanamide 
(5R,6S,7S)-5,6-dihydroxy-8-(alpha-D-galactosyloxy)-7-octanamido-N-nonyloctanamide 
(5R,6S,7S)-7-dodecanamido-8-(alpha-D-galactosyloxy)-5,6-dihydroxy-N-(6-phenylhexyl)octanamide 
(5R,6S,7S)-8-(alpha-D-galactosyloxy)-7-hexadecanamido-5,6-dihydroxy-N-(6-phenylhexyl)octanamide 
(6aS,11aS)-2-dimethylallyl-3,6a,9-trihydroxypterocarpan 
(6aS,11aS)-4-dimethylallyl-3,6a,9-trihydroxypterocarpan 
(6Z,8E,10E,14Z,16E,18R)-5,12,18-trihydroxyicosapentaenoic acid 
(7R,8R)-AGI-B4 
(7R,8R)-alpha-diversonolic ester 
(7S,8S)-methoxy-3',7-epoxy-8,4'-oxyneolignan-4,9,9'-triol 
(8)-Gingerol 
(9E,13Z,15E)-14,18-dihydroxy-12-oxooctadeca-9,13,15-trienoic acid 
(9R,10S,12Z)-9,10-Dihydroxy-8-oxo-12-octadecenoic acid 
(9S,10E,12Z,15Z)-9-Hydroxy-10,12,15-octadecatrienoic acid 
(9Z,11E,13E,15Z)-4-oxo-9,11,13,15-octadecatetraenoic acid 
(9Z,12Z,15Z)-(7S,8S)-Dihydroxyoctadeca-9,12,15-trienoate 
(beta-D-glucosyl)-O-mycofactocinone +  
(E)-1,7-bis(4-hydroxyphenyl)-6-hepten-3-one 
(E)-4-[5-(4-Hydroxyphenoxy)-3-penten-1-ynyl]phenol 
(E)-5-hydroxy-6-(3-methylbut-2-enyl)-2-(pent-1-enyl)benzofuran-4-carbaldehyde 
(E)-sinapaldehyde +  
(omega-1)-methyl-branched lipid 
(R)-3-Hydroxy-1-[(R)-4-hydroxy-1,3-dihydroisobenzofuran-1-yl]butan-2-one 
(R)-3-Hydroxy-1-[(S)-4-hydroxy-1,3-dihydroisobenzofuran-1-yl]butan-2-one 
(R)-7-butyl-6,8-dihydroxy-3-[(3E)-pent-3-en-1-yl]-3,4-dihydroisochromen-1-one 
(R)-N-trans-feruloyloctopamine 
(S)-2-(4-nitrobenzyl)-DOTA 
(S)-2-\{4-[2-(2-hydroxyethylthio)acetamido]benzyl\}-DOTA 
(S)-[10]-Gingerol 
(S)-[8]-Gingerol 
(S)-codamine 
(S)-DNPA 
(S)-nandinine +  
(Z)-3-(henicos-14-en-1-yl)phenol 
(Z)-dehydrotyrosine 
(Z)-hexadec-11-enal 
->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)]-beta-D-Galp-yl group 
->4)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
->8)-alpha-Neu5Ac-(2->3)-[beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)]-beta-D-Gal-(1->4)-yl group +   
1'-Hydroxychavicol acetate 
1,2,3-butanetriol 
1,2,4-butanetriol 
1,2-bis(4-hydroxyphenyl)propan-2-ol 
1,2-di-O-[1-(14)C]-palmitoyl-sn-glycero-3-phosphocholine 
1,2-di-O-palmitoyl-sn-glycero-3-phosphocholine 
1,3,5,6-tetrahydroxy-4,7,8-tri(3-methyl-2-butenyl)xanthone 
1,3,5-pentanetriol 
1,3,5-trihydroxy-2-(2',2'-dimethyl-4'-isopropenyl)cyclopentanylxanthone 
1,3,7-trihydroxy-2,4-diisoprenylxanthone 
1,3-benzodioxole-5-carboxylic acid [2-[[[(3-fluorophenyl)-oxomethyl]hydrazinylidene]methyl]phenyl] ester 
1,5-anhydro-D-fructose 
1,6:5,9:8,12:11,16-tetraanhydro-2,3,4,10,13,14-hexadeoxy-D-glycero-D-allo-D-gulo-heptadeca-2,13-dienitol 
1,7,8,9,10,10-hexachloro-4-methyl-4-azatricyclo[5.2.1.0(2,6)]dec-8-ene-3,5-dione 
1,7-bis (4-hydroxyphenyl)-1,4,6-heptatrien-3-one 
1,7-bis(4-hydroxyphenyl)-3-heptanone 
1,7-bis(4-hydroxyphenyl)hepta-4E-6E-dien-3-one 
1,7-dihydroxy-4-methoxyxanthone 
1-(2-hydroxy-3,4,5,6-tetramethoxyphenyl)-3-(2,3,4,6-tetramethoxyphenyl)-2-propen-1-one 
1-(3,4,5-trihydroxy-7-methoxynaphthalen-2-yl)propan-2-one 
1-(3,6-di-O-sulfo-beta-D-galactosyl)-N-lauroylsphingosine 
1-(3-hydroxy-4-methoxyphenyl)ethane-1,2-diol 
1-(3-Methoxy-4-hydroxy)-phenyl-6,7-dihydroxy-isochroman 
1-(3-O-sulfo-beta-D-galactosyl)-N-[(15Z)-tetracos-15-enoyl]sphingosine 
1-(3-O-sulfo-beta-D-galactosyl)-N-stearoylsphingosine 
1-(4'-hydroxy-3'-methoxyphenyl)-7-phenyl-3-heptanone 
1-(4-\{[1,3-dihydroxy-1-(4-hydroxy-3-methoxyphenyl)propan-2-yl]oxy\}-3,5-dimethoxyphenyl)propane-1,2,3-triol 
1-(4-hydroxy-3,5-dimethoxyphenyl)ethanol 
1-(4-hydroxyphenyl)-7-phenyl-(6E)-hept-6-en-3-one 
1-(4-hydroxyphenyl)ethane-1,2-diol 
1-(4-hydroxyphenyl)pentan-3-one 
1-(p-Hydroxyphenyl)ethylamine 
1-[2,3-Dihydro-6-hydroxy-4,7-dimethoxy-2S-(prop-1-en-2-yl)benzofuran-5-yl]ethanone 
1-[4-(2-methoxyethyl)phenoxy]-3-(propan-2-ylamino)-2-propanol 
1-aci-nitro-2-(4-hydroxyphenyl)ethane 
1-chloro-2,4,6-trinitrobenzene  
1-chloro-2,4-dinitrobenzene  
1-dodecylpyrrolidin-2-one 
1-elaidoyl-sn-glycero-3-phosphocholine 
1-feruloyl-sn-glycerol 
1-isomangostin 
1-O-(1-O-hexadecanoyl-2-O-heptadecanoyl-sn-glycero-3-phosphono)-1D-myo-inositol 
1-O-(alpha-D-galactopyranosyl)-N-hexacosanoylsphinganine 
1-O-(alpha-D-galactopyranosyl)-N-pamitoylphytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-tetracosanyl-2-aminononane-1,3,4-triol 
1-O-(alpha-D-galactopyranuronosyl)-N-tetradecanoyldihydrosphingosine 
1-O-(alpha-D-galactosyl)-N-hexacosanoylphytosphingosine +   
1-O-3,4-dimethoxy-5-hydroxyphenyl-(6-O-3,5-dimethoxygalloyl)-beta-D-glucopyranoside 
1-O-3,4-dimethoxy-5-hydroxyphenyl-(6-O-vanilloyl)-beta-D-glucopyranoside 
1-O-[6-O-(3-phenylpropanoyl)-alpha-D-galactopyranosyl]-N-hexacosanoylsphinganine 
1-O-[6-O-(3-phenylpropanoyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-dodecanoyl-2-O-pentacosanoyl-sn-glycero-3-phosphocholine 
1-O-feruloyl-beta-D-glucose 
1-O-palmitoyl-2-O-[1-(14)C]-linoleoyl-sn-glycero-3-phosphocholine 
10,12,15-Octadecatrienoic acid 
10-deoxygerfelin 
10-epi-pyriculol 
10-hydroxyicajine 
10-Nitro-9Z,12Z-octadecadienoic acid 
10R-HODE 
10S-HODE 
11-hydroxyicajine 
11beta,13-dihydrolactucopicrin 
11beta,13-dihydrolactucopicrin 15-oxalate 
12,13-DiHODE 
12-demethylmulticaulin 
12-HpODE 
12-HpOTrE 
12-hydroxy-1-oxo-20-norabieta-5(10),6,8,11,13-pentaene 
12-Nitro-9Z,12Z-octadecadienoic acid 
12-O-deacetyltrichilin H 
12R-HODE 
12Z,15Z-Octadecadienoic acid 
13,14,15,16-tetranorlabdane-8alpha,12,18-triol 
13-Hydroxy-9-methoxy-10-oxo-11-octadecenoic acid 
13-hydroxy-alpha-tocopherol 
13-hydroxy-gamma-tocopherol 
13E,17-Octadecadienoic acid 
13S-HOTrE(gamma) 
13S-HpOTrE(gamma) 
14-HpODE 
15,16-DiHODE 
15-acetyldeoxynivalenol  
15-methylhexadecaphytosphingosine +  
15-O-acetylbruceolide 
15-O-propionylbruceolide 
15alpha-hydroxyestradiol 
15alpha-hydroxyestrone 
16-HpOTrE 
16alpha-hydroxyestrone 16-O-(beta-D-glucuronide) 
16beta-hydroxyestradiol +  
16beta-hydroxyestrone 
17-(4-hydroxyphenyl)heptadecanoic acid +  
17-hydroxy-linolenic acid 
17-Hydroxylinolenic acid 
17alpha-estradiol 17-O-(beta-D-glucuronide) 
17beta-estradiol 6-O-(carboxymethyl)oxime 
18-acetoxy-1alpha,25-dihydroxyvitamin D3 
18-fluoro-9Z,12Z-octadecadienoic acid 
18-hydroxyleukotriene B4 
19-(4-hydroxyphenyl)nonadecanoic acid +  
19-hydroxyleukotriene B4 
19-hydroxyprostaglandin I2 
1beta,4beta,7alpha-trihydroxyeudesmane 
1D-myo-inositol 1,2-cyclic phosphate 
2',3'-secoguanosine 
2',4',5',7'-tetrabromo-2,3,4,5-tetrachlorofluorescein 
2',6'-dimethoxy-4'-hydroxyacetophenone 
2'-(4-hydroxyphenyl)-5-(4-methylpiperazin-1-yl)-2,5'-bibenzimidazole 
2'-Hydroxyacetanilide 
2'-hydroxychalcone  
2'-O-methylisoliquiritigenin 
2'-O-methyllicodione 
2,2',3-trihydroxydiphenyl ether 
2,2'-(1-phenyl-1H-1,2,4-triazole-3,5-diyl)diphenol +   
2,2,4-trihydroxybutanoic acid 
2,2-dimethyl-3-(4-methoxyphenyl)-4-ethyl-2H-1-benzopyran-7-ol 
2,2-dimethyl-3-(4-methoxyphenyl)-4-ethyl-6-(1-pyrrolidinylmethyl)-2H-1-benzopyran-7-ol 
2,2-dimethyl-3-(4-methoxyphenyl)-4-ethyl-8-(1-pyrrolidinylmethyl)-2H-1-benzopyran-7-ol 
2,3,4,7,9-pentahydroxy-6-methyl-1H-phenalen-1-one 
2,3,4-trihydroxypentanoic acid 
2,3,4-trihydroxytetrahydrofuran +  
2,3,5-trihydroxy-4-phosphonooxyadipic acid 
2,3,5-trimethylphenol +  
2,3,6,8,9-pentahydroxy-3-(2-oxopropyl)-1,2,3,4-tetrahydroanthracen-1-one 
2,3-bis(4-hydroxyphenyl)propionitrile  
2,3-bis(hydroxymethyl)-7-hydroxy-6-methoxy-1-tetralone 
2,3-Epoxysesamone 
2,4'-dihydroxyacetophenone 
2,4,6-Trimethoxyphenyl acetate 
2,4,6-trinitrobenzenesulfonic acid  
2,4,6-trinitrophenyl group +  
2,4-di-tert-butylphenol  
2,4-dihydroxyacetophenone-5-O-sulfate 
2,4-dinitrophenyl group +  
2,5-bis[(4-hydroxy-3-methoxyphenyl)methylidene]-1-cyclopentanone 
2,5-di-tert-butylphenol 
2,5-Dimethoxy-4-(2-propenyl)phenol 
2,5-ditert-butyl-4-methoxyphenol 
2,6,7-trihydroxy-3-methylnaphthalene-1,4-dione 
2,6-di-O-(alpha-D-mannosyl)-1-O-(1,2-di-O-hexadecanoyl-sn-glycero-3-phosphono)-1D-myo-inositol 
2,6-di-tert-butyl-4-methylphenol  
2,6-di-tert-butylphenol  
2,6-dichloroindophenol  
2,6-Dimethoxy-4-(1-propenyl)phenol 
2,6-Dimethoxy-4-methylphenol 
2,6-Dimethoxy-4-propylphenol 
2,6-dimethoxyphenol +  
2-(2-chloroanilino)-5-[(4-hydroxy-3-methoxyphenyl)methylidene]-4-thiazolone 
2-(2-hydroxy-4-methoxyphenyl)-5-(3-hydroxypropyl)benzofuran 
2-(2-hydroxyphenyl)ethanol 
2-(3,3-dimethyl-2-oxobutylidene)-5-[(3-hydroxy-4-methoxyphenyl)methylidene]-4-thiazolidinone 
2-(3,4-Dihydroxyphenylethyl)-6-epi-elenaiate 
2-(3,5-diphenyl-3,4-dihydropyrazol-2-yl)-2-(4-hydroxy-3-methoxyphenyl)acetonitrile 
2-(3-hydroxyphenyl)propionic acid 
2-(4-ethylanilino)-5-[(4-hydroxy-3,5-dimethoxyphenyl)methylidene]-4-thiazolone 
2-(4-hydroxy-3,5-dimethoxyphenyl)-3-(hydroxymethyl)-2,3-dihydro-7H-pyrano[2,3-g][1,4]benzodioxin-7-one 
2-(4-hydroxyanilino)-5-[(4-hydroxy-3,5-dimethoxyphenyl)methylidene]-4-thiazolone 
2-(4-hydroxyanilino)-5-[(4-hydroxy-3-methoxyphenyl)methylidene]-4-thiazolone 
2-(4-hydroxybenzyl)quinazolin-4(3H)-one 
2-(4-hydroxyphenyl)-1-benzofuran-5-ol 
2-(4-hydroxyphenyl)-3-methylbutyric acid +   
2-(4-hydroxyphenyl)-5-(E)-propenylbenzofuran 
2-(4-hydroxyphenyl)ethanol +   
2-(4-hydroxyphenylazo)benzoic acid 
2-(acetylamino)naphthalene-1,5-disulfonic acid 
2-(hydroxymethyl)-4-(1-hydroxy-2-\{[6-(4-phenylbutoxy)hexyl]amino\}ethyl)phenol +  
2-(p-coumaroyl)malic acid 
2-[(4-acetyloxy-3-ethoxyphenyl)methylidene]-7-methyl-3-oxo-5-(2-phenylethenyl)-5H-thiazolo[3,2-a]pyrimidine-6-carboxylic acid ethyl ester 
2-[(4-acetyloxyphenyl)methylidene]-7-methyl-3-oxo-5-(2-phenylethenyl)-5H-thiazolo[3,2-a]pyrimidine-6-carboxylic acid ethyl ester 
2-[(4-hydroxyphenyl)methyl]propanedinitrile 
2-[(4-hydroxyphenyl)methylidene]propanedinitrile 
2-[(ethylsulfanyl)methyl]phenol +   
2-[1-(p-chlorophenyl)ethyl]-4,6-dinitrophenol 
2-[1-hydroxy-3-(4-methoxyphenyl)propyl]-3,5-dimethoxyphenol 
2-[2-nitro-4-(trifluoromethyl)phenyl]sulfinylacetic acid (4-chlorophenyl) ester 
2-[3-ethyl-5-(4-methoxyphenyl)-1H-pyrazol-4-yl]phenol 
2-[5-[(4-hydroxy-3-methoxyphenyl)methylidene]-4-oxo-2-sulfanylidene-3-thiazolidinyl]-2-phenylacetic acid 
2-[[2-(6-oxo-1-cyclohexa-2,4-dienylidene)-3H-1,3,4-oxadiazol-5-yl]thio]acetic acid (2,6-dimethylphenyl) ester 
2-[[2-(6-oxo-1-cyclohexa-2,4-dienylidene)-3H-1,3,4-oxadiazol-5-yl]thio]acetic acid (4-phenylmethoxyphenyl) ester 
2-[[2-[(2-hydroxyphenyl)-oxomethoxy]-1-oxoethyl]amino]-5,6,7,8-tetrahydro-4H-cyclohepta[b]thiophene-3-carboxylic acid methyl ester 
2-[[3-(methylthio)-1,2,4-thiadiazol-5-yl]thio]acetic acid (4-acetamidophenyl) ester 
2-\{[(2E)-3-iodoprop-2-en-1-yl](propyl)amino\}tetralin-7-ol 
2-\{[(R)-\{[4-(aminomethyl)phenyl]amino\}\{[(1R)-1-phenylethyl]amino\}methyl]amino\}ethane-1,1-diol 
2-acetamidofluorene +   
2-acetamidophenol  
2-acetylphenol 
2-allylphenol  
2-amino-1,3,4-tetradecanetriol 
2-amino-4-(4-hydroxyphenyl)buta-1,3-diene-1,1,3-tricarbonitrile 
2-amino-5-[(4-hydroxy-3-methoxyphenyl)methylidene]-4-thiazolone 
2-amino-5-[(4-hydroxyphenyl)methylidene]-4-thiazolone 
2-amino-5-chlorophenol 
2-cyclopentylphenol 
2-decaprenyl-6-methoxyphenol 
2-deoxy-alpha-L-fucosylaclacinomycin S 
2-deoxypentose 
2-deoxystreptidine 
2-endo-amino-2-exo-benzoyl-3-exo-phenylnorbornane 
2-ethoxyphenol 
2-Ethylphenol  
2-furancarboxylic acid [3-[[[1,3-benzodioxol-5-yl(oxo)methyl]hydrazinylidene]methyl]phenyl] ester 
2-furancarboxylic acid [3-[[[4-anilino-6-(4-morpholinyl)-1,3,5-triazin-2-yl]hydrazinylidene]methyl]phenyl] ester 
2-furancarboxylic acid [4-[(2,4-dioxo-5-thiazolidinylidene)methyl]-2-methoxyphenyl] ester 
2-furancarboxylic acid [4-[(3-methyl-4-oxo-2-sulfanylidene-5-thiazolidinylidene)methyl]phenyl] ester 
2-furancarboxylic acid [4-[[[(2-methylpropan-2-yl)oxy-oxomethyl]hydrazinylidene]methyl]phenyl] ester 
2-furancarboxylic acid [4-[[[oxo(2-pyridinyl)methyl]hydrazinylidene]methyl]phenyl] ester 
2-HoTrE 
2-hydroxy-3-(4-hydroxyphenyl)prop-2-enoic acid 
2-hydroxy-3-methoxybenzaldehyde 2-pyridylhydrazone 
2-hydroxy-3-methoxystrychnine 
2-hydroxy-3-methylbenzoic acid (3-cyano-4-imino-2-oxopentyl) ester 
2-hydroxy-4-(4-hydroxyphenyl)butanoic acid 
2-hydroxy-4-hydroxymethylbenzylidenepyruvic acid 
2-hydroxy-4-methylbenzoic acid [2-(2-chloroanilino)-2-oxoethyl] ester 
2-hydroxy-5-[(4-methoxyphenyl)sulfamoyl]benzoic acid [2-[1-(3-bicyclo[2.2.1]heptanyl)ethylamino]-2-oxoethyl] ester 
2-hydroxy-5-\{1-hydroxy-2-[(4-phenylbutan-2-yl)amino]ethyl\}benzamide +   
2-hydroxy-6-[2-(4-hydroxyphenyl)-2-oxo-ethyl]benzoic acid 
2-hydroxybenzoic acid (3,3,5-trimethylcyclohexyl) ester  
2-hydroxybenzoic acid [2-(2-ethoxyanilino)-2-oxo-1-phenylethyl] ester 
2-hydroxybenzoic acid [2-[[(1-methyl-2-pyrrolyl)-oxomethyl]amino]-2-oxoethyl] ester 
2-hydroxyethyl salicylate 
2-hydroxyisophthalic acid +   
2-hydroxyphenylalanine +  
2-iodo-6-methoxyphenol 
2-isopropoxyphenol +   
2-isopropylphenol +   
2-Linoleoyl glycerol 
2-Methoxy-4-(4-methyl-1,3-dioxolan-2-yl)phenol 
2-Methoxy-4-methylphenol  
2-methoxy-4-vinylphenol 
2-methoxy-6-[[(1-methyl-2-benzimidazolyl)amino]methyl]phenol 
2-methoxy-6-[[(1-propyl-5-benzimidazolyl)amino]methyl]phenol 
2-methoxyestrone +   
2-methoxyhydroquinone 
2-Methoxyresorcinol 
2-Methylphenyl 2-methylpropanoate 
2-O,3-dimethylflaviolin 
2-O-palmitoyl-2'-O-sulfo-3-O-[(2E,4S,6S,8S)-2,4,6,8-tetramethylhexadec-2-enoyl]-alpha,alpha-trehalose 
2-O-sulfate-4-hydroxyacetophenone 
2-polyprenylphenol +  
2-propylphenol 
2-sec-butylphenol +   
2-tert-butyl-4-hydroxyanisole +   
2-thiophenecarboxylic acid (4-acetamidophenyl) ester 
2-thiophenecarboxylic acid [2-ethoxy-4-[(3-methyl-5-oxo-1-phenyl-4-pyrazolylidene)methyl]phenyl] ester 
2-thiophenecarboxylic acid [3-[[1-(3-chloro-4-fluorophenyl)-3,5-dioxo-4-pyrazolidinylidene]methyl]phenyl] ester 
2-thiophenecarboxylic acid [4-[2-cyano-2-(6-methyl-1H-benzimidazol-2-yl)ethenyl]phenyl] ester 
20(S),25-dihydroxyvitamin D3 
20-hydroxyprostaglandin E1 
20-hydroxyprostaglandin E2 
23(S),25-dihydroxy-24-oxovitamin D3 
24G7 epitope +   
2alpha,3alpha,23-trihydroxyolean-12-en-28-oic acid 
2alpha,3beta,23-trihydroxylup-20(29)-en-28-oic acid 
2R-HpOTrE 
3',4'-O-disulfo-N-acetyllactosamine 
3'-Deoxyoleacein 
3'-hydroxy-4'-methoxydiclofenac 
3'-hydroxydiclofenac 
3,3-dimethylcystein-S-yl group 
3,4,5-tribromo-2-(2,4-dibromophenoxy)phenol 
3,4,5-trimethoxyphenol +  
3,4,5-Trimethoxyphenyl acetate 
3,4,5-trimethylphenol +  
3,4-DHPEA-EA 
3,4-di-O-methyl-alpha-L-rhamnose 
3,4-dichloroaniline +   
3,4-Dihydro-8-hydroxy-3-(3-hydroxy-4-methoxyphenyl)-1H-2-benzopyran-1-one 
3,4-dihydroxy-5-(2-hydroxyethanimidoyl)oxolan-2-one 
3,4-xylenol +   
3,5-dibromo-4-hydroxybenzamide 
3,5-dibromo-4-hydroxybenzonitrile  
3,5-dibromo-4-hydroxyphenylpyruvic acid 
3,5-diiodothyropropionic acid 
3,5-Dimethoxyphenol 
3,5-dimethyl-4-(methylsulfanyl)phenol +   
3,5-dimethyl-4-oxo-6-thieno[2,3-d]pyrimidinecarboxylic acid (4-methylphenyl) ester 
3,5-dinitro-4-hydroxyphenylpyruvic acid 
3,5-Dinitroguaiacol 
3,5-xylenol +   
3,6,7,9-tetrahydroxy-3-methyl-2,3-dihydro-1H-naphtho[2,1-b]pyran-1-one 
3,6-di-O-sulfo-beta-D-galactosyl-(1->4)-6-O-sulfo-N-acetyl-beta-D-glucosamine 
3,6-di-O-sulfo-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
3,7-dihydroxytropolone 
3,8,9,10-tetrahydroxy-6-methyl-1,4-dihydroanthracen-1-one 
3-(1,3-benzodioxol-5-yl)-1-(2,6-dimethyl-4-morpholinyl)-3-(2-hydroxy-4,6-dimethoxyphenyl)-1-propanone 
3-(1,3-benzodioxol-5-yl)-3-(2-hydroxy-4,6-dimethoxyphenyl)-1-(3-methyl-1-piperidinyl)-1-propanone 
3-(1,3-benzodioxol-5-yl)-3-(2-hydroxy-4,6-dimethoxyphenyl)-1-(4-methyl-1-piperidinyl)-1-propanone 
3-(10-Heptadecenyl)phenol 
3-(2-furanyl)-2-propenoic acid (3-formylphenyl) ester 
3-(2-hydroxyphenyl)oxirane-2-carboxylic acid 
3-(2-hydroxyphenyl)propanoic acid 
3-(2-Methylpropanoyloxy)-8-(2-methylbutanoyloxy)-9,10-epoxy-p-mentha-1,3,5-triene 
3-(2-Methylpropanoyloxy)-8-(3-methylbutanoyloxy)-9,10-epoxy-p-mentha-1,3,5-triene 
3-(3-hydroxyphenyl)-3-hydroxypropanoic acid 
3-(4-amino-1-tert-butyl-1H-pyrazolo[3,4-d]pyrimidin-3-yl)phenol 
3-(4-ethoxyphenyl)-5-[(3-hydroxy-4-methoxyphenyl)methylidene]-2-(3-nitrophenyl)-1,1-dioxo-1,3-thiazolidin-4-one 
3-(4-hydroxy-3,5-diiodophenyl)lactic acid 
3-(4-hydroxy-3,5-dimethoxyphenyl)propanoylpyrrole 
3-(4-hydroxy-3-methoxyphenyl)propane-1,2-diol 
3-(4-hydroxyphenyl)lactic acid +  
3-(8,11,14-Pentadecatrienyl)phenol 
3-(hydrazinylmethyl)phenol 
3-(hydroxyamino)phenol 
3-[(2E,4E,8S,10E,12Z)-4,8-dimethyltetradeca-2,4,10,12-tetraenoyl]-4-hydroxy-5-(4-hydroxyphenyl)-1,2-dihydropyridin-2-one 
3-[(R)-[1-[2-(4-fluorophenyl)ethyl]-4-piperidinyl]-hydroxymethyl]-2-methoxyphenol 
3-[(S)-[1-[2-(4-fluorophenyl)ethyl]-4-piperidinyl]-hydroxymethyl]-2-methoxyphenol 
3-[1-hydroxy-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enylidene]-6-methylpyran-2,4-dione 
3-[2-(ethylamino)-1-hydroxyethyl]phenol  
3-\{6-[5-(4-methylpiperazin-1-yl)-1H-imidazo[4,5-b]pyridin-2-yl]-1H-benzimidazol-2-yl\}phenol 
3-\{[(5-nitrofuran-2-yl)methylidene]amino\}-1,3-oxazol-2-one 
3-\{[2-(1H-benzimidazol-1-yl)-6-\{[2-(diethylamino)ethyl]amino\}pyrimidin-4-yl]amino\}-4-methylphenol 
3-\{[4-(2,4-dimethyl-1,3-thiazol-5-yl)pyrimidin-2-yl]amino\}phenol 
3-acetyldeoxynivalenol  
3-amino-5-[(4-hydroxyphenyl)methyl]-4,4-dimethylpyrrolidin-2-one 
3-Chloro-1-(4-hydroxy-3-methoxyphenyl)-1,2-propanediol 
3-decaprenyl-4-hydroxy-5-methoxybenzoic acid 
3-dimethylallyl-4-hydroxymandelic acid 
3-dimethylallyl-4-hydroxyphenylpyruvic acid 
3-epi-fagomine 
3-Ethylphenol  
3-formylsalicylic acid 
3-hydroxy-2,8-dichlorodibenzofuran 
3-hydroxy-3-(3-hydroxyphenyl)propanoic acid-O-sulphate 
3-Hydroxy-4-methoxymandelate 
3-hydroxy-9,10-secoandrosta-1,3,5(10)-triene-9,17-dione 
3-hydroxy-9-oxo-9,10-seco-23,24-bisnorchola-1,3,5(10)-trien-22-oic acid +  
3-hydroxybenzoic acid [2-(1H-indol-3-yl)-2-oxoethyl] ester 
3-hydroxybenzyl acetate 
3-hydroxybenzyl alcohol 
3-hydroxybenzyl benzoate 
3-hydroxymandelic acid 
3-hydroxyphenyl propanoate 
3-hydroxyphenylacetic acid  
3-hydroxyphenylpyruvic acid 
3-linalylflaviolin 
3-Methoxy-4-hydroxyphenylethyleneglycol 
3-Methoxy-4-Hydroxyphenylglycol sulfate 
3-Methoxy-5-methylphenol 
3-methoxycatechol monosulfate 
3-methoxyphenol 
3-methoxytyramine +   
3-Methoxytyramine-betaxanthin 
3-methylsalicylaldehyde 
3-nonaprenyl-4-hydroxy-5-methoxybenzoic acid 
3-O-(cis-4-coumaroyl)-beta-D-glucopyranose 
3-O-(trans-4-coumaroyl)-beta-D-glucopyranose 
3-O-\{(1R)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl\}-2,6-bis-O-\{(1S)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl\}-beta-D-Man-(1->4) -beta-D-GlcNAc-(1->4)-3-O-[(1S)-2-hydroxy-1-\{[(2S)-1-hydroxypropan-2-yl]oxy\}ethyl]-D-GlcNAc-yl group 
3-O-alpha-abequopyranosyl-alpha-D-mannopyranose 
3-O-methyl-alpha-L-rhamnose 
3-O-methylcalopocarpin 
3-O-sulfo-beta-D-galactose +  
3-O-vanillyceanothic acid 
3-oxo-N-[(3S)-2-oxopyrrolidin-3-yl]dodecanamide 
3-Pentadecylphenol  
3-tert-butyl-4-hydroxyanisole +   
3beta,12-dihydroxy-13-methyl-5,8,11,13-podocarpatetraene-7-one 
3beta,12-dihydroxy-13-methyl-6,8,11,13-podocarpatetraene 
3beta,15alpha,22-trihydroxyhopane 
3beta,6beta,23-trihydroxyolean-12-en-28-oic acid 28-O-beta-D-glucopyranoside 
3beta-acetoxy-7beta,15alpha,22-trihydroxyhopane 
3S-hydrangenol 4'-O-alpha-L-rhamnopyranoysl-(1->3)-beta-D-glucopyranoside 
4''-deoxyterphenyllin 
4',5-dihydroxydiclofenac 
4'-demethyldeoxypodophyllotoxin 
4'-demethylepipodophyllotoxin +   
4'-demethylpodophyllotoxin 
4'-hydroxy torasemide 
4'-hydroxychalcone  
4'-hydroxydiclofenac  
4'-O-methylbavachalcone 
4,4',4''-(4-propylpyrazole-1,3,5-triyl)trisphenol 
4,4'-Dihydroxy-2',6'-dimethoxychalcone 
4,4'-dihydroxy-3,5-dimethoxydihydrostilbene 
4,4'-dihydroxybenzyl sulfone 
4,4'-thiodiphenol +   
4,6-di-O-sulfo-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-ManpOMe 
4,8,12,15-Octadecatetraenoic acid 
4-(1-hydroxyethyl)phenol 
4-(18,20-dihydroxy-26-methoxy-25-methyloctacosyl)phenyl 3,6-di-O-methyl-beta-D-Glc-(1->4)-2,3-di-O-methyl-alpha-L-Rha-(1->2)-3-O-methyl-alpha-L-Rha 
4-(2,4,7-trioxa-bicyclo[4.1.0]heptan-3-yl)phenol 
4-(2-amino-1-hydroxypropyl)-2-methoxyphenol 
4-(2-amino-3-hydroxyphenyl)-2,4-dioxobutanoic acid 
4-(3-hydroxybutyl)-2-methoxyphenol 
4-(4-hydroxy-3-methoxyphenyl)-6-methyl-2-oxo-3,4-dihydro-1H-pyrimidine-5-carboxylic acid (3-methylcyclohexyl) ester 
4-(4-hydroxy-3-methoxyphenyl)-6-methyl-2-oxo-3,4-dihydro-1H-pyrimidine-5-carboxylic acid (4-methoxyphenyl)methyl ester 
4-(4-Hydroxyphenyl)-2-butanol 
4-(4-styrylphenylcarbamoyl)butyric acid 
4-(6-imidazolidin-2-yl-1H,3'H-2,5'-bibenzimidazol-2'-yl)phenol 
4-(7-butyl-5H-pyrrolo[2,3-b]pyrazin-6-yl)phenol 
4-(\{4-[(2,3,3-Trichloroacryloyl)oxy]phenyl\}sulfonyl)phenyl 2,3,3-trichloroacrylate 
4-(\{4-[4-methyl-2-(methylamino)-1,3-thiazol-5-yl]pyrimidin-2-yl\}amino)phenol 
4-(\{5-[(2-aminoethyl)amino]-2,4-dinitrophenyl\}amino)-TEMPO 
4-(acetylamino)-3-hydroxyphenyl hydrogen sulfate 
4-(methoxymethyl)phenol 
4-(methylsulfanyl)-m-cresol +   
4-(methylsulfanyl)phenol +   
4-(methylsulfinyl)phenol +   
4-(trifluoromethyl)phenol 
4-(trimethylsilyl)phenol +  
4-[(1S,2R)-3-(4-fluorophenyl)-2-hydroxy-1-(1,2,4-triazol-1-yl)propyl]benzonitrile 
4-[(1S,3aR,4S,6aR)-4-(1,3-benzodioxol-5-yl)tetrahydrofuro[3,4-c]furan-1-yl]-2-methoxyphenol 
4-[2-(4-methoxyphenyl)propan-2-yl]phenol 
4-[[(4S)-3-[2-(1-adamantyl)ethyl]-2-amino-4,5-dihydroimidazol-4-yl]methyl]phenol 
4-[N'-(2-hydroxyethyl)thioureido]-L-benzyl EDTA 
4-\{2-[(2-hydroxybenzyl)amino]ethyl\}-2,5-dimethoxybenzonitrile 
4-\{bis[4-(dimethylamino)phenyl]methyl\}phenol 
4-allyl-2,6-dimethoxyphenol 
4-aminobutyl beta-D-xylopyranoside 
4-aminosalicylic acid  
4-benzyloxy-2'-hydroxy-3',4',5',6'-tetramethoxychalcone 
4-chloro-2-methylphenol  
4-chloro-3,5-dimethylphenol  
4-coumaric acid methyl ester 
4-coumaroyltriacetic acid lactone 
4-cyanophenol +   
4-cyclopentylphenol 
4-Dodecylphenol 
4-ethylphenol +   
4-formylsalicylic acid 
4-Gingerol 
4-hydroxy-2,6-dimethylaniline 
4-hydroxy-2-methoxyphenyl 1-O-beta-D-glucopyranoside 
4-hydroxy-2-methylacetophenone 
4-hydroxy-3-methoxy-N-[[1-(phenylmethyl)-3-indolyl]methylideneamino]benzamide 
4-Hydroxy-5-(4'-hydroxyphenyl)-valeric acid-4'-O-sulphate 
4-hydroxy-6-methylaniline 
4-Hydroxy-alprenolol 
4-Hydroxy-benzenepropanedioate 
4-Hydroxyatomoxetine 
4-hydroxybenzoate ester +   
4-hydroxychalcone  
4-Hydroxydihydrocinnamaldehyde 
4-hydroxyglenoblone 
4-hydroxyindole 
4-hydroxymandelate +  
4-hydroxymandelic acid +  
4-hydroxymandelonitrile +  
4-hydroxymellein 
4-hydroxymethamphetamine 
4-hydroxymethylsalicylaldehyde 
4-hydroxyphenylacetic acid +   
4-hydroxyphenylglyoxylic acid 
4-hydroxyphenylpyruvic acid +  
4-hydroxyphenytoin  
4-hydroxyphthalic acid 
4-hydroxystyrene +   
4-iminobutane-1,2,3-triol 
4-Isopentylphenol 
4-isopropylphenol +   
4-methoxy-17beta-estradiol +   
4-Methoxy-2-allylphenol 
4-methoxyestrone +  
4-methyl-1,4-dihydropyridine-3,5-dicarbaldehyde 
4-Methyl-2,4-bis-(p-hydroxyphenyl)pent-1-ene 
4-methylaeruginoic acid 
4-methylaminophenol +  
4-n-Butylphenol 
4-n-Heptylphenol 
4-n-Hexylphenol 
4-n-Pentylphenol 
4-nitrophenyl (4-carboxybutyl)phosphonate 
4-nitrophenyl methylphosphonate 
4-nonylphenol  
4-O-(2-acetamido-2-deoxy-beta-D-glucopyranosyl)-5-O-phosphono-D-ribitol 
4-O-(2-acetamido-2-deoxy-beta-D-glucopyranosyl)-D-ribitol +  
4-O-acetyl-2,3-di-O-methyl-alpha-L-fucopyranose 
4-octylphenol +   
4-tert-butylphenol +   
4beta,7alpha-dihydroxycholesterol 
4R,5R,6S-Trihydroxy-2-hydroxymethyl-2-cyclohexen-1-one 6-(2-hydroxy-6-methylbenzoate) 
5'-(3'-Methoxy-4'-hydroxyphenyl)-gamma-valerolactone 
5'-CGAAAGUCCGAUCGGCGUAAUGUCA-3' RNA fragment 
5'-CGTGCTGTTTTTTTTTG-3' 
5'-CGUUCGCG-3' RNA fragment 
5'-GACCCCUG-3' RNA fragment 
5'-GUUUGGCGACGUCCCACAUGAGCC-3' RNA fragment 
5'-hydroxy-asperentin-8-O-methylether 
5'-TCGAGCTGCCTTCAGTCGT-3' 
5,7-dihydroxy-4-methylphthalide 
5-(2-amino-5,6-dimethyl-1H-benzimidazol-1-yl)pentanoic acid 
5-(3',4'-dihydroxyphenyl)-gamma-valerolactone 3'-O-sulfate 
5-(3',4'-dihydroxyphenyl)-gamma-valerolactone-3'-O-glucuronide 
5-(3',5'-Dihydroxyphenyl)-gamma-valerolactone-O-sulphate-O-methyl 
5-(3-hydroxypropyl)-2-(2-methoxy-4-hydroxyphenyl)benzofuran 
5-(4-acetyloxy-3-methoxyphenyl)-2,7-dimethyl-3-oxo-5H-thiazolo[3,2-a]pyrimidine-6-carboxylic acid ethyl ester 
5-(4-bromophenyl)-4-(4-hydroxy-3-methoxyphenyl)-3-methyl-2,4-dihydropyrrolo[3,4-c]pyrazol-6-one 
5-(\{4-[2-(1-oxidopiperidin-1-yl)ethyl]phenyl\}amino)-5-oxopentanoic acid 
5-(diethylsulfamoyl)-2-hydroxybenzoic acid [2-oxo-2-[4-(trifluoromethoxy)anilino]ethyl] ester 
5-(pentadeca-8,11,14-trien-1-yl)resorcinol monomethyl ether 
5-[(4,6-diamino-1,3,5-triazin-2-yl)amino]-4-hydroxy-3-[(2-sulfophenyl)diazenyl]naphthalene-2,7-disulfonic acid 
5-[(4-hydroxy-3,5-dimethoxyphenyl)methylidene]-1-phenyl-1,3-diazinane-2,4,6-trione 
5-[(4-hydroxy-3-methoxyphenyl)methylidene]-2-(2-methoxyanilino)-4-thiazolone 
5-[(4-hydroxy-3-methoxyphenyl)methylidene]-2-(2-pyridinylamino)-4-thiazolone 
5-[(4-hydroxy-3-methoxyphenyl)methylidene]-2-(4-methoxyanilino)-4-thiazolone 
5-[(4-hydroxy-3-methoxyphenyl)methylidene]-2-(4-methyl-1-piperidinyl)-4-thiazolone 
5-[(4-hydroxyphenyl)methyl]-3-imino-4,4-dimethylpyrrolidin-2-one 
5-[(4-nitrobenzyl)(phosphonomethyl)amino]valeric acid 
5-[2-(feruloyl)ethen-1-yl]thalidomide 
5-amino-2-chlorobenzotrifluoride 
5-amino-4-chloro-2-(2,3-dihydroxyphenyl)pyridazin-3(2H)-one 
5-amino-5-(4-hydroxybenzyl)-6-(D-ribitylimino)-5,6-dihydrouracil 
5-aminosalicylaldehyde 
5-formylsalicylic acid 
5-hydroxy-2-(1'-hydroxyethyl)naphtho[2,3-b]furan-4,9-dione 
5-hydroxy-2-methylchromone-7-O-rutinoside 
5-hydroxy-6,7-dimethoxy-2-methylchromone 
5-hydroxy-6-methoxy-2-methylchromone-7-O-rutinoside 
5-hydroxybenzimidazole 
5-Hydroxyconiferaldehyde 
5-hydroxydiclofenac  
5-hydroxypropafenone 
5-methoxy-2-[[(1-methyl-2-benzimidazolyl)amino]methyl]phenol 
5-methoxysalicylaldehyde 
5-pyridoxolactone 
5-sulfosalicylic acid 
5alpha-androstane-3beta,6alpha,17beta-triol 
5alpha-androstane-3beta,7alpha,17beta-triol 
5beta-dihydrocortisol 
5E-7-oxozeaenol 
5Z-7-oxozeaenol 
6,7-Dihydro-4-(hydroxymethyl)-2-(p-hydroxyphenethyl)-7-methyl-5H-2-pyrindinium 
6,8-dihydroxy-3-(2-oxopropyl)-isocoumarin 
6-(2-amino-2-carboxyethyl)-4-hydroxybenzothiazole 
6-(alpha-D-glucosaminyl)-1D-myo-inositol 1,2-cyclic phosphate 
6-(hexylthio)-4-(4-hydroxyphenyl)-2-oxo-3,4-dihydro-1H-pyridine-5-carbonitrile 
6-[(1,2-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,3-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,4-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,5-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1-deoxy-D-ribityl)methyl]-5-[(1E)-3-oxobut-1-en-1-yl]uracil 
6-[(2-hydroxyethyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(3-hydroxypropyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(4-aminobenzyl)amino]-2,3,4,5-tetrahydropyridinium 
6-[(4-hydroxybutyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(5-hydroxypentyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-\{4-[hydroxy-(4-nitrophenoxy)phosphoryl]butyrylamino\}hexanoic acid 
6-deoxy-alpha-L-Talp2,3Ac2-(1->3)-beta-D-Glcp-yl group 
6-deoxy-alpha-L-Talp2Ac3Me-(1->3)-beta-D-Glcp-yl group 
6-Gingesulfonic acid 
6-HODE 
6-Hydroxyshogaol 
6-hydroxysphing-4E-enine 
6-linalyl-2-O,3-dimethylflaviolin 
6-methoxy indan-5-ol 
6-methyl-5-[(1E)-3-oxobut-1-en-1-yl]uracil 
6-O-(trans-4-coumaroyl)-alpha-D-glucopyranose 
6-O-(trans-4-coumaroyl)-beta-D-glucopyranose 
6-O-methyl-2-deprenylrheediaxanthone B 
6beta-hydroxyestrone 
6beta-hydroxyferruginol 
7,2'-dihydroxy-4'-methoxyisoflavan quinonemethide 
7,9,10-trihydroxy-3-(2-oxopropyl)-1H-benzo[g]isochromen-1-one 
7-(2-amino-2-carboxyethyl)-5-hydroxy-2H-1,4-benzothiazine-3-carboxylic acid 
7-(2-amino-2-carboxyethyl)-5-hydroxy-3,4-dihydro-2H-1,4-benzothiazin-3-one 
7-epi-zeaenol 
7-hydroxy-1,2,3,6,8-pentachlorodibenzofuran 
7-hydroxy-3,4-dichlorodibenzofuran 
7-hydroxy-5-hydroxymethyl-2H-benzo[1,4]thiazin-3-one 
7-hydroxysecoisolariciresinol 
7-methoxydeoxymorellin 
7-O-geranyl-2-O,3-dimethylflaviolin 
7-oxo-8,9-dihydroxy-4'-N-demethyl staurosporine 
7-oxohernangerine 
7alpha,26-dihydroxycholesterol +  
7alpha-hydroxyestradiol 
7beta,15alpha,22-trihydroxyhopane 
7S,8S-DiHOTrE 
8'-epi-cleomiscosin A 
8,13-DiHODE 
8,8a-epoxymorellic acid 
8-(2-hydroxyethyl)-6-methyllumazine 
8-benzyl-7-hydroxy-4,10-dioxo-1-phenyl-6-oxa-3,9-diaza-7-phosphatetradecan-14-oic acid 7-oxide 
8-demethyl-8-(2,3,4-O-trimethyl-alpha-L-rhamnosyl)tetracenomycin C 
8-demethyl-8-(2,3-O-dimethyl-alpha-L-rhamnosyl)tetracenomycin C 
8-demethyl-8-(2-O-methyl-alpha-L-rhamnosyl)tetracenomycin C 
8-demethyl-8-(alpha-L-rhamnosyl)tetracenomycin C 
8-demethyltetracenomycin C 
8-epi-ilicicolin H 
8-hydroxy-2-(1'-hydroxyethyl)naphtho-[2,3-b]-furan-4,9-dione 
8-hydroxy-3-chlorodibenzofuran 
8-Hydroxy-7-methoxy-4-methyl-5H-indeno[1,2-b]pyridin-5-one 
8-Methoxy-13-hydroxy-9,11-octadecadienoic acid 
8-OH-DPAT  
8R,11S-DiHODE 
8S-HODE 
9,10,18-trihydroxyoctadecanoic acid 
9,10-DiHODE 
9,10-dihydroxy-7-methoxy-3-(2-oxopropyl)-1H-benzo[g]isochromen-1-one 
9,12,13,TriHODE 
9,12,14-Octadecatrienoic acid 
9,14-DiHODE 
9-(4-hydroxyphenyl)-2,7-phenanthroline 
9-acetoxy-8,10-dehydrothymol 3-O-tiglate 
9-acetoxy-8,10-epoxythymol 3-O-tiglate 
9-deoxy-9-acetamido-alpha-N-acetylneuraminyl-(2->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
9-deoxy-9-acetamido-N-acetyl-alpha-neuraminic acid 
9-HOTE 
9-HpOTrE 
9-Hydroxy-12-oxo-10-octadecenoic acid 
9-hydroxy-2,6-dichlorodibenzofuran 
9-hydroxy-3,4-dichlorodibenzofuran 
9E,12Z,15Z-Octadecatrienoic acid 
[10]-Gingerdione 
[12]-Gingerol 
[3)-6-deoxy-alpha-L-Talp-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2,4Ac2-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2Ac-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2Me-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp4Ac2Me-(1->3)-beta-D-Glcp-(1->]n 
[3)-alpha-D-Galp-(1->3)-beta-D-Galf2Ac-(1->]n 
[3)-beta-D-Glcp-(1->]5 
[3)-beta-D-Glcp6,NAc2-(1->] residue 
[3)-beta-D-GlcpNAc-(1->4)-alpha-L-Rhap-(1->]n 
[4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->3)-beta-D-QuiNAc-(1->2)-beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->]n 
[4)-alpha-D-Galp-(1->3)-beta-D-Galf-(1->]n 
[4)-alpha-D-Glcp-(1->4)-alpha-D-Glcp-(1->4)-alpha-D-Glcp-(1->] residue 
[4)-beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->]n 
[4]-Gingerdiol 3,5-diacetate 
[6]-Gingerdiol 5-acetate 
[6]-Gingerdione 
[6]-Paradol 
[6]-Shogaol  
[7]-Paradol 
[8]-Gingerdione 
[8]-Paradol 
[8]-Paradyl acetate 
[8]-Shogaol 
[N-(4-cyanophenyl)-N'-(diphenylmethyl)guanidine]acetic acid  
[P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-] 
[P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-] 
[P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-] 
[P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-] 
[P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-] 
[P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-] 
\{4-[(1E)-3-(4-hydroxy-2-methoxyphenyl)prop-1-en-1-yl]phenyl\}oxidanesulfonic acid 
abyssinone I 
abyssinone V 
acenaphthoquinone  
acetic acid [2-(4-acetamido-6-phenyl-1,3,5-triazin-2-yl)phenyl] ester 
acetic acid [2-[2-acetyl-3-(4-methoxyphenyl)-3,4-dihydropyrazol-5-yl]phenyl] ester 
acetic acid [3-[3-(dimethylamino)-1-oxopropyl]-5-benzofuranyl] ester 
acetic acid [4-(1-acetyl-3,6-dihydro-2H-pyridin-4-yl)-2-methoxyphenyl] ester 
acetic acid [4-[(1-oxo-2-phenylethyl)amino]phenyl] ester 
acetic acid [4-[oxo-(2-phenylethylamino)methyl]phenyl] ester 
acetosyringone +  
Acetyleugenol  
aclacinomycin A  
aclacinomycin N 
aclacinomycin S 
aclacinomycin T 
aclacinomycin Y 
actinodaphnine 
acumitin 
adxanthromycin A 
adxanthromycin B 
aerugine 
afimoxifene  
aflatoxin B1 triol 
Agatharesinol acetonide 
agnestin A 
agnestin B 
agnuside 
agrochelin 
ajugaciliatin J 
ajugacumbin F 
alamarine 
alangimarckine 
alangimarine 
alangiside 
albuterol +   
alizarin blue 
aloin A +  
aloin B +  
alpha-(1->3)-galactobiose +  
alpha-(4-hydroxyphenyl)-N-tert-butylnitrone 
alpha-Artemisic acid  
alpha-cyano-4-hydroxycinnamic acid  
alpha-D-Abep-(1->3)-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-D-GlcNAc +  
alpha-D-Gal-(1->3)-beta-D-Gal-(1->3)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-galactosaminyl-(1->3)-[alpha-L-fucosyl-(1->2)]-beta-D-galactosyl derivative(1+) 
alpha-D-galactosyl-(1->2)-alpha-D-galactose 
alpha-D-galactosyl-(1->2)-beta-D-galactose +  
alpha-D-galactosyl-(1->2)-D-galactosyl group 
alpha-D-galactosyl-(1->3)-D-galactose +  
alpha-D-galactosyl-(1->3)-D-galactosyl group 
alpha-D-galactosyl-(1->4)-beta-D-galactosyl group +  
alpha-D-GalNAc-(1->2)-beta-D-Man-(1->4)-[beta-D-Glc-(1->2)]-alpha-D-Man-(1->5)-alpha-Kdo 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-GalNpAc-(1->3)-beta-D-GalpNAc 
alpha-D-Galp-(1->2)-[alpha-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp 
alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-[alpha-D-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-D-Galp +  
alpha-D-Galp-(1->3)-[alpha-D-Galp-(1->4)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group +  
alpha-D-Galp-(1->3)-beta-D-Manp 
alpha-D-Galp-(1->4)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-D-Galp-(1->4)-beta-D-GalpNAc-(1->3)-D-Galp 
alpha-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GalpN-(1->4)-alpha-D-GalpA-yl group 
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-yl group +  
alpha-D-GalpNAc-(1->3)-beta-D-Galp +  
alpha-D-GalpNAc-(1->4)-[alpha-D-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Glcp-(1->3)-alpha-L-Rhap 
alpha-D-Glcp-(1->6)-alpha-D-Glcp-(1->6)-beta-D-Glcp +  
alpha-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-D-GalpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN-4P-(1->6)-alpha-D-GlcN-1P 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc 
alpha-D-Man-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->3)-[alpha-D-Man-(1->2)-alpha-D-Man-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-mannose +  
alpha-D-mannose 6-phosphate +  
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-D-Manp +  
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-alpha-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc +  
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-D-Manp-(1->6)-beta-D-Manp +  
alpha-D-Manp6P-(1->3)-alpha-D-Manp-(1->3)-alpha-D-Manp-(1->3)-alpha-D-Manp-(1->2)-D-Manp +  
alpha-D-Rhap-(1->2)-alpha-D-Rhap-(1->3)-alpha-D-Rhap 
alpha-D-Rhap-(1->3)-alpha-D-Rhap 
alpha-D-Rhap-(1->3)-alpha-D-Rhap-(1->2)-alpha-D-Rhap 
alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo 
alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo 
alpha-D-Rhap4NFo-(1->3)-alpha-D-Rhap4NFo +  
alpha-D-Xylf5SMe-(1->4)-alpha-D-Manp-(1->2)-alpha-D-Manp-yl group +  
alpha-dimorphecolic acid 
alpha-KDN-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-D-Glcp 
alpha-KDN-(2->6)-beta-D-Galp-(1->4)-D-GlcpNAc 
alpha-Kdo-(2->8)-[alpha-Kdo-(2->4)]-alpha-Kdo 
alpha-L-Araf-(1->2)-beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
alpha-L-Fuc-(1->2)-[alpha-D-Gal-(1->3)]-beta-D-Gal +  
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-D-GlcNAc 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]GlcNAc-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc 
alpha-L-Fuc-(1->3)-[beta-D-Gal-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-L-Fuc-(1->3)-[beta-D-Gal-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-L-Fuc-(1->3)-beta-D-GalNAc-(1->4)-beta-D-GlcNAc-yl group 
alpha-L-fucose +  
alpha-L-fucosyl group +  
alpha-L-fucosyl-(1->2)-beta-D-galactosyl group 
alpha-L-fucosyl-(1->4)-N-acetyl-beta-D-glucosamine +  
alpha-L-Fucp-(1->2)-(1->3)-[alpha-D-Galp]-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[beta-D-Galp-(1->3)-alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-D-Glcp 
alpha-L-Fucp-(1->2)-[beta-D-Galp-(1->3)-alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-\{alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->6)\}-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-Glcp6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-GlcpNAc6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-Glcp +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-Glcp6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-[alpha-Neup5Ac-(2->3)-beta-D-Galp6S-(1->4)]-beta-D-GlcpNAc 
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->4)-[beta-D-Galp3S-(1->3)]-beta-D-GlcpNAc 
alpha-L-FucpNAc-(1->3)-D-FucpNAc 
alpha-L-rhamnopyranose +   
alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->2)-alpha-L-Rhap 
alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap 
alpha-L-Rhap-(1->3)-alpha-D-Galp 
alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc 
alpha-mangostin  
alpha-mycolic acid 
alpha-N-acetylneuraminyl-(2->3)-D-galactosyl group +  
alpha-N-acetylneuraminyl-(2->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->6)]-D-GalNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-Neu5Ac-(2->6)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-D-Gal +  
alpha-Neu9,NAc2-(2->6)-GalNAc 
alpha-Neup5,9Ac2-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5,9Ac2-(2->6)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->3)-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-D-GalpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-D-Galp-yl group 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[beta-D-Galp-(1->4)-beta-D-Glcp-(1->6)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1->6)]-2,5-anhydro-D-Man 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-D-GalpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp6S-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)]-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->6)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)]-D-GalpNAc +  
alpha-Neup5Ac-(2->6)-beta-D-Galp 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-GalpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac +  
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +   
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-[beta-D-GalpNAc-(1->4)]-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-yl group 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-beta-Neup5Ac 
alpha-Neup5Ac-(2->8)-beta-Neup5Ac 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-D-Glcp-yl group 
alpha-Neup5Gc-(2->6)-alpha-D-GalpNAc 
alpha-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-D-Glcp-yl group 
alpha-NeupNAc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S 
alpha-peltatin +  
alternariol +   
amaryllisine 
aminophenol +   
amodiaquine +   
amylmetacresol 
androst-5-ene-3beta,7alpha,17beta-triol 
angelitriol 
ankorine 
anolignan B 
ansaetherone 
anthracenol +   
anthramycin 
antimycin A  
antimycin A9 
apocynol 
argpyrimidine 
Arnebinol 
arugosin A (hydroxy-aldehyde form) 
AS-186a +  
AS-186b 
asiatic acid +   
asperentin-8-methyl ether 
aspergillusene A 
aspergillusone A 
aspergillusone B 
aspernidine A 
aspirin-triggered resolvin D2 
aspirin-triggered resolvin D3 
aspirin-triggered resolvin D4 
atrochrysone 
aurafuron A 
aureoquinone 
auricin 
avenanthramide B 
Avenoleic acid 
avilamycin A 
avilamycin A precursor 
bacteriohopanetetrol glucosamine 
bauhinoxepin I 
BE-54238A 
BE-54238B 
benzenediols +   
benzenetetrol +  
benzenetriol +   
benzoylhypaconine  
benzyl 2,5-dihydroxybenzoate 
benzyl cinnamate  
Benzyl salicylate  
benzylpenamaldate group 
benzylpenamidyl group 
benzylpenicanyl group 
benzylpenicillenyl group 
benzylpenicillin +   
benzylpenicilloic acid 
benzylpenicilloyl group +  
benzylpenilloic acid 
beryllium atom +   
beta-(1->3)-galactobiose +  
beta-cellobiose +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)]-alpha-D-Araf-(1->5)-alpha-D-Araf +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)]-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)]-alpha-D-Araf-(1->5)-alpha-D-Araf-yl group +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-alpha-D-Araf-(1->5)-alpha-D-Araf 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-alpha-D-Araf-(1->5)-alpha-D-Araf-yl group 
beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->3)-\{beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-[alpha-L-Fuc-(1->6)]-beta-D-GlcNAc 
beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->3)-\{beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
beta-D-Gal-(1->3)-[beta-D-GlcNAc-(1->6)]-D-GalNAc +  
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
beta-D-Gal-(1->4)-alpha-D-Glc-(1->3)-[alpha-D-GlcNAc-(1->2)]-alpha-L-Hep 
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-[beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->4)]-alpha-D-Man-(1->3)-[beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-D-GlcNAc +  
beta-D-galactose +   
beta-D-galactosyl-(1->3)-alpha-D-mannose 
beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl group 
beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl group 
beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl group 
beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl group +  
beta-D-Galf-(1->3)-alpha-D-Manp 
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-GalNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-D-Glc +  
beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
beta-D-GalNAc-(1->4)-beta-D-GalNAc-yl group 
beta-D-Galp-(1->2)-beta-D-Galp +  
beta-D-Galp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->3)-L-glycero-alpha-D-manno-Hepp-(1->5)-Kdo 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-yl group 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcpNAc +  
beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-D-GalpNAc +  
beta-D-Galp-(1->3)-[beta-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-\{alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcNAc-(1->6)\}-D-GalNAc +  
beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp-(1->3)-beta-D-GalpNAc +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-D-Glcp +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-yl group +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-D-Galp-yl group 
beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp +  
beta-D-Galp-(1->3)-D-GalpNAc +  
beta-D-Galp-(1->3)-D-GlcpNAc +  
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->6)-[beta-D-Galp-(1->3)]-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-D-Glcp +  
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp6S +  
beta-D-Galp-(1->4)-alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-alpha-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcNAcp-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->4)-beta-D-Glcp6S 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-\{alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-[alpha-D-Manp-(1->3)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-D-GalpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)-alpha-D-GalpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->3-)-alpha-D-GalpNAc 
beta-D-Galp3S-(1->3-)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp +  
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp6S 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc6S +  
beta-D-Galp3S-(1->4)-beta-D-Glcp 
beta-D-Galp3S-(1->4)-beta-D-Glcp6S 
beta-D-Galp3S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-beta-D-GlcpNAc6S 
beta-D-Galp4S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp6S-(1->4)-beta-D-Glcp 
beta-D-Galp6S-(1->4)-beta-D-Glcp6S 
beta-D-Galp6S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp6S-(1->4)-beta-D-GlcpNAc6S 
beta-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp 
beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->3)-alpha-D-GalpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-D-Galp 
beta-D-GalpNAc-(1->4)-[alpha-Neup5Gc-(2->3)]-beta-D-Galp +  
beta-D-GalpNAc-(1->4)-[alpha-Neup5Gc-(2->3)]-beta-D-Galp-(1->4)-R group +  
beta-D-GalpNAc-(1->4)-alpha-D-GalpNAc 
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
beta-D-GalpNAc-(1->4)-D-GlcpNAc +  
beta-D-GlcNAc-(1->4)-MDP-Lys(L18) 
beta-D-Glcp(1->6)-alpha-D-GlcpNAc-(1->3)-alpha-L-QuipNAc-(1->3)-beta-D-GlcpNAc 
beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-GlcpO[CH2]5CO2Me 
beta-D-Glcp-(1->3)-beta-D-GlcpA-(1->4)-beta-D-Glcp 
beta-D-Glcp-(1->6)-beta-D-Glcp +  
beta-D-GlcpA-(1->3)-beta-D-Galp +  
beta-D-GlcpA-(1->3)-beta-D-GlcpNAc 
beta-D-GlcpA-(1->6)-beta-D-Galp 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->4)]-[beta-D-GlcpNAc-(1->6)]-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-alpha-D-GalpNAc +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-D-Manp +  
beta-D-GlcpNAc-(1->4)-[beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc +  
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->6)-alpha-D-GalpNAc +  
beta-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc6S-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-glucose +   
beta-D-glucose 6-phosphate 
beta-D-glucosyl-N-(octadecanoyl)sphinganine 
beta-D-mannose +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-alpha-D-Manp +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-beta-D-Manp +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-D-Manp +  
beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->3)-beta-D-QuiNAc-yl group 
beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-yl group 
beta-D-Tyvp-(1->3)-beta-D-GalpN-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpN6,OMe2 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc6,OMe2 
beta-D-Tyvp2Me-(1->3)-beta-D-GalpN6,OMe2 
beta-D-Tyvp2Me-(1->3)-beta-D-GalpNAc-OMe 
beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-R group +  
beta-isosalicin 
beta-L-fucosyl-(1->3)-N-acetyl-beta-D-glucosamine 
beta-melibiose 
beta-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-NeupNAc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
Beta-Orcinol 
beta-peltatin 
BF 4 
BF 5 
BF 6 
bidenlignaside A 
biliatresone 
Bis(2-methylpropanoyloxy)-9,10-epoxy-p-mentha-1,3,5-triene 
bisphenol +   
bisphenol A sulfate 
BMS-192548 
bracteatin +  
brasilicardin A 
brasiliquinone A 
brasiliquinone C 
brazilein  
brevipolide A 
brevipolide B 
bromophenol blue  
bromophycolide A 
bromosulfophthalein  
Broussonin C 
bruceanol D 
bruceanol E 
bruceanol F 
bruceolline H 
bruceolline I 
brugunin A 
buddlenol B 
bulbocapnine +  
bullatantriol 
Bussealin A 
Bussealin B 
Bussealin C 
Butyl salicylate 
calcipotriol +   
calcitriol +   
Calcium linoleate 
callipeltin A 
capsiate  
carvacrol  
cassiarin A 
cassiaside C2 
catechol beta-D-glucuronide 
cathestatin B 
CAY10397 
CD437 +   
cefatrizine 
celesticetin 
chaetochromin A 
chaetochromin B 
chaetochromin C 
chaetochromin D 
chaetoxanthone A 
chaetoxanthone B 
chaetoxanthone C 
chavicol +   
chloropeptin I 
chondramide A +  
chondramide B 
chondramide C +  
chondramide D 
chondrochloren A 
chondrochloren B 
chroman-6-ol +   
chrysopine +  
cichorine 
ciguatoxin ABC ring fragment 
ciguatoxin ABCDE ring fragment 
ciguatoxin JKLM ring fragment 
CII259-273 
cis-coniferyl alcohol 
Citreovirenone 
citrifolinoside 
cleomiscosin A 
clethroidoside B 
cochinchinone C 
cochinchinone G 
cochinchinoxanthone 
cochinensoxanthone 
coelenterazine h dioxetanone 
colterol 
comazaphilone A 
coniferyl acetate 
coniferyl ester +  
Corchorifatty acid D 
cordyheptapeptide A 
CPA(18:2(9Z,12Z)/0:0) 
cresatin 
crosatoside B 
cryogenine 
Cuelure 
cuevaene A 
curamycin A 
curtisian A 
curtisian B 
curtisian C 
curtisian D 
cyclodepsipeptide 2 
cyclodopa 5-beta-D-glucoside 
cylindol A 
D-alpha-D-Hepp-(1->6)-beta-D-Glcp 
D-glucosyl salicylate +  
D-xylo-phytosphingosine +  
daidzein 7-(6-O-acetyl-beta-D-glucoside) 
danielone 
dauricine +   
debromoaplysiatoxin 
debromolaurinterol 
decarboxysuprofen 
decarboxytiaprofenic acid 
decussatin 
deferasirox  
dehydrocitreoisocoumarin 
dehydrodiconiferyl dibenzoate 
dehydrojacoline 
dehydroluciferin 
Delta(9)-tetrahydrocannabinol +   
demethoxyshogaol 
deoxyfuconojirimycin 
deoxyherqueinone 
deoxynivalenol +   
dezocine 
DG(14:0/18:4(6Z,9Z,12Z,15Z)/0:0) 
DG(15:0/0:0/18:3n3) 
DG(15:0/0:0/18:4n3) 
DG(15:0/18:2(9Z,12Z)/0:0) 
DG(15:0/18:3(6Z,9Z,12Z)/0:0) 
DG(15:0/18:3(9Z,12Z,15Z)/0:0) 
DG(15:0/18:4(6Z,9Z,12Z,15Z)/0:0) 
DG(15:1(9Z)/18:3(9Z,12Z,15Z)/0:0)[iso2] 
DG(16:0/0:0/18:3n3) 
DG(18:3(9Z,12Z,15Z)/15:0/0:0) 
DG(18:4(6Z,9Z,12Z,15Z)/15:0/0:0) 
diazepinomicin 
dibenzodioxicin 
dichotomide V 
dichotomide VI 
dichotomine E 
dienestrol  
differentiation-inducing factor +  
Dig-Cy5 
digoxin +   
dihydro sinapyl alcohol 
Dihydrocapsiate 
Dihydroconiferyl aldehyde 
Dihydroeugenol 
dihydrogeodin 
dihydropyriculol 
Dihydroxy-octadecadienoic acid 
Dihydroxy-octadecatrienoate 
dimethyl 2,2'-(9,9',10,10'-tetrahydroxy-7,7'-dimethoxy-1,1'-dioxo-3,3',4,4'-tetrahydro-[6,6'-binaphtho[2,3-c]pyran]-3,3'-diyl)diacetate +  
dimetofrine 
Dinorcapsaicin 
Dinoseb acetate 
Dinoterb 
diorcinol 
Dioxooctadecadienoic acid 
Dnp-Asn-Gln 
Dnp-Gln 
Dnp-Nor-Gln 
Dnp-Sar-Gln 
Dnp-Thr-Gln 
Dnp-Trp-Gln 
dopamine 3-O-sulfate 
dopamine 4-O-sulfate 
doxorubicinol 
dT4 
dT6 
dT8 
dTT(6-4)TT 
dutomycin 
E,E-13-HpODE 
E,E-9-HpODE 
ecgonine benzoate  
edrophonium +   
ehretianone 
ekatetrone 
Elaidolinolenic acid 
elloramycin A 
emericellin 
emodin anthrone +   
endocannabinoid +   
endocrocin 
ENPAVHFFKNIVTPRTP 
ENPVVAFFKNIVTPRTP 
ENPVVHFFFNIVTPRTP 
ENPVVHFFKNIVTPRTP 
ENPVVHFFYNIVTPRTP 
Epi-4'-hydroxyjasmonic acid 
erdasporine A 
erybraedin A 
erythrosin 
eseroline +  
espicufolin 
estra-1,3,5(10)-trien-3-ol  
estriol 16-O-(beta-D-glucuronide)  
estriol 3-O-(beta-D-glucuronide)  
etamivan 
ether lipid +   
ethyl 4-(3-hydroxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate +  
ethyl dihydrogen phosphate +   
ethyl hydrogen phosphate(1-) 
ethyl N-acetyl-L-tyrosinate 
ethyl N-benzoyl-L-tyrosinate 
ethyl phosphate(2-) 
ethyl vanillin  
Ethylhexyl salicylate 
ethylzingerone 
Etilefrine hydrochloride (TN) 
Etrogol 
eugenin 
eugenol +   
euscaphic acid 
euxanthone 
F-9775A 
F-9775B 
F390B 
F390C 
fatty acid +   
fatty acid anion +   
fatty acid ester +   
fatty acyl-CoA(4-) +  
fatty acylcarnitine 
fatty alcohol +   
fatty amide +   
fenadiazole 
fenhexamid  
ferruginol +   
fertaric acid +  
ferulic acids +   
feruloylacetic acid 
Feruperine 
fidaxomicin  
flavasperone 
flavokawain B  
flucofuron 
fluorescein (acid form) +   
fluorescein-DNP hapten 
FluoZin-3 
fomesafen  
fonsecin +  
fonsecin B 
foresticine 
formobactin 
forskolin +   
fostriecin  
FR901469 
fruticoside A 
ftivazide 
fukanefuromarin A 
fukanefuromarin B 
fukanefuromarin C 
fukanefuromarin D 
fumisoquin A 
fumisoquin B 
fumonisin B1  
fumonisin B6 
funalenone 
futokadsurin A 
G a G b G 
G b G AcO 
G b S 
gamma-12,13-DiHODE 
gamma-6,7-DiHODE 
gamma-9,10-DiHODE 
gamma-Glu-Tyr 
gamma-mangostin  
gentisyl alcohol 
gigantrionenin 
gilvusmycin 
Ginsenoyne A linoleate 
globosuxanthone A 
globosuxanthone B 
globosuxanthone D 
glyceollin IV 
glycerol +   
glycerolipid +   
glycycarpan 
glycyrrhizol B 
glyoxal-lysine dimer 
gnidilatimonoein 
gougerotin 
graminone B 
griffithane D 
GTRI-02 
Guaiacol acetate 
guaiacols +   
guaiacyl chalcone 
guaiacylglycerol beta-coniferyl ether 
Guaicyl phenylacetate 
guattegaumerine 
guignardone N 
gutolactone 
Gyrocyanin 
H b G AcO 
halophenol +   
hematein 
heptane-1,2,3-triol +  
Hexahydro-6,7-dihydroxy-5-(hydroxymethyl)-3-(2-hydroxyphenyl)-2H-pyrano[2,3-d]oxazol-2-one 
hispidin  
hokbusine A 
Homocapsaicin 
Homodihydrocapsaicin 
Homovanillic acid sulfate 
hopane-6beta,7beta,22-triol 
hordatine A 
hordatine B 
HS44 
Htris +   
humulone 
hydramacrophyllol A 
hydramacrophyllol B 
hydrangenol +  
hydrangenol 4'-O-beta-D-apiofuranosyl-(1->6)-beta-D-glucopyranoside 
hydrangenol 4'-O-beta-D-glucopyranoside 
hydrangenol 8-O-beta-D-glucopyranoside 
Hydroperoxy-octadecatrienoic acid 
hydroxy-cannabidiol +  
hydroxyanthraquinones +   
hydroxyaurone +   
hydroxybenzaldehyde +   
hydroxybenzo[c]phenanthrene +  
hydroxybenzoic acid +   
hydroxybenzophenone +   
hydroxybenzoyl-CoA +  
hydroxybenzyl alcohol +   
hydroxybiphenyls +   
hydroxychrysene +   
hydroxyfenbendazole 
hydroxyisoflavanone +   
hydroxylipid +  
Hydroxymethoxyphenylcarboxylic acid-O-sulphate 
hydroxynaphthalene +   
Hydroxyphenylethanol diacetate 
hydroxysafflor yellow A  
hydroxytetracaine 
hydroxytoluene +   
hyperaspidinol A 
hypothemycin 
ibopamine 
ilicicolin H +  
indan-5-ol +  
inumakal 
inumakoic acid 
iodothyronine +   
Ioxynil octanoate 
isoacetovanillone 
Isoamyl salicylate 
isobrucein A 
isobutrin 
Isobutyl salicylate 
Isoeugenol phenylacetate 
isohomovanillic acid 
isonocardicin A 
isonocardicin C 
isopentenyl diphosphate  
isopentenyl diphosphate(3-) 
isoprenoid +   
isopropyl salicylate +   
isotalatizidine 
ivacaftor +   
ixerochinolide 
jacoline +  
jacoline N-oxide 
jaspamide  
jasplakinolide D 
jasplakinolide Q 
jerantinine A +  
jerantinine B 
jerantinine C +  
jerantinine D 
jerantinine E 
jerantinine F 
JTE-607 free base 
juglanin A 
juglanin B 
julichrome Q6 +  
kanzonol P 
karalicin 
keto mycolic acid 
kinanthraquinone 
kinanthraquinone B +  
kinocoumarin 
kitastatin 1 
kweichowenol B 
L-glycero-alpha-D-manno-Hepp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->3)-L-glycero-alpha-D-manno-Hepp-(1->5)-alpha-Kdo 
L-idopyranose 6-monomycolate 
L-m-tyrosine 
L-Metanephrine 
L-Normetanephrine 
L-Thr-(N->6)-alpha-D-Galp6d3OAc-(1->3)-beta-D-GalpNAc 
L-tyrosinal +   
L-tyrosyl ester +  
labd-13Z-ene-9,15,16-triol 
laccaridione A 
laccaridione B 
lactonamycin 
lactucopicrin 
lactucopicrin 15-oxalate 
lanigerol 
latanoprost  
laudanine +  
laurebiphenyl 
laurinterol +  
laurolistine +  
legioliulin 
lespeflorin C3 
lespeflorin G10 
lespeflorin G2 
lespeflorin G3 
lespeflorin G5 
lespeflorin G8 
lespeflorin H2 
lichexanthone 
lignin cw compound-1029 
lignin cw compound-116 
lignin cw compound-126 
lignin cw compound-132 
lignin cw compound-134 
lignin cw compound-135 
lignin cw compound-138 
lignin cw compound-195 
lignin cw compound-2007 
lignin cw compound-2015 
lignin cw compound-202 
lignin cw compound-2026 
lignin cw compound-2033 
lignin cw compound-2034 
lignin cw compound-2050 
lignin cw compound-2063 
lignin cw compound-2064 
lignin cw compound-214 
lignin cw compound-217 
lignin cw compound-218 
lignin cw compound-280 
lignin cw compound-285 
lignin cw compound-290 
lignin cw compound-293 
lignin cw compound-294 
lignin cw compound-3010 
lignin cw compound-3031 
lignin cw compound-3034 
lignin cw compound-3035 
lignin cw compound-3036 
lignin cw compound-3037 
lignin cw compound-3038 
lignin cw compound-3039 
lignin cw compound-3040 
lignin cw compound-3041 
lignin cw compound-3053 
lignin cw compound-3057 
lignin cw compound-3058 
lignin cw compound-3062 
lignin cw compound-50 
lignin cw compound-99 
ligstroside 
lindechunine A 
Linoleic acid(d4) 
lipid hydroperoxide +   
lipid micelle 
lipopeptide +   
liposaccharide +   
LLP-3 
lobarin 
LSM-20628 
LSM-28414 
luzonial A 
luzonial B 
luzonidial B 
LY 117018  
lyratol D 
Lys-GalA 
Lys-Thr-Trp-Gly-Lys-Asn-Leu-Val-Phe 
m-Eugenol 
m-hydroxyhippuric acid 
maackiain +  
maackiapterocarpan A 
macluraxanthone B 
macluraxanthone C 
maculosin 
Mangiferic acid 
marinacarboline B 
marinobufagenin  
Mayolene-16 
Mayolene-18 
Medinoterb acetate 
melleolide F 
menthyl salicylate 
mesalamine  
meso-3,3'-didemethoxynectandrin B 
meta-hydroxyphenylhydracrylic acid 
metacetamol  
metachromin T 
Metasequirin E 
Metasequirin F 
methacholine +   
methoxy mycolic acid 
methyl (2E)-3-(3-hydroxyphenyl)acrylate 
methyl 13-butylperoxy-9,11-octadecadienoate 
Methyl 2-(10-heptadecenyl)-6-hydroxybenzoate 
methyl 2-(4-hydroxyphenyl)acetate 
methyl 2-[(3S)-9,10-dihydroxy-7-methoxy-1-oxo-1H,3H,4H-naphtho[2,3-c]pyran-3-yl]acetate 
methyl 3-(4-hydroxyphenyl)propionate 
Methyl 3-hydroxybenzoate 
methyl 4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-2-O-methyl-alpha-D-mannopyranoside 
Methyl 5-hydroxy-2-benzimidazole carbamate 
methyl 8-hydroxy-6-methyl-9-oxo-9H-xanthene-1-carboxylate 
methyl brevifolincarboxylate 
methyl dihydrogen phosphate  
Methyl dihydrojasmonate 
methyl nonanoate 
methyl phosphate(2-) 
methyl syringate 
methyl vanillate +  
methylglyoxal-lysine dimer 
Metoprolol succinate 
Metoprolol tartrate 
MG(0:0/18:3(6Z,9Z,12Z)/0:0) 
MG(0:0/18:4(6Z,9Z,12Z,15Z)/0:0) 
MG(18:3(6Z,9Z,12Z)/0:0/0:0) 
microdiplodiasol 
Microlenin 
mollicellin B 
mollicellin L 
mollicellin M 
monapinone A 
monapinone E +  
monoanhydrobacterioruberin 
monodictysin B 
monodictysin C 
monothioglycerolipid +  
morellic acid +  
morellin +  
mucrolidin 
mupirocin 
mycophenolate mofetil  
mycophenolic acid +   
mycophenolic acid O-acyl-glucuronide 
Myricanone 
N'-(3-hydroxyphenyl)-N,N-dimethylformamidine +   
N(2)-(5'-phosphopyridoxyl)-L-lysine 
N(6)-acetyl-N(2)-(5'-phosphonatopyridoxyl)-L-lysinate(2-) 
N(6)-acetyl-N(2)-(5'-phosphopyridoxyl)-L-lysine 
N(6)-dansyl-L-lysine 
N(6)-Dnp-Lys-NH2 
N,N-dimethyltetradecanamide 
N,O-(Dnp)2-Tyr-Gln 
N,O-didesmethylvenlafaxine 
N-(2,3-dihydroxybenzoyl)serine 
N-(4-hydroxyphenyl)-N-methyl-N'-thiophen-2-ylsulfonylbenzenecarboximidamide 
N-(4-nitrophenyl)-3-oxovalidamine 
N-(5'-phosphonatopyridoxyl)-D-alaninate(2-) 
N-(5'-phosphonatopyridoxyl)-L-alaninate(2-) 
N-(5'-phosphopyridoxyl)-D-alanine 
N-(5'-phosphopyridoxyl)-L-alanine 
N-(p-hydroxyphenyl)glycine 
N-(p-nitrophenylphosphobutanoyl)glycine 
N-(trans-4'-nitro-4-stilbenyl)-N-methyl-5-aminopentanoic acid 
N-[(3R,4R,5S,6R)-5-[(2S,3R,4R,5S,6R)-3-Acetamido-5-[(2S,3S,4S,5R,6R)-4-[(2S,3S,4S,5S,6R)-3-[(2S,3R,4R,5S,6R)-3-acetamido-5-[(2S,3R,4R,5R,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-[[(2S,3S,4S,5S,6R)-3-[(2S,3R,4R,5S,6R)-3-acetamido-5-[(2S,3R,4R,5R,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxymethyl]-3,5-dihydroxyoxan-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-2,4-dihydroxy-6-(hydroxymethyl)oxan-3-yl]acetamide 
N-[(4-hydroxy-2-iodo-5-methoxyphenyl)methyl]nonanamide 
N-[(4-hydroxy-3-methoxyphenyl)methyl]-8-methyl-6-nonenamide 
N-[(4-hydroxy-3-methoxyphenyl)methyl]-9-octadecenamide 
N-[(4-hydroxy-3-methoxyphenyl)methyl]eicosa-5,8,11,14-tetraenamide 
N-[(4-Hydroxy-3-methoxyphenyl)methyl]octanamide 
N-[2-hydroxy-5-(1-hydroxy-2-\{[1-(4-methoxyphenyl)propan-2-yl]amino\}ethyl)phenyl]formamide +  
N-[4-(4-nitrophenylphospho)butanoyl]-D-alanine 
N-[4-(4-nitrophenylphospho)butanoyl]-L-alanine 
N-\{5-chloro-4-[(4-chlorophenyl)(cyano)methyl]-2-methylphenyl\}-2-hydroxy-3,5-diiodobenzamide +   
N-\{beta-D-Man-(1->2)-beta-D-Man-(1->2)-beta-D-ManO[CH2]3S[CH2]2NHC(O)[CH2O]4C(O)[CH2]2S[CH2]2C(O)\}-YGKDVKDLFDYAQE-NH-[CH2O]3[CH2]2C(O)NHC(CO2H)[CH2]4N3 +  
N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 
N-acetyl-alpha-D-galactosamine +  
N-acetyl-alpha-D-galactosaminyl group +  
N-acetyl-alpha-D-galactosaminyl-(1->3)-[alpha-L-fucosyl-(1->2)]-beta-D-galactose derivative 
N-acetyl-alpha-D-galactosaminyl-L-serine residue 
N-acetyl-alpha-neuraminic acid +  
N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucose +  
N-acetyl-alpha-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosamine 
N-acetyl-beta-D-galactosamine +  
N-acetyl-beta-D-galactosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl group 
N-acetyl-beta-D-glucosamine +   
N-acetyl-beta-D-glucosaminyl-(1->4)-N-acetyl-beta-D-glucosamine +  
N-acetyl-beta-neuraminic acid +   
N-acetyl-beta-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosamine 
N-acetylneuraminyl group 
N-acetylserotonin  
N-acetyltyrosine +  
N-arachidonoyl-2-oxoserotonin 
N-arachidonoylserotonin 
N-Dihydroferuloyltyramine 
N-feruloylserotonin 
N-glycoloyl-beta-D-glucosamine 
N-methylmesoporphyrin 
N-methylserotonin 
N-octanoylisoglobotriaosyl ceramide 
naloxegol 
nelfinavir  
neoline 
neopentyl glycosyl pyrrole 
neosartoricin 
neotriptophenolide 
nickel atom +   
nidulalin A 
nigerloxin 
nigerone 
nitrophenol +   
nocardicin C 
nocardione A 
Nocazoline A 
non-polar lipid 
nonivamide  
nor-toralactone +  
Norcapsaicin 
Nordihydrocapsaicin  
Nordihydrocapsiate 
norfenefrine  
Norfenefrine hydrochloride 
norrubrofusarin 
novclobiocin 109 
novobiocin  
NS 1619  
NU 1025  
O-(2-aminopropyl)-O'-(2-methyoxyethyl)octa(propylene glycol) 
O-[N-acetyl-alpha-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosaminyl]-L-serine residue 
O-desmethylvenlafaxine 
O-hydroxy(phenyl)phosphinoyl ecgonine methyl ester 
O-sulfate-6-hydroxydihydroferulic acid 
obochalcolactone 
obtusafuran 
Obtustyrene 
ochracenomicin A 
ochratoxin alpha +   
ochrindole A 
ochrocarpin A 
ochrocarpin B 
ochrocarpin C 
ochrocarpin D 
ochrocarpin E 
ochrocarpin F 
ochrocarpin G 
octadeca-6,9,12-trienoic acid 
octadeca-9,12,15-trienoic acid 
octadeca-9,12-dienoic acid 
Octadecadienoic acid, methyl ester 
odoratol +  
Oleacein  
oleandolide +   
oleocanthal 
oleuropein (aldehyde form) 
olodaterol  
omega-hydroxy,(omega-1)-methyl-branched lipid 
onetine +  
Oplophorus luciferin +  
oregon green 488 
ornidazole  
Oryzarol 
oviedomycin 
oxidized Renilla luciferin 
Oxo-dihydroxy-octadecadienoic acid 
oxonitine 
oxyacanthine 
oxymetazoline  
oxyphenbutazone +   
oxyphenisatine acetate 
p-coumaroylagmatine +  
p-coumaryl glycerol 
p-coutaric acid +  
p-HPEA-EDA 
p-hydroxybenzyl alcohol  
p-Hydroxybenzyl-alcohol-diacetate 
p-Hydroxyfelbamate 
p-hydroxymexiletine 
p-Hydroxyphenylacetothiohydroximate 
p-hydroxyphenylbut-3-ene-2-one 
p-Hydroxyprimidone 
p-methoxyphenol 
p-nitrobenzyl glutaryl glycinic acid 
p-nitrophenylphosphocholine 
p-Tolyl isobutyrate 
p-Tolyl phenylacetate 
P. aeruginosa serotype O11 O-specific polysaccharide 
Paecilocin B, (rel)- 
Paecilocin C, (rel)- 
Paeonol  
palmitoleyl alcohol +  
palmityl acetate 
Panaxydol linoleate 
pannarin 
paracetamol +   
parfumine 
penipanoid A 
penipanoid B 
penipanoid C 
perquinoline A 
perquinoline B 
Pestalospirane A 
Pestalospirane B 
PFI-3 
Phe(4-NO2)-Gln 
phenanthrol +   
Phenethyl salicylate  
phenol +   
phenol red  
phenolic donor 
phenolic phthiocerol +  
A lipid derived from phthiocerol, having a 4-hydroxyphenyl substituent at the 29-position.
phenolphthalein  
phenoxyphenol +   
phentolamine  
phenyl salicylate  
phenylephrine  
Phenyliodoundecynoate 
phomoxanthone A 
phomoxanthone B 
phosphatoquinone A 
phosphatoquinone B 
phosphocholine +   
phospholipid +   
phosphonolipid +  
phoyunbene D 
phthalaldehyde  
phthiocerol A +  
phthiocerol dimycocerosate 
phytantriol 
phytosphingosine +   
PI-103 
pisonin A 
pisonin D 
pisonin E 
plakortolide M 
plakortolide N 
plakortolide S 
plakortone N 
platensimycin B4 +  
platensimycin B4 methyl ester 
pleosporone 
plumbagin  
PM-94128 
polygonimitin B 
polyketomycin 
polyphenol +   
Porrigenic acid 
premycofactocin +  
premycofactocinol 
prenyl diphosphate  
prenyl diphosphate(3-) 
prenylcandidusin B 
prenylcandidusin C 
prenylterphenyllin 
prenylterphenyllin B 
Prohydrojasmon 
promysalin 
propofol +   
propyl dihydroferulate 
propylparaben  
protoaphin aglucone 
protoasukamycin +  
psilocin +  
pterolinus C 
pterolinus D 
pterolinus E 
pterolinus H 
pterolinus I 
Pulicatin A 
Pulicatin B 
Pulvinatal 
purpurogallin  
pyochelin +  
pyriculariol 
pyriculol +  
pyrocatechol sulfate 
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 
quassimarin 
quininib 
quinol sulfate 
quinolobactin 
radicicol  
raloxifene  
raspberry ketone  
rataniaphenol I 
rataniaphenol II 
rataniaphenol III 
ravidomycin 
Reactive Red 6 hapten copper complex 
rel-(+)-(1S,4R,8S,10R)-1,4,8-trihydroxycembra-2E,6E,11Z-trien-20,10-olide 
rel-(+)-(1S,4S,7R,10R)-1,4,7-trihydroxycembra-2E,8-(19),11Z-trien-20,10-olide 
rel-(+)-(7'S,8S,8'S)-4,4'-dihydroxy-3',5,5'-trimethoxy-2,7'-cyclolignan 
rel-(-)-(1S,4S,7S,10R)-1,4,7-trihydroxycembra-2E,8-(19),11Z-trien-20,10-olide 
rel-(-)-(7S,7'R,8S,8'R)-4,4'-dihydroxy-3,3',5'-trimethoxy-7,7'-epoxylignan 
rel-2alpha,3alpha,23-trihydroxy-19-oxo-18,19-seco-urs-11,13(18)-dien-28-oic acid 
rel-2alpha,3beta,23-trihydroxy-12,17-dien-28-norursane 
rel-2alpha,3beta,23-trihydroxy-19-oxo-18,19-seco-12,17-dien-28-norursane 
rel-hopan-27-al-6beta,11alpha,22-triol 
Renilla luciferin +  
resiniferatoxin  
resolvin D1  
resolvin D2  
resolvin D3 
resolvin D4 
resolvin E1 
resorcinol monoacetate 
resorcinol sulfate 
respirantin 
rhamnacene +  
rhuscholide A 
robustaside D 
robustaside E 
robustaside G 
robustine 
roducitabine 
rose bengal free acid 
rubiarbonol A 3-O-beta-D-glucopyranosyl-(1->2)-beta-D-glucopyranoside 
rubiarbonol A 7-acetate 
rubiarbonol G 
rubiarbonol L 
rubiarbonone B 
rubimaillin  
rubrofusarin +  
rubrofusarin B 
S a S b S 
S b S AcO 
S-(5-acetamido-2-hydroxyphenyl)-N-acetyl-L-cysteine 
S-(5-acetamido-2-hydroxyphenyl)cysteine 
S-adenosyl-L-homocysteine  
Saccharolipids +   
Salicifoline 
salicylamide +   
salicylhydroxamic acid  
salsalate  
salvin A 
salvin B 
samaderine C 
samaderine X 
samaderine Y 
sandwicensin 
sarpagine +  
SB 415286  
SB-202190 
sch 54445 
schweinfurthin H 
scytalone 
secnidazole 
semiviriditoxin +  
sennosides +  
Sequosempervirin D 
Ser-Tyr 
serotonin +   
Sesamolinol 
shamixanthone 
siamenol 
sibiromycin 
simalikalactone D 
simulanol 
sinapate ester 
sinapic acid +   
sinapyl alcohol +   
Sinapyl alcohol diacetate 
SN-38 +   
SN-38 carboxylic acid 
sodium amoxicilloyl group 
sojagol 
Solorinin 
Sorbicillin 
sorocenol G 
sphingolipid +   
SR12813 
Stachyline C 
staphyloxanthin 
stemphyperylenol 
sterebin L 
steroid +   
stigmastane-3beta,5alpha,6beta-triol 
stigmatellin A  
stilben-4-ol +   
stilbenol +   
strongylin A 
SU1498 
subereaphenol D 
sugiol +  
sulcofuron 
sulcofuron-sodium 
sulfamethoxazole +   
sulfolipid +   
sulochrin +  
swerchirin 
sydowinin A 
Sylvopinol 
synephrine +   
syringic acid +   
syringyl alcohol +  
syringylglycerol beta-guaiacyl ether 
SZL-P1-41 
talaroconvolutin A 
TAN-1612 
Taxoleic acid 
teniposide  
termilignan B 
terphenyllin +  
terprenin 
TES +  
tetracenomycin D3 +  
tetracenomycin F1 +  
tetradecaethylene glycol 
tetradecaphytosphingosine +  
tetrangomycin +  
tetrangulol +  
tetraphen-1-ol 
Thellungianin G 
thiomarinol G 
threo-1-(4-Hydroxyphenyl)-1,2,3-propanetriol 
thymol +   
thyronine +   
tilimycin 
tilivalline 
tinyatoxin 
TMC-135A 
TMC-135B 
TMC-52A 
TMC-52B 
TMC-95A 
TMC-95B 
TMC-95C 
TMC-95D 
Tnp-Gln 
Tolylacetate 
tomaymycin +  
tomelukast  
TOP-53 
topopyrone A 
topopyrone B 
topopyrone C 
topopyrone D 
toralactone 
torkinib 
Torrubiellone D 
trans-2-coumaric acid 
trans-4-(dimethylphenylsilyl)-N-methylpiperidine N-oxide 
trans-anol 
trans-coumaryl acetate 
trans-p-coumaryl alcohol +  
trans-sinapyl actetate 
tricine +  
triclosan  
triethanolamine  
trifloroside 
trihydroxyicosatrienoic acid +  
trilobacin 
trimellitic anhydride  
triptobenzene A 
triptobenzene H 
triptohypol B 
triptonolide 
triptonoterpene 
triptonoterpene methyl ether 
triptonoterpenol 
triptriolide 
tris +  
Trolox 
Trp-Gly-Ile-His-His 
Trp-Tyr-Gly-Tyr-His-His 
tubulosine 
turmeronol 
TX-1875 
tyramines +   
tyrphostin AG 825 
tyrvalin 
urolithin A 3-O-glucuronide 
urolithin A 8-O-glucuronide 
ustilaginoidin A 
validone 7-phosphate 
valienone 7-phosphate 
vanchrobactin 
vanillin +   
Vanillin 1,2-butylene glycol acetal 
Vanillin a G b CA 
Vanillin isobutyrate 
vanilloylacetic acid +  
vanillylmandelic acid  
vanitiolide 
variecolorquinone A 
variecolorquinone B 
variecoxanthone C 
veratryl glycerol +  
vernakalant 
vieillardixanthone 
vilanterol +  
virensol A 
viscumneoside VI 
Watasemycin A 
Watasemycin B 
Xenognosin A 
xibornol 
yahyaxanthone 
yanuthone H 
yanuthone J 
yersiniabactin 
YWA1 
zeaenol 
zingerone  
zucapsaicin 

Synonyms
Exact Synonyms: (3S,4R,9R,11S)-29-(4-hydroxyphenyl)-3-methoxy-4-methylnonacosane-9,11-diol
Related Synonyms: Formula=C37H68O4 ;   InChI=1S/C37H68O4/c1-4-37(41-3)32(2)23-21-22-26-36(40)31-35(39)25-20-18-16-14-12-10-8-6-5-7-9-11-13-15-17-19-24-33-27-29-34(38)30-28-33/h27-30,32,35-40H,4-26,31H2,1-3H3/t32-,35+,36-,37+/m1/s1 ;   InChIKey=GDIGGEUWHKJEEK-IIVMXCGDSA-N ;   SMILES=CC[C@H](OC)[C@H](C)CCCC[C@@H](O)C[C@@H](O)CCCCCCCCCCCCCCCCCCc1ccc(O)cc1
Xrefs: PMID:6193065

paths to the root