Send us a Message



Submit Data |  Help |  Video Tutorials |  News |  Publications |  Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
1-O-(alpha-D-galactosyl)-N-hexacosanoylphytosphingosine (CHEBI:466659)
Annotations: Rat: (2) Mouse: (2) Human: (2) Chinchilla: (0) Bonobo: (0) Dog: (0) Squirrel: (0) Pig: (0)
Parent Terms Term With Siblings Child Terms
(+)-albicanol 
(+)-aplysinillin 
(+)-delta-cadinol 
(+)-dexrazoxane +   
(+)-dihydromyricetin  
(+)-flavipucine 
(+)-halomon 
(+)-jasplakinolide V 
(+)-jasplakinolide W 
(+)-jasplakinolide Z1 
(+)-jasplakinolide Z2 
(+)-jasplakinolide Z3 
(+)-jasplakinolide Z5 
(+)-lyoniresinol +  
(+)-sesamin +   
(+)-syringaresinol +   
(+)-tephrorin A 
(+)-tephrorin B 
(+)-tephrosone 
(-)-(S)-chlorizidine A 
(-)-anisomycin  
(-)-annonaine +  
(-)-antofine  
(-)-beta-elemene 
(-)-coronaridine +  
(-)-demecolcine  
(-)-duryne 
(-)-duryne B 
(-)-duryne C 
(-)-duryne D 
(-)-duryne E 
(-)-duryne F 
(-)-epigallocatechin 3-gallate +   
(-)-flavipucine 
(-)-gallocatechin gallate 
(-)-jasplakinolide Z4 
(-)-marinopyrrole A 
(-)-noscapine  
(-)-voacangine 
(1,2-diaminocyclohexane)PtCl2 
(13R)-13-dihydrocarminomycin 
(1R,2R,4S,5S,6R,7S)4,5-epoxygermacra-9Z-en-1,2,6-triol 
(2->6)-beta-D-fructan 
(2-sulfonatophenyl)azo group 
(20S)-ginsenoside Rg3 +   
(20S)-ginsenoside Rh2  
(223)RaCl2 
(22E,24R)-5alpha,8alpha-epidioxyergosta-6,9,22-triene-3beta-ol-3-O-beta-D-glucopyranoside 
(25R)-5beta-spirostan-3beta-ol +  
(2E)-4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
(2E)-4-hydroxy-3-methylbut-2-enyl diphosphate(3-) 
(2R)-2-\{(1R)-1-hydroxy-15-[2-(20-methoxy-21-methylnonatriacontyl)cyclopropyl]pentadecyl\}hexacosanoic acid +  
(2S),(2''S)-8,8''-5',5''-tetrahydroxy-7,7''-3,3''-4,4''-hexamethoxy-5,5''-biflavan 
(2S),(2''S)-8,8''-5'-trihydroxy-7,7''-3,3''-4,4''-5''-heptamethoxy-5,5''-biflavan 
(2S)-(-)-kurarinone +  
(2S)-1-O-(7Z,10Z)-hexadecadienoyl-2-O-(7Z,10Z)-hexadecadienoyl-3-O-beta-D-galactopyranosyl-sn-glycerol 
(2S)-1-O-(7Z,10Z)-hexadecadienoyl-2-O-linoleoyl-3-O-beta-D-galactopyranosyl-sn-glycerol 
(2S)-1-O-(7Z,10Z,13Z)-hexadecatrienoyl-2-O-(7Z,10Z)-hexadecadienoyl-3-O-beta-D-galactopyranosyl-sn-glycerol 
(2S)-1-O-(9Z,12Z)-octadecadienoyl-2-O-(7Z,10Z)-hexadecadienoyl-3-O-(alpha-D-galactopyranosyl(1->6)-beta-D-galactopyranosyl)-sn-glycerol 
(2S)-2'-hydroxy-7,8,3',4',5'-pentamethoxyflavan 
(2S)-2'-methoxykurarinone 
(2S)-5,7-dimethoxy-8-(2S-hydroxy-3-methyl-3-butenyl)-3',4'-methylenedioxyflavanone 
(2S)-5,7-dimethoxy-8-formylflavanone 
(2S)-5-Hydroxy-7-methoxy-8-[(E)-3-oxo-1-butenyl]flavanone 
(3-sulfonatophenyl)azo group 
(3beta,16alpha)-16-hydroxy-13,28-epoxyoleanan-3-yl alpha-L-Rhap-(1->2)-beta-D-Glcp-(1->4)-[beta-D-Glcp-(1->2)]-alpha-L-arabinopyranoside 
(3S)-3-\{[3',4'-difluoro-5-(\{4'-fluoro-6-[(3S)-pyrrolidinium-3-yloxy][biphenyl]-3-yl\}carbamoyl)[biphenyl]-2-yl]oxy\}pyrrolidinium dichloride 
(4-hydroxy-3-iodo-5-nitrophenyl)acetic acid +  
(4-sulfonatophenyl)azo group 
(4betaH)-5alpha-hydroxy-8alpha-(2-methylbut-2-enoyloxy)-2-oxo-1(10),11(13)-guaiadien-12,6alpha-olide 
(4betaH)-8alpha-(2-methylbut-2-enoyloxy)-2-oxo-1(5),10(14),11(13)-guaiatrien-12,6alpha-olide 
(4R)-limonene 1-hydroperoxide 
(4R)-limonene 2-hydroperoxide 
(4S)-2-methylpentane-2,4-diol 
(4Z)-2,8:7,12:11,15:14,18:17,22-pentaanhydro-4,5,6,9,10,13,19,20,21-nonadeoxy-L-arabino-L-allo-L-allo-docosa-4,9,20-trienitol 
(4Z,7Z,10Z,13Z,15E,19Z)-17-oxodocosahexaenoic acid 
(5,6-dimethyl-1,10-phenanthroline)(1S,2S-diaminocyclohexane)platinum(II)(2+) 
(5R)-5-isopropenyl-1,2-dimethylcyclohexane 1-hydroperoxide 
(5R)-5-isopropenyl-2-methylcyclohexane 1-hydroperoxide 
(5R)-5-isopropyl-2-methyl-2-cyclohexen-1-one 
(5R,6S,7S)-5,6-dihydroxy-8-(alpha-D-galactosyloxy)-7-hexacosanamido-N-(4-pentylphenyl)octanamide 
(5R,6S,7S)-5,6-dihydroxy-8-(alpha-D-galactosyloxy)-7-hexacosanamido-N-(6-phenylhexyl)octanamide 
(5R,6S,7S)-5,6-dihydroxy-8-(alpha-D-galactosyloxy)-7-icosanamido-N-(6-phenylhexyl)octanamide 
(5R,6S,7S)-5,6-dihydroxy-8-(alpha-D-galactosyloxy)-7-octanamido-N-(3-pentylphenyl)octanamide 
(5R,6S,7S)-5,6-dihydroxy-8-(alpha-D-galactosyloxy)-7-octanamido-N-(4-pentylphenyl)octanamide 
(5R,6S,7S)-5,6-dihydroxy-8-(alpha-D-galactosyloxy)-7-octanamido-N-(4-phenylbutyl)octanamide 
(5R,6S,7S)-5,6-dihydroxy-8-(alpha-D-galactosyloxy)-7-octanamido-N-nonyloctanamide 
(5R,6S,7S)-7-dodecanamido-8-(alpha-D-galactosyloxy)-5,6-dihydroxy-N-(6-phenylhexyl)octanamide 
(5R,6S,7S)-8-(alpha-D-galactosyloxy)-7-hexadecanamido-5,6-dihydroxy-N-(6-phenylhexyl)octanamide 
(5Z,9Z,12Z)-octadecatrienoic acid +  
(6S)-5-formyltetrahydrofolic acid 
(8Z,11Z)-urushiol III 
(9Z,11E,13Z)-octadecatrienoic acid +  
(E)-2-[[[4-(2-chlorophenyl)-1,3-thiazol-2-yl]hydrazinylidene]methyl]benzoic acid 
(E)-trans-miyabenol C 
(E,E)-germacrone  
(R)-amygdalin  
(R)-bicalutamide +   
(R)-homocamptothecin +  
(S)-2-(4-nitrobenzyl)-DOTA 
(S)-2-\{4-[2-(2-hydroxyethylthio)acetamido]benzyl\}-DOTA 
(S)-glaucine +   
(Z)-hexadec-11-enal 
->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)]-beta-D-Galp-yl group 
->4)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
->8)-alpha-Neu5Ac-(2->3)-[beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)]-beta-D-Gal-(1->4)-yl group +   
1'-acetoxychavicol acetate  
1,2,3,4,6-pentakis-O-galloyl-beta-D-glucose  
1,2-bis(diphenylphosphino)ethane 
1,2-di-O-[1-(14)C]-palmitoyl-sn-glycero-3-phosphocholine 
1,2-di-O-myristoyl-sn-glycero-3-phosphocholine 
1,2-di-O-myristoyl-sn-glycero-3-phosphosulfocholine 
1,2-di-O-palmitoyl-sn-glycero-3-phosphocholine 
1,3,6,8-tetraazatricyclo[6.2.1.1(3,6)]dodecane 
1,3,6-trihydroxy-2-methyl-9,10-anthraquinone-3-O-(6'-O-acetyl)-alpha-L-rhamnopyranosyl-(1->2)-beta-D-glucopyranoside 
1,3-diphenylguanidine +   
1,4-phenylenediamine +   
1,5,6-trihydroxy-6',6'-dimethyl-2H-pyrano(2',3':3,4)-2-(3-methylbut-2-enyl)xanthone 
1,6,7-trihydroxy-6',6'-dimethyl-2H-pyrano(2',3':3,2)-4-(3-methylbut-2-enyl)xanthone 
1,6:5,9:8,12:11,16-tetraanhydro-2,3,4,10,13,14-hexadeoxy-D-glycero-D-allo-D-gulo-heptadeca-2,13-dienitol 
1,7,8,9,10,10-hexachloro-4-methyl-4-azatricyclo[5.2.1.0(2,6)]dec-8-ene-3,5-dione 
1-(2,6,6-trimethylcyclohex-2-en-1-yl)but-2-enone 
1-(2-hydroxy-4-methoxyphenyl)-3-(4-hydroxy-3-methoxyphenyl)propane 
1-(3,6-di-O-sulfo-beta-D-galactosyl)-N-lauroylsphingosine 
1-(3-O-sulfo-beta-D-galactosyl)-N-[(15Z)-tetracos-15-enoyl]sphingosine 
1-(3-O-sulfo-beta-D-galactosyl)-N-stearoylsphingosine 
1-(4'-hydroxy-3'-methoxyphenyl)-7-phenyl-3-heptanone 
1-behenoylglycerol 
1-chloro-2,4,6-trinitrobenzene  
1-chloro-2,4-dinitrobenzene  
1-deoxysphinganine +  
1-dodecylpyrrolidin-2-one 
1-elaidoyl-sn-glycero-3-phosphocholine 
1-fluoro-2,4-dinitrobenzene  
1-isothiocyanato-6-(methylsulfanyl)hexane 
1-methyltryptophan  
1-O-(1-O-hexadecanoyl-2-O-heptadecanoyl-sn-glycero-3-phosphono)-1D-myo-inositol 
1-O-(4-deoxy-alpha-D-xylo-hexopyranosyl)-N-hexacosanoylphytosphingosine 
1-O-(4-O-\{3-[4-(trifluoromethyl)phenyl]propyl\}-alpha-D-galactosyl)-N-hexacosanoylphytosphingosine 
1-O-(4-O-allyl-alpha-D-galactosyl)-N-hexacosanoylphytosphingosine 
1-O-(4-O-benzyl-alpha-D-galactosyl)-N-hexacosanoylphytosphingosine 
1-O-(4-O-propyl-alpha-D-galactosyl)-N-hexacosanoylphytosphingosine 
1-O-(6-acetamido-6-deoxy-alpha-D-galactosyl)-N-[(15Z)-tetracos-15-enoyl]phytosphingosine 
1-O-(6-deoxy-6-benzamido-alpha-D-galactopyranosyl)-N-hexacosanoylphytosphingosine 
1-O-(6-thio-alpha-D-galactopyranosyl)-N-hexacosanylphytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-(10-phenyldecanoyl)phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-(11-phenylundecanoyl)phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-(15-phenylpentadecanoyl)phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-(21-phenylhenicosanoyl)phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-(25-phenylpentacosanoyl)phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-(6-phenylhexanoyl)phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-(7-phenylheptanoyl)phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-(8-phenyloctanoyl)phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-(9-phenylnonanoyl)phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-[11-(4-fluorophenyl)undecanoyl]phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-[11-(4-methoxyphenyl)undecanoyl]phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-[6-(4-methoxyphenyl)hexanoyl]phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-[8-(4-fluorophenyl)octanoyl]phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-[8-(4-methoxyphenyl)octanoyl]phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-[8-(4-trifluoromethyl)phenyloctanoyl]phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-\{11-[4-(trifluoromethyl)phenyl]undecanoyl\}phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-\{6-[4-(trifluoromethyl)phenyl]hexanoyl\}phytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-dodecanoylphytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-hexacosanoylsphinganine 
1-O-(alpha-D-galactopyranosyl)-N-icosa-11,14-dienoylphytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-nonanoylphytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-octanoylphytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-pamitoylphytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-tetracosanyl-2-aminononane-1,3,4-triol 
1-O-(alpha-D-galactopyranosyl)-N-tetracosanylphytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-tetradecanoylphytosphingosine 
1-O-(alpha-D-galactopyranuronosyl)-N-tetradecanoyldihydrosphingosine 
1-O-(alpha-D-galactosyl)-N-[(15Z)-tetracos-15-enoyl]phytosphingosine 
1-O-(alpha-D-galactosyl)-N-decanoylphytosphingosine 
1-O-(alpha-D-galactosyl)-N-hexacosanoylphytosphingosine +   
A glycophytoceramide having an alpha-D-galactosyl residue at the O-1 position and a hexacosanoyl group attached to the nitrogen.
1-O-(alpha-D-galactosyl)-N-undecanoylphytosphingosine 
1-O-(alpha-D-glucopyranosyl)-N-icosa-11,14-dienoylphytosphingosine 
1-O-(alpha-D-glucopyranosyl)-N-tetracosanylphytosphingosine 
1-O-(alpha-D-glucosyl)-N-hexacosanoylphytosphingosine 
1-O-(alpha-lactosyl)-N-hexacosanoylphytosphingosine 
1-O-[4-O-(2-adamantylethyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-[4-O-(3,4-dichlorobenzyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-[4-O-(3,4-difluorobenzyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-[4-O-(3-phenylpropyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-[4-O-(4-chlorobenzyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-[4-O-(4-fluorobenzyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-[4-O-(4-methylbenzyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-[4-O-(4-phenylbutyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-[4-O-(4-tert-butylbenzyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-[4-O-(5-phenylpentyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-[4-O-(6-phenylhexyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-[4-O-(cyclobutylmethyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-[4-O-(cyclopropylmethyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-[6-O-(1-naphthylcarbamoyl)-alpha-D-galactopyranosyl]-N-hexacosanoylphytosphingosine 
1-O-[6-O-(3-phenylpropanoyl)-alpha-D-galactopyranosyl]-N-hexacosanoylsphinganine 
1-O-[6-O-(3-phenylpropanoyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-[6-O-(4-pyridylcarbamoyl)-alpha-D-galactopyranosyl]-N-hexacosanoylphytosphingosine 
1-O-[alpha-D-galactosyl-(1->2)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-\{4-O-[3-(3,4-dichlorophenyl)propyl]-alpha-D-galactosyl\}-N-hexacosanoylphytosphingosine 
1-O-\{4-O-[3-(4-chlorophenyl)propyl]-alpha-D-galactosyl\}-N-hexacosanoylphytosphingosine 
1-O-\{4-O-[3-(4-fluorophenyl)propyl]-alpha-D-galactosyl\}-N-hexacosanoylphytosphingosine 
1-O-\{4-O-[3-(4-methoxyphenyl)propyl]-alpha-D-galactosyl\}-N-hexacosanoylphytosphingosine 
1-O-\{4-O-[3-(4-methylphenyl)propyl]-alpha-D-galactosyl\}-N-hexacosanoylphytosphingosine 
1-O-\{4-O-[3-(4-tert-butylphenyl)propyl]-alpha-D-galactosyl\}-N-hexacosanoylphytosphingosine 
1-O-\{4-O-[4-(trifluoromethyl)benzyl]-alpha-D-galactosyl\}-N-hexacosanoylphytosphingosine 
1-O-\{6-deoxy-6-[N'-(1-naphthyl)ureido]-alpha-D-galactopyranosyl\}-N-hexacosanoylphytosphingosine 
1-O-\{6-O-[(4-chlorophenyl)carbamoyl]-alpha-D-galactopyranosyl\}-N-hexacosanoylphytosphingosine 
1-O-caffeoylquinic acid 
1-O-dodecanoyl-2-O-pentacosanoyl-sn-glycero-3-phosphocholine 
1-O-linoleoyl-2-O-oleoyl-3-O-alpha-D-galactosyl-sn-glycerol 
1-O-palmitoyl-2-O-[1-(14)C]-linoleoyl-sn-glycero-3-phosphocholine 
10-hydroxycanthin-6-one 
10058-F4 
12-deacetoxy-21-acetoxyscalarin 
12-O-acetyl-16-O-deacetyl-16-epi-scalarobutenolide 
13(S)-HODE 
13,14-dihydro-Delta(12)-prostaglandin J2  
13-deoxycarminomycin 
14-norpseurotin A 
15-acetyldeoxynivalenol  
15-O-deacetylnimbolidin B 
16,23-epoxy-5beta-cholestane triglycoside 
16-O-deacetyl-16-epi-scalarolbutenolide 
16beta-[(alpha-L-arabinopyranosyl)oxy]-3beta-[(beta-D-glucopyranosyl)oxy]-17alpha-hydroxycholest-5-en-22-one 
16beta-[(O-(2-O-(E)-cinnamoyl-beta-D-xylopyranosyl)-(1->2)-2-O-acetyl-alpha-L-arabinopyranosyl)oxy]-3beta-[(beta-D-glucopyranosyl)oxy]-17alpha-hydroxycholest-5-en-22-one 
17-epi-17-hydroxyazadiradione 
17alpha-ethynylestradiol 3-sulfate 
17alpha-hydroxywithanolide D 
17beta-estradiol 6-O-(carboxymethyl)oxime 
18-oxotryprostatin A 
1D-myo-inositol 1,2-cyclic phosphate 
1R,4S,6R-1,4-endoperoxy-bisabola-2,10-diene 
1S,4R,6R-1,4-endoperoxy-bisabola-2,10-diene 
1S,6R-di(2-)methylbutanoyloxy-4S-hydroxy-8S-benzoyloxy-9R-(3-)furancarbonyloxy-13-acetyloxy-beta-dihydroagarofuran 
2',4'-dihydroxy-3'-(2-hydroxy benzyl)-6'-methoxy chalcone 
2,3-dihydro-3beta-O-sulfate withaferin A 
2,4,4',6-tetrahydroxydibenzoylmethane 
2,4,6-trinitrobenzenesulfonic acid  
2,4,6-trinitrophenyl group +  
2,4-dinitrophenol +   
2,4-dinitrophenyl group +  
2,5,5-trimethyl-1,3-thiazolidine-4-carboxylic acid 
2,5-bis(2-hydroxyethylamino)-3,6-diaziridinylbenzoquinone 
2,5-diaminotoluene sulfate 
2,5-dimethyl-p-phenylenediamine 
2,5-epoxy-2beta-hydroxy-8alpha-(2-methylbut-2-enoyloxy)-4(15),10(14),11(13)-germacratrien-12,6alpha-olide 
2,6-di-O-(alpha-D-mannosyl)-1-O-(1,2-di-O-hexadecanoyl-sn-glycero-3-phosphono)-1D-myo-inositol 
2-(2,4-dihydroxy-5-prenylphenyl)-5,6-methylenedioxybenzofuran 
2-(6-methoxy-1-oxo-1,3-dihydro-2H-isoindol-2-yl)-N-[4-(piperazin-1-yl)pyridin-3-yl]-1,3-thiazole-4-carboxamide 
2-(7-aminoheptyl)guanidine 
2-(acetylamino)naphthalene-1,5-disulfonic acid 
2-[4-(piperidin-3-yl)phenyl]-2H-indazole-7-carboxamide +   
2-\{4-[(3R)-piperidin-3-yl]phenyl\}-2H-indazole-7-carboxamide 
2-\{[(R)-\{[4-(aminomethyl)phenyl]amino\}\{[(1R)-1-phenylethyl]amino\}methyl]amino\}ethane-1,1-diol 
2-acetamidofluorene +   
2-acetamidophenol  
2-amino-5-[(1-methoxy-2-methylindolizin-3-yl)carbonyl]benzoic acid 
2-bromo-2-(bromomethyl)pentanedinitrile +   
2-deoxy-2-fluoro-alpha-D-galactose 
2-endo-amino-2-exo-benzoyl-3-exo-phenylnorbornane 
2-fluoroadenine +  
2-heptylfuran 
2-hydroxyethyl methacrylate  
2-hydroxylinoleic acid 
2-hydroxymelatonin 
2-hydroxyoleic acid 
2-methoxy-17beta-estradiol +   
2-methyl-1,4-phenylenediamine +   
2-O-(alpha-D-mannopyranosyl)-1-phosphatidyl-1D-myo-inositol 
2-O-alpha-D-mannosyl-1-O-\{1-O-[(10S)-10-methyloctadecanoyl]-2-O-palmitoyl-sn-glycero-3-phosphonato\}-5-O-palmitoyl-6-O-(6-O-palmitoyl-alpha-D-mannosyl)-1D-myo-inositol +  
2-O-alpha-D-mannosyl-1-O-\{1-O-[(10S)-10-methyloctadecanoyl]-2-O-palmitoyl-sn-glycero-3-phosphono\}-5-O-palmitoyl-6-O-(6-O-palmitoyl-alpha-D-mannosyl)-1D-myo-inositol 
2-O-oleoyl-3-O-palmitoyl-1-O-alpha-D-galactosyl-sn-glycerol 
2-O-palmitoyl-2'-O-sulfo-3-O-[(2E,4S,6S,8S)-2,4,6,8-tetramethylhexadec-2-enoyl]-alpha,alpha-trehalose 
2-O-palmitoyl-2'-O-sulfo-3-O-[(2E,4S,6S,8S)-2,4,6,8-tetramethyltriacont-2-enoyl]-alpha,alpha-trehalose 
2-thienylacetic acid +  
2-thiobarbituric acid +   
20(R),22(xi),24(S)-dammar-25(26)-ene-3beta,6alpha,12beta,20,22,24-hexanol 
20-epi-bryonolic acid 
20-hydroxytubocapsanolide A 
23,24-dimethylcholest-16(17)-E-en-3beta,5alpha,6beta,20(S)-tetrol 
23-hydroxytubocapsanolide A 
24G7 epitope +   
25-O-methoxycimigenol 3-O-alpha-L-arabinopyranoside 
28-deoxonimbolide  
2alpha-(2'-pyrrolyl)-4alpha-methoxycarbonyl-5beta-[(2''-methyl)-heptyl]-1,3-oxazacyclohexane 
2alpha-(3-hydroxypropyl)-1alpha,25-dihydroxy-19-norvitamin D3 
2beta-methoxy-2-deethoxy-8-O-deacylphantomolin-8-O-tiglinate 
2beta-methoxy-2-deethoxyphantomolin 
3',4',5-trihydroxy-3,6,7-trimethoxyflavone 
3',4',7-trihydroxyisoflavone  
3',4'-difluoro-N-\{4'-fluoro-6-[(3S)-pyrrolidin-3-yloxy][biphenyl]-3-yl\}-6-[(3S)-pyrrolidin-3-yloxy][biphenyl]-3-carboxamide 
3',4'-O-disulfo-N-acetyllactosamine 
3'-deamino-3'-(3-cyanomorpholin-4-yl)doxorubicin  
3'-hydroxy-4'-methoxydiclofenac 
3'-hydroxydiclofenac 
3,3'-diindolylmethane  
3,3'-dimethylquercetin 
3,3-dimethylcystein-S-yl group 
3,4'-dimethylkaempferol 
3,4,5-trimethoxycinnamic acid 
3,4-di-O-methyl-alpha-L-rhamnose 
3,4-dichloroaniline +   
3,4-dihydroxybenzoic acid +   
3,4-dimethoxybenzoic acid +  
3,4-dimethoxyphenylethylamine 
3,5-di-O-caffeoyl quinic acid +  
3,5-dihydroxy-2-(1'-oxo-3'-hexadecenyl)-2-cyclohexene-1-one 
3,5-dimethoxy-4-hydroxybenzyl alcohol-4-O-beta-D-glucopyranoside 
3,6-di-O-sulfo-beta-D-galactosyl-(1->4)-6-O-sulfo-N-acetyl-beta-D-glucosamine 
3,6-di-O-sulfo-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
3,7-dihydroxytropolone 
3-(leucinocarbonyl)phenylazo group 
3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid  
3-\{[(5-nitrofuran-2-yl)methylidene]amino\}-1,3-oxazol-2-one 
3-acetamino-6-isobutyl-2,5-dioxopiperazine 
3-acetyldeoxynivalenol  
3-alpha-D-glucuronosyl-2-[(10R)-10-methyloctadecanoyl]-1-palmitoyl-sn-glycerol 
3-alpha-D-glucuronosyl-2-palmitoyl-1-[(10R)-10-methyloctadecanoyl]-sn-glycerol 
3-alpha-D-glucuronosyl-2-palmitoyl-1-stearoyl-sn-glycerol 
3-beta-O-(E)-coumaroyl-D:C-friedooleana-7,9(11)-dien-29-oic acid 
3-bromopyruvic acid  
3-epi-heliangin 
3-hydroxy-2-hydroxymethyl-9,10-anthraquinone 
3-O-\{(1R)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl\}-2,6-bis-O-\{(1S)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl\}-beta-D-Man-(1->4) -beta-D-GlcNAc-(1->4)-3-O-[(1S)-2-hydroxy-1-\{[(2S)-1-hydroxypropan-2-yl]oxy\}ethyl]-D-GlcNAc-yl group 
3-O-alpha-abequopyranosyl-alpha-D-mannopyranose 
3-O-feruloylcycloartenol 
3-O-hydroxyphthioceranoyl-2-O-stearoyl-2'-O-sulfo-alpha,alpha-trehalose 
3-O-methyl-alpha-L-rhamnose 
3-O-sulfo-beta-D-galactose +  
3-oxo-N-[(3S)-2-oxopyrrolidin-3-yl]dodecanamide 
3-pentadecylcatechol 
3beta,12-dihydroxy-13-methyl-5,8,11,13-podocarpatetraene-7-one 
3beta,12-dihydroxy-13-methyl-6,8,11,13-podocarpatetraene 
3beta-[(beta-D-glucopyranosyl)oxy]-17alpha-hydroxy-16beta-[(O-(2-O-3,4,5-trimethoxybenzoyl-beta-D-xylopyranosyl)-(1->3)-2-O-acetyl-alpha-L-arabinopyranosyl)oxy]cholest-5-en-22-one 
3beta-[(beta-D-glucopyranosyl)oxy]-17alpha-hydroxy-16beta-[(O-(2-O-3,4-dimethoxybenzoyl-beta-D-xylopyranosyl)-(1->3)-2-O-acetyl-alpha-L-arabinopyranosyl)oxy]cholest-5-en-22-one 
3beta-[(beta-D-glucopyranosyl)oxy]-17alpha-hydroxy-16beta-[(O-beta-D-xylopyranosyl)-(1->3)-2-O-acetyl-alpha-L-arabinopyranosyloxy]cholest-5-en-22-one 
3beta-[(O-beta-D-glucopyranosyl-(1->3)-4,6-dideoxy-2-O-methyl-beta-D-gulopyranosyl)]-5beta,14beta-dihydroxy-19-oxocard-20(22)enolide 
3beta-[(O-beta-D-glucopyranosyl-(1->4)-O-beta-D-glucopyranosyl-(1->6)-beta-D-glucopyranosyl)oxy]-17alpha-hydroxy-16beta-[(O-(2-O-3,4,5-trimethoxybenzoyl-beta-D-xylopyranosyl)-(1->3)-2-O-acetyl-alpha-L-arabinopyranosyl)oxy]cholest-5-en-22-one 
3beta-[(O-beta-D-glucopyranosyl-(1->4)-O-beta-D-glucopyranosyl-(1->6)-beta-D-glucopyranosyl)oxy]-17alpha-hydroxy-16beta-[(O-(2-O-3,4-dimethoxybenzoyl-beta-D-xylopyranosyl)-(1->3)-2-O-acetyl-alpha-L-arabinopyranosyl)oxy]cholest-5-en-22-one 
3beta-[(O-beta-D-glucopyranosyl-(1->4)-O-beta-D-glucopyranosyl-(1->6)-beta-D-glucopyranosyl)oxy]-17alphahydroxy-16beta-[(O-(3-O-3,4-dimethoxybenzoyl-beta-D-xylopyranosyl)-(1->3)-2-O-acetyl-alpha-L-arabinopyranosyl)oxy]cholest-5-en-22-one 
3beta-[(O-beta-D-glucopyranosyl-(1->6)-beta-D-glucopyranosyl)oxy]-17alpha-hydroxy-16beta-[(O-(2-O-3,4,5-trimethoxybenzoyl-beta-D-xylopyranosyl)-(1->3)-2-O-acetyl-alpha-L-arabinopyranosyl)oxy]cholest-5-en-22-one 
3beta-[(O-beta-D-glucopyranosyl-(1->6)-beta-D-glucopyranosyl)oxy]-17alpha-hydroxy-16beta-[(O-(2-O-3,4-dimethoxybenzoyl-beta-D-xylopyranosyl)-(1->3)-2-O-acetyl-alpha-L-arabinopyranosyl)oxy]cholest-5-en-22-one 
3beta-O-\{alpha-L-Rhap-(1->2)-beta-D-Glcp-(1->4)-[beta-D-Glcp-(1->2)]-alpha-L-Arap\}primulagenin A 
3PO 
4''-dehydro-3-hydroxyterphenyllin 
4',5'-dihydro-11,5'-dihydroxy-4'-methoxytephrosin 
4',5,7-trihydroxy-3'-methoxyflavone +   
4'-demethyldeoxypodophyllotoxin 
4'-demethylepipodophyllotoxin +   
4'-epidoxorubicin  
4'-hydroxychalcone  
4'-hydroxydiclofenac  
4,4'-(ethyl-2-nitropropane-1,3-diyl)bismorpholine 
4,4'-azodibenzenearsonic acid 
4,4'-diaminodiphenylmethane  
4,5,6-trimethyl-3-pentadecylcatechol 
4,6-di-O-sulfo-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-ManpOMe 
4-(18,20-dihydroxy-26-methoxy-25-methyloctacosyl)phenyl 3,6-di-O-methyl-beta-D-Glc-(1->4)-2,3-di-O-methyl-alpha-L-Rha-(1->2)-3-O-methyl-alpha-L-Rha 
4-(2,6-dichlorobenzamido)-N-(piperidin-4-yl)-pyrazole-3-carboxamide 
4-(2-hydroxy-5-methylphenylazo)acetanilide 
4-(2-nitrobutyl)morpholine 
4-(4-nitrophenylazo)aniline 
4-(4-styrylphenylcarbamoyl)butyric acid 
4-(\{5-[(2-aminoethyl)amino]-2,4-dinitrophenyl\}amino)-TEMPO 
4-(dimethylamino)-N-[7-(hydroxyamino)-7-oxoheptyl]benzamide 
4-(ethoxymethylene)-2-phenyloxazol-5-one  
4-(phenylazo)aniline 
4-[(1S,2R)-3-(4-fluorophenyl)-2-hydroxy-1-(1,2,4-triazol-1-yl)propyl]benzonitrile 
4-[N'-(2-hydroxyethyl)thioureido]-L-benzyl EDTA 
4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid  
4-amino-TEMPO +   
4-aminobenzenesulfonic acid 
4-aminobenzoic acid +   
4-aminobutyl alpha-L-fucopyranoside 
4-aminobutyl beta-D-xylopyranoside 
4-aminophenol +   
4-chlorobenzoyl group 
4-hydroperoxycyclophosphamide  
4-hydroxy-TEMPO +   
4-hydroxyphenyl retinamide  
4-iodo-6-phenylpyrimidine 
4-isopropyl-1-methylcyclohexane 1-hydroperoxide 
4-methoxymagnaldehyde B 
4-methyl-1,4-dihydropyridine-3,5-dicarbaldehyde 
4-methyl-5-pentylbenzene-1,3-diol 
4-methylaeruginoic acid 
4-methylaminophenol +  
4-methylumbelliferone +   
4-methylumbelliferone beta-D-glucuronide  
4-nitrobenzyl bromide  
4-nitrophenyl (4-carboxybutyl)phosphonate 
4-nitrophenyl methylphosphonate 
4-nitrosobenzenesulfonamide 
4-O-(2-acetamido-2-deoxy-beta-D-glucopyranosyl)-5-O-phosphono-D-ribitol 
4-O-(2-acetamido-2-deoxy-beta-D-glucopyranosyl)-D-ribitol +  
4-O-acetyl-2,3-di-O-methyl-alpha-L-fucopyranose 
4-phenylbutyric acid  
4-sulfanilamidobenzoic acid 
4-terpineol +   
4-tert-butylphenol +   
4-tolyl isocyanate  
5'-AsGsCsCsGsCsGsAsCsTsTsCsTsAsGsAsCsT-3' 
5'-CGAAAGUCCGAUCGGCGUAAUGUCA-3' RNA fragment 
5'-CGTGCTGTTTTTTTTTG-3' 
5'-CGUUCGCG-3' RNA fragment 
5'-CsGsGsCsTsCsCsAsTsGsTsAsCsAsGsCsAsTsGsCsG-3' 
5'-GACCCCUG-3' RNA fragment 
5'-GsCsAsGsTsCsTsAsTsTsAsCsTsGsTsGsCsGsAsGsA-3' 
5'-GsCsCsGsAsGsGsTsCsCsAsTsGsTsCsGsTsAsCsGsC-3' 
5'-GsCsGsTsAsCsGsAsCsAsTsGsGsAsCsCsTsCsGsGsC-3' 
5'-GUUUGGCGACGUCCCACAUGAGCC-3' RNA fragment 
5'-TCAACC-3' 
5'-TCGAGCTGCCTTCAGTCGT-3' 
5'-TsGsTsGsGsGsTsTsAsAsGsAsCsTsTsTsTsTsAsCsC-3' 
5,6-dimethyl-3-pentadecylcatechol 
5,6-epoxyretinoic acid +  
5,7,3'-trihydroxy-4'-methoxy-8,2'-di(3-methyl-2-butenyl)-(2S)-flavanone 
5-(2,2-diferuloylethen-1-yl)thalidomide 
5-(2-amino-5,6-dimethyl-1H-benzimidazol-1-yl)pentanoic acid 
5-(2-oxoethylideneamino)-6-D-ribitylaminouracil 
5-(2-oxopropylideneamino)-6-D-ribitylaminouracil 
5-(\{4-[2-(1-oxidopiperidin-1-yl)ethyl]phenyl\}amino)-5-oxopentanoic acid 
5-(dimethylamino)-N-(4-nitrosobenzyl)naphthalene-1-sulfonamide 
5-(N,N-hexamethylene)amiloride  
5-(tetradecyloxy)-2-furoic acid  
5-[(4,6-diamino-1,3,5-triazin-2-yl)amino]-4-hydroxy-3-[(2-sulfophenyl)diazenyl]naphthalene-2,7-disulfonic acid 
5-[(4-nitrobenzyl)(phosphonomethyl)amino]valeric acid 
5-[2-(2-oxoethoxy)ethoxy]-diclofenac 
5-[2-(feruloyl)ethen-1-yl]thalidomide 
5-amino-2-chlorobenzotrifluoride 
5-aminolevulinic acid +   
5-aminolevulinic acid hydrochloride 
5-azacytidine  
5-bromo-2'-deoxyuridine  
5-bromo-8-methoxy-1-methyl-beta-carboline 
5-chloro-7-iodoquinolin-8-ol  
5-fluorouracil  
5-heptadecylresorcinol 
5-hydroxy-2-(1'-hydroxyethyl)naphtho[2,3-b]furan-4,9-dione 
5-hydroxy-2-methylchromone-7-O-rutinoside 
5-hydroxy-6-methoxy-2-methylchromone-7-O-rutinoside 
5-hydroxy-7-prop-2-en-(E)-ylidene-7,7a-dihydro- 2H-cyclopenta[b]pyran-6-one 
5-hydroxy-7-prop-2-en-(Z)-ylidene-7,7a-dihydro- 2H-cyclopenta[b]pyran-6-one 
5-hydroxydiclofenac  
5-hydroxyimidazole-4-carboxamide 
5-O-ethyl embelin 
5-O-methyl embelin 
5alpha,8alpha-epidioxycholest-6-en-3beta-ol 
5alpha,8alpha-epidioxysterol 
5E-7-oxozeaenol 
5Z-7-oxozeaenol 
6'-O-galloylalbiflorin 
6-(alpha-D-glucosaminyl)-1D-myo-inositol 1,2-cyclic phosphate 
6-[(1,2-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,3-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,4-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,5-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1-deoxy-D-ribityl)methyl]-5-[(1E)-3-oxobut-1-en-1-yl]uracil 
6-[(2-hydroxyethyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(3-hydroxypropyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(4-aminobenzyl)amino]-2,3,4,5-tetrahydropyridinium 
6-[(4-hydroxybutyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(5-hydroxypentyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[1'-oxo-3'(R)-hydroxy-butyl]-5,7-dimethoxy-2,2-dimethyl-2H-1-benzopyran 
6-[1'-oxo-3'(R)-methoxy-butyl]-5,7-dimethoxy-2,2-dimethyl-2H-1-benzopyran 
6-\{4-[hydroxy-(4-nitrophenoxy)phosphoryl]butyrylamino\}hexanoic acid 
6-aminopenicillanic acid +   
6-anilino-5,8-quinolinedione  
6-azauridine +   
6-azauridine 5'-monophosphate 
6-azauridine 5'-monophosphate(2-) 
6-deoxy-alpha-L-Talp2,3Ac2-(1->3)-beta-D-Glcp-yl group 
6-deoxy-alpha-L-Talp2Ac3Me-(1->3)-beta-D-Glcp-yl group 
6-deoxy-D-glucos-6-yl corynomycolate +  
6-diazo-5-oxo-L-norleucine 
6-hydroxypaclitaxel  
6-methoxyspirotryprostatin B 
6-methyl-5-[(1E)-3-oxobut-1-en-1-yl]uracil 
6-methylcoumarin 
6-O-(1-O-stearoyl-sn-glycero-3-phosphono)-1D-myo-inositol 
6-tuliposide A 
7,3',4'-trihydroxy-3,8-dimethoxyflavone 
7,8-dehydrocerberin 
7,8-dihydroxyflavanone 
7,8-dihydroxyflavone 
7-(4''-hydroxy-3''-methoxyphenyl)-1-phenyl-4E-heptene-3-one 
7-(4''-hydroxy-3''-methoxyphenyl)-5-methoxy-1-phenyl-3-heptanone 
7-deacetyl-7-benzoylgedunin 
7-methoxydeoxymorellin 
7-nor-ergosterolide 
7-oxo-3,8,9-trihydroxy staurosporine 
7-oxo-8,9-dihydroxy-4'-N-demethyl staurosporine 
7alpha-hydroperoxy manool 
8,8a-epoxymorellic acid 
8-(2-chloro-3,4,5-trimethoxybenzyl)-2-fluoro-9-pent-4-yn-1-yl-9H-purin-6-amine 
8-(2-hydroxyethyl)-6-methyllumazine 
8-acetoxy-4,10-dihydroxy-2,11(13)-guaiadiene-12,6-olide 
8-azaguanine +   
8-benzyl-7-hydroxy-4,10-dioxo-1-phenyl-6-oxa-3,9-diaza-7-phosphatetradecan-14-oic acid 7-oxide 
8-hydroxy-2-(1'-hydroxyethyl)naphtho-[2,3-b]-furan-4,9-dione 
8-PIP-cAMP 
9(11)-dehydroaxinysterol 
9-beta-D-arabinofuranosylguanine +  
9-cis-retinoate 
9-cis-retinoic acid +   
9-deacetoxyfumigaclavine C 
9-deoxy-9-acetamido-alpha-N-acetylneuraminyl-(2->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
9-deoxy-9-acetamido-N-acetyl-alpha-neuraminic acid 
9-hydroxy hedychenone 
9-hydroxycanthin-6-one  
9-hydroxyellipticine  
9-methoxycanthin-6-one 
9alpha,11alpha-dihydroxyergosta-4,6,8(14),22-tetraen-3-one 
9E,11E-octadecadienoic acid +   
9H-purine-2,6-diamine +  
[->2)-beta-Man-(1->2)-alpha-Man-(1->2)-[alpha-Glc-(1->3)]-alpha-Man(1->2)-alpha-Man(1->3)-beta-GlcNAc-(1->]2 
[3)-6-deoxy-alpha-L-Talp-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2,4Ac2-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2Ac-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2Me-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp4Ac2Me-(1->3)-beta-D-Glcp-(1->]n 
[3)-alpha-D-Fucp-(1->2)-beta-L-Rhap-(1->]n 
[3)-alpha-D-Galp-(1->3)-beta-D-Galf2Ac-(1->]n 
[3)-beta-D-Glcp-(1->]5 
[3)-beta-D-Glcp6,NAc2-(1->] residue 
[3)-beta-D-GlcpNAc-(1->4)-alpha-L-Rhap-(1->]n 
[4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->3)-beta-D-QuiNAc-(1->2)-beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->]n 
[4)-alpha-D-Galp-(1->3)-beta-D-Galf-(1->]n 
[4)-alpha-D-Glcp-(1->4)-alpha-D-Glcp-(1->4)-alpha-D-Glcp-(1->] residue 
[4)-beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->]n 
[N-(4-cyanophenyl)-N'-(diphenylmethyl)guanidine]acetic acid  
[P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-] 
[P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-] 
[P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-] 
[P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-] 
[P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-] 
[P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-P-6)-alpha-D-ManpN,4(3)Ac2-(1-P-6)-alpha-D-ManpN,3(4)Ac2-(1-] 
A. haemolyticus strain 57 O-specific polysaccharide 
A. haemolyticus strain 61 O-specific polysaccharide 
A2-32-01 
A2-58-06 
abarelix 
abiraterone +   
abiraterone acetate 
ABT-737  
abyssinone A 
abyssinone C 
abyssinone D 
acadesine +   
acalabrutinib  
acenaphthoquinone  
acetyl aleuritolic acid 
acetyl cardiolipin 
acetyl-GPL-2 
acivicin  
aclacinomycin A  
aclacinomycin A zwitterion 
aclacinomycin N 
aclacinomycin S 
aclacinomycin S zwitterion 
aclacinomycin T 
aclacinomycin T hydrochloride 
aclacinomycin T zwitterion 
acriflavinium chloride 
acronycine 
actinodaphnine 
aculeatol E 
acumitin 
adenine arabinoside +   
adonixanthin 
AEE788 
afatinib +   
afatinib dimaleate 
afimoxifene  
agathisflavone  
ageladine A  
agigenin +  
aglaiabbreviatin F 
AKI00000020a 
aklavinone +   
alantolactone +   
alatolide 
albizoside A 
albizoside B 
albizoside C 
alectinib  
alectinib hydrochloride 
alfuzosin +   
all-cis-5,8,11,14,17-icosapentaenoic acid +  
all-cis-docosa-4,7,10,13,16,19-hexaenoic acid +   
all-trans-4-oxoretinol  
all-trans-retinoic acid +   
allanxanthone C 
allyl isothiocyanate  
Aloe emodin  
alpha-(1->3)-galactobiose +  
alpha-(4-hydroxyphenyl)-N-tert-butylnitrone 
alpha-D-Abep-(1->3)-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp 
alpha-D-fucose +  
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-D-GlcNAc +  
alpha-D-Gal-(1->3)-alpha-D-Gal-OMe 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->3)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-D-GlcNAc +  
alpha-D-Gal-(1->4)-alpha-D-Gal-OMe 
alpha-D-galactosaminyl-(1->3)-[alpha-L-fucosyl-(1->2)]-beta-D-galactosyl derivative(1+) 
alpha-D-galactose 1-phosphate  
alpha-D-galactoside +  
alpha-D-galactosyl group +  
alpha-D-galactosyl-(1->2)-alpha-D-galactose 
alpha-D-galactosyl-(1->2)-beta-D-galactose +  
alpha-D-galactosyl-(1->2)-D-galactosyl group 
alpha-D-galactosyl-(1->3)-D-galactose +  
alpha-D-galactosyl-(1->3)-D-galactosyl group 
alpha-D-galactosyl-(1->4)-beta-D-galactosyl group +  
alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide +   
alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1<->1')-ceramide 
alpha-D-Galf-(1->2)-alpha-D-Galp 
alpha-D-GalN-(1->4)-[alpha-LD-Hep-(1->2)-alpha-DD-Hep-(1->2)]-alpha-D-GalA-yl group 
alpha-D-GalNAc-(1->2)-beta-D-Man-(1->4)-[beta-D-Glc-(1->2)]-alpha-D-Man-(1->5)-alpha-Kdo 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->3)-alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-GalNpAc-(1->3)-beta-D-GalpNAc 
alpha-D-Galp-(1->2)-[alpha-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp 
alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-[alpha-D-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-alpha-D-Glcp 
alpha-D-Galp-(1->2)-alpha-D-Manp 
alpha-D-Galp-(1->2)-beta-D-Glcp-(1->4)-beta-D-Glcp 
alpha-D-Galp-(1->2)-beta-D-Manp 
alpha-D-Galp-(1->2)-D-Galp +  
alpha-D-Galp-(1->3)-[alpha-D-Galp-(1->4)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-Galp-(1->3)-alpha-D-GlcpNAc 
alpha-D-Galp-(1->3)-alpha-D-Manp 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group +  
alpha-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-D-Galp-(1->3)-beta-D-Manp 
alpha-D-Galp-(1->3)-D-GalNAc-OH 
alpha-D-Galp-(1->3)-D-Glcp 
alpha-D-Galp-(1->4)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Galp-(1->4)-alpha-D-Glcp 
alpha-D-Galp-(1->4)-alpha-L-Fucp 
alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-D-Galp-(1->4)-beta-D-GalpNAc-(1->3)-D-Galp 
alpha-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Galp-(1->4)-D-Gal-OH 
alpha-D-Galp-(1->6)-alpha-D-Galp 
alpha-D-Galp-(1->6)-alpha-D-Glcp 
alpha-D-Galp-(1->6)-beta-D-Manp 
alpha-D-Galp-(1->6)-D-Glc-OH 
alpha-D-GalpN-(1->4)-alpha-D-GalpA-yl group 
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-alpha-D-GalpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GalpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-D-GlcpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-D-GlcpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-yl group +  
alpha-D-GalpNAc-(1->3)-alpha-D-Galp +  
alpha-D-GalpNAc-(1->3)-beta-D-Galp +  
alpha-D-GalpNAc-(1->4)-[alpha-D-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Glcp-(1->3)-alpha-D-Galp +  
alpha-D-Glcp-(1->3)-alpha-L-Rhap 
alpha-D-Glcp-(1->3)-beta-D-Glcp-(1->4)-[alpha-D-GlcpA-(1->3)]-beta-D-Manp-(1->4)-alpha-D-Glcp +  
alpha-D-Glcp-(1->6)-alpha-D-Galp +  
alpha-D-Glcp-(1->6)-alpha-D-Glcp-(1->6)-beta-D-Glcp +  
alpha-D-Glcp-(1->6)-D-Gal-OH 
alpha-D-GlcpA-(1->3)-beta-D-Manp-(1->4)-alpha-D-Glcp-(1->3)-beta-D-Glcp-(1->4)-[alpha-D-GlcpA-(1->3)]-beta-D-Manp-(1->4)-alpha-D-Glcp +  
alpha-D-GlcpN-(1->1)-alpha-D-Galp 
alpha-D-GlcpNAc-(1->2)-L-alpha-D-Hepp-(1->3)-L-alpha-D-Hepp 
alpha-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-D-GalpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNH2-(1->7)-alpha-LD-Hepp-(1->2)-[alpha-LD-Hepp-(1->6)]-alpha-LD-Hepp-(1->3)-[alpha-D-Glcp-(1->6)]-[beta-D-Glcp-(1->4)]-alpha-LD-Hepp-(1->5)-4,7-anhydro-Kdo 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN4P-(1->6)-alpha-D-GlcN1P 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN-4P-(1->6)-alpha-D-GlcN-1P 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN-4P-(1->6)-alpha-D-GlcN-1P 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN-4P-(1->6)-alpha-D-GlcN-1P 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc 
alpha-D-Man-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->3)-[alpha-D-Man-(1->2)-alpha-D-Man-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-mannose +  
alpha-D-mannose 6-phosphate +  
alpha-D-Manp-(1->2)-alpha-D-Galp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-D-Manp +  
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-alpha-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc +  
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-D-Manp-(1->6)-beta-D-Manp +  
alpha-D-Manp6P-(1->3)-alpha-D-Manp-(1->3)-alpha-D-Manp-(1->3)-alpha-D-Manp-(1->2)-D-Manp +  
alpha-D-Rhap-(1->2)-alpha-D-Rhap-(1->3)-alpha-D-Rhap 
alpha-D-Rhap-(1->3)-alpha-D-Rhap 
alpha-D-Rhap-(1->3)-alpha-D-Rhap-(1->2)-alpha-D-Rhap 
alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo 
alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo 
alpha-D-Rhap4NFo-(1->3)-alpha-D-Rhap4NFo +  
alpha-D-Xylf5SMe-(1->4)-alpha-D-Manp-(1->2)-alpha-D-Manp-yl group +  
alpha-KDN-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-D-Glcp 
alpha-KDN-(2->6)-beta-D-Galp-(1->4)-D-GlcpNAc 
alpha-Kdo-(2->4)-alpha-Kdo-OAll 
alpha-Kdo-(2->8)-[alpha-Kdo-(2->4)]-alpha-Kdo 
alpha-Kdo-(2->8)-alpha-7-O-Me-Kdo 
alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo-OAll 
alpha-Kdo-(2->8)-alpha-Kdo-OAll 
alpha-Kdo-CH2OH-(2->4)-alpha-Kdo 
alpha-L-arabinofuranose +  
alpha-L-Araf-(1->2)-beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
alpha-L-Fuc-(1->2)-[alpha-D-Gal-(1->3)]-beta-D-Gal +  
alpha-L-Fuc-(1->2)-[alpha-D-Gal-(1->3)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-alpha-D-Gal-yl group 
alpha-L-Fuc-(1->2)-[alpha-D-GalNAc-(1->3)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-alpha-D-Gal-yl group 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-alpha-D-Gal-yl group 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-D-GlcNAc 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]GlcNAc-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-alpha-D-Gal-yl group 
alpha-L-Fuc-(1->3)-[beta-D-Gal-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-L-Fuc-(1->3)-[beta-D-Gal-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-L-Fuc-(1->3)-[beta-D-Gal-(1->4)]-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-NeuAc-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-L-Fuc-(1->3)-beta-D-GalNAc-(1->4)-beta-D-GlcNAc-yl group 
alpha-L-fucose +  
alpha-L-fucosyl group +  
alpha-L-fucosyl-(1->2)-beta-D-galactosyl group 
alpha-L-fucosyl-(1->4)-N-acetyl-beta-D-glucosamine +  
alpha-L-Fucp-(1->2)-(1->3)-[alpha-D-Galp]-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[beta-D-Galp-(1->3)-alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-D-Glcp 
alpha-L-Fucp-(1->2)-[beta-D-Galp-(1->3)-alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-D-GlcpNAc 
alpha-L-Fucp-(1->2)-alpha-D-Galp 
alpha-L-Fucp-(1->2)-beta-D-Galp +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-\{alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->6)\}-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-D-Galp +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-Glcp6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-GlcpNAc6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-Glcp +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-Glcp6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)]-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-[alpha-Neup5Ac-(2->3)-beta-D-Galp6S-(1->4)]-beta-D-GlcpNAc 
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-alpha-D-Galp +  
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->4)-[beta-D-Galp3S-(1->3)]-beta-D-GlcpNAc 
alpha-L-Fucp-(1->6)-alpha-D-Galp 
alpha-L-FucpNAc-(1->3)-D-FucpNAc 
alpha-L-rhamnopyranose +   
alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->2)-alpha-L-Rhap 
alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap 
alpha-L-Rhap-(1->3)-[alpha-D-Glcp-(1->4)]-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc 
alpha-L-Rhap-(1->3)-[alpha-D-Glcp-(1->4)]-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap 
alpha-L-Rhap-(1->3)-alpha-D-Galp 
alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc 
alpha-mangostin  
alpha-mycolic acid 
alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-N-acylsphingosine +   
alpha-N-acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide +  
alpha-N-acetylneuraminyl-(2->3)-D-galactosyl group +  
alpha-N-acetylneuraminyl-(2->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
alpha-Neu4Ac5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1<->1')-Cer 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->6)]-D-GalNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-Neu5Ac-(2->6)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-D-Gal +  
alpha-Neu5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1<->1')-Cer 
alpha-Neu5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1<->1')-Cer 
alpha-Neu9,NAc2-(2->6)-GalNAc 
alpha-Neup5,9Ac2-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5,9Ac2-(2->6)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->3)-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-D-GalpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-D-Galp-yl group 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[beta-D-Galp-(1->4)-beta-D-Glcp-(1->6)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1->6)]-2,5-anhydro-D-Man 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-D-GalpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp6S-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)]-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->6)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)]-D-GalpNAc +  
alpha-Neup5Ac-(2->6)-beta-D-Galp 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-GalpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac +  
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +   
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-[beta-D-GalpNAc-(1->4)]-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-yl group 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-beta-Neup5Ac 
alpha-Neup5Ac-(2->8)-beta-Neup5Ac 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-D-Glcp-yl group 
alpha-Neup5Gc-(2->6)-alpha-D-GalpNAc 
alpha-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-D-Glcp-yl group 
alpha-NeupNAc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S 
alpha-peltatin +  
alsterpaullone  
alvaradoin E 
alvaradoin F 
alvaradoin G 
alvaradoin H 
alvaradoin I 
alvaradoin J 
alvaradoin K 
alvaradoin L 
alvaradoin M 
alvaradoin N 
alvocidib  
alvocidib hydrochloride 
AM-251  
AMG-208 
AMG-925 
aminoglutethimide +   
ammonium persulfate 
ammonium thioglycolate 
amomol A 
amoxicillin diketopiperazine 
amoxicilloic acid 
amrubicin +  
amrubicinol 
amsacrine  
anastrozole +   
ancitabine  
ancitabine hydrochloride 
andrographolide  
ansamitocin P3 
anthra[1,9-cd]pyrazol-6(2H)-one  
anthramycin 
anthrarobin  
antroquinonol  
aphidicolin  
apigenin +   
aplysinoplide A 
aplysinoplide B 
aplysinoplide C 
apratoxin A  
apratoxin D 
apratoxin E 
ardisianoside A 
ardisianoside B 
ardisianoside C 
ardisianoside D 
ardisianoside E 
ardisiphenol A 
ardisiphenol B 
ardisiphenol C 
arenamide A 
arenamide B 
arglabin +  
argpyrimidine 
arotinoid acid  
artemorin 
artesunate  
artocarpin 
artochamin C 
artoindonesianin E1 
artoindonesianin P 
AS-I-145 
AS1842856 
ascochlorin 
ascofuranone 
ASP-3026 
asperfuranone 
aspergillide A 
aspergillide B 
aspergillide C 
asperphenamate  
asprellic acid A 
asprellic acid C 
asukamycin 
AT7867 
atromentin 
auraptene  
aureothin 
austocystin D 
avenanthramide B 
axitinib  
azadirone +  
azaserine 
azathioprine  
AZD-1152 +  
AZD-8055 
AZD1080 
AZD2858 
AZD3463 
AZT-1152 
aztreonyl group +  
baicalein +   
baicalin  
Bandrowski's base  
barbituric acid +   
bassianolide 
BAY11-7085 
BCI-215 
BDA-366 
BE-54238A 
BE-54238B 
beauvericin  
belinostat  
benfotiamine  
benzocaine  
benzyl cinnamate  
benzylamine +   
benzylpenamaldate group 
benzylpenamidyl group 
benzylpenicanyl group 
benzylpenicillenate +  
benzylpenicillenic acid +  
benzylpenicillenyl group 
benzylpenicillin +   
benzylpenicilloic acid 
benzylpenicilloyl group +  
benzylpenicilloyl-benzylamine 
benzylpenilloaldehyde 
benzylpenilloic acid 
berberine  
berkeleydione 
beryllium atom +   
beryllium sulfate +   
beta-(1->3)-galactobiose +  
beta-aminoarteether maleate 
beta-aminopropionitrile +   
beta-aminopropionitrile hemifumarate 
beta-cellobiose +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)]-alpha-D-Araf-(1->5)-alpha-D-Araf +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)]-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)]-alpha-D-Araf-(1->5)-alpha-D-Araf-yl group +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-alpha-D-Araf-(1->5)-alpha-D-Araf 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-alpha-D-Araf-(1->5)-alpha-D-Araf-yl group 
beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->3)-\{beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-[alpha-L-Fuc-(1->6)]-beta-D-GlcNAc 
beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->3)-\{beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
beta-D-Gal-(1->3)-[beta-D-GlcNAc-(1->6)]-D-GalNAc +  
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Gc-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
beta-D-Gal-(1->4)-alpha-D-Glc-(1->3)-[alpha-D-GlcNAc-(1->2)]-alpha-L-Hep 
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-[beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->4)]-alpha-D-Man-(1->3)-[beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-D-GlcNAc +  
beta-D-galactose +   
beta-D-galactosyl-(1->3)-alpha-D-mannose 
beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl group 
beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl group 
beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl group 
beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl group +  
beta-D-Galf-(1->3)-alpha-D-Galp 
beta-D-Galf-(1->3)-alpha-D-Manp 
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-GalNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-D-Glc +  
beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
beta-D-GalNAc-(1->4)-beta-D-GalNAc-yl group 
beta-D-Galp-(1->2)-beta-D-Galp +  
beta-D-Galp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->3)-L-glycero-alpha-D-manno-Hepp-(1->5)-Kdo 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-yl group 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcpNAc +  
beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-D-GalpNAc +  
beta-D-Galp-(1->3)-[beta-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-\{alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcNAc-(1->6)\}-D-GalNAc +  
beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp-(1->3)-beta-D-GalpNAc +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-D-Glcp +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-yl group +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-D-Galp-yl group 
beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp +  
beta-D-Galp-(1->3)-D-GalpNAc +  
beta-D-Galp-(1->3)-D-GlcpNAc +  
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->6)-[beta-D-Galp-(1->3)]-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-D-Glcp +  
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp6S +  
beta-D-Galp-(1->4)-alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-alpha-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcNAcp-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->4)-beta-D-Glcp-(1->6)-[beta-D-Glcp-(1->4)]-beta-D-GlcpNAcOCH2CH2N3 
beta-D-Galp-(1->4)-beta-D-Glcp6S 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-\{alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-[alpha-D-Manp-(1->3)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-D-GalpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)-alpha-D-GalpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->3-)-alpha-D-GalpNAc 
beta-D-Galp3S-(1->3-)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp +  
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp6S 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc6S +  
beta-D-Galp3S-(1->4)-beta-D-Glcp 
beta-D-Galp3S-(1->4)-beta-D-Glcp6S 
beta-D-Galp3S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-beta-D-GlcpNAc6S 
beta-D-Galp4S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp6S-(1->4)-beta-D-Glcp 
beta-D-Galp6S-(1->4)-beta-D-Glcp6S 
beta-D-Galp6S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp6S-(1->4)-beta-D-GlcpNAc6S 
beta-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp 
beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->3)-alpha-D-GalpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-D-Galp 
beta-D-GalpNAc-(1->4)-[alpha-Neup5Gc-(2->3)]-beta-D-Galp +  
beta-D-GalpNAc-(1->4)-[alpha-Neup5Gc-(2->3)]-beta-D-Galp-(1->4)-R group +  
beta-D-GalpNAc-(1->4)-alpha-D-GalpNAc 
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
beta-D-GalpNAc-(1->4)-D-GlcpNAc +  
beta-D-GlcA-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-GlcNAc-(1->4)-MDP-Lys(L18) 
beta-D-Glcp(1->6)-alpha-D-GlcpNAc-(1->3)-alpha-L-QuipNAc-(1->3)-beta-D-GlcpNAc 
beta-D-Glcp-(1->3)-alpha-D-Galp 
beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-GlcpO[CH2]5CO2Me 
beta-D-Glcp-(1->3)-beta-D-GlcpA-(1->4)-beta-D-Glcp 
beta-D-Glcp-(1->4)-[alpha-D-GlcpA-(1->3)]-beta-D-Manp-(1->4)-alpha-D-Glcp +  
beta-D-Glcp-(1->4)-[alpha-D-GlcpA-(1->3)]-beta-D-Manp-(1->4)-alpha-D-Glcp-(1->3)-beta-D-Glcp-(1->4)-[alpha-D-GlcpA-(1->3)]-beta-D-Manp-(1->4)-alpha-D-Glcp +  
beta-D-Glcp-(1->6)-alpha-D-Galp 
beta-D-Glcp-(1->6)-beta-D-Glcp +  
beta-D-GlcpA-(1->3)-beta-D-Galp +  
beta-D-GlcpA-(1->3)-beta-D-GlcpNAc 
beta-D-GlcpA-(1->4)-beta-D-Glcp-(1->3)-beta-D-GlcpA-(1->4)-beta-D-GlcpOCH2CH2N3 
beta-D-GlcpA-(1->6)-beta-D-Galp 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->2-)alpha-D-Galp 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->4)]-[beta-D-GlcpNAc-(1->6)]-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-alpha-D-GalpNAc +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-D-Manp +  
beta-D-GlcpNAc-(1->4)-[beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc +  
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->6)-alpha-D-GalpNAc +  
beta-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc6S-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-glucose +   
beta-D-glucose 6-phosphate 
beta-D-glucosyl-N-(octadecanoyl)sphinganine 
beta-D-mannose +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-alpha-D-Manp +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-beta-D-Manp +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-D-Manp +  
beta-D-Manp-(1->4)-alpha-D-Glcp-(1->3)-beta-D-Glcp-(1->4)-[alpha-D-GlcpA-(1->3)]-beta-D-Manp-(1->4)-alpha-D-Glcp +  
beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->3)-beta-D-QuiNAc-yl group 
beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-yl group 
beta-D-Tyvp-(1->3)-beta-D-GalpN-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpN6,OMe2 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc6,OMe2 
beta-D-Tyvp2Me-(1->3)-beta-D-GalpN6,OMe2 
beta-D-Tyvp2Me-(1->3)-beta-D-GalpNAc-OMe 
beta-elemene +  
beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-R group +  
beta-L-fucosyl-(1->3)-N-acetyl-beta-D-glucosamine 
beta-L-Fucp-(1->2)-alpha-D-Galp 
beta-L-Fucp-(1->3)-alpha-D-Galp 
beta-L-Fucp-(1->4)-alpha-D-Galp +  
beta-lactam antibiotic allergen +   
beta-lapachone  
beta-melibiose 
beta-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-NeupNAc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-peltatin 
beta-thujaplicin  
beta-tocotrienol  
betulin +   
betulinic acid +   
bexarotene  
BF 4 
BF 5 
BF 6 
BGJ-398 
BGT226 
BGT226 free base 
bianfugenine 
bicalutamide  
bielschowskysin 
bigelovin 
BIIB021 
binimetinib  
biochanin A +   
bis(S-citronellalthiosemicarbazonato)nickel(II) 
bisantrene 
Bismark brown Y 
bistratamide E 
bistratamide F 
bistratamide G 
bistratamide H 
bistratamide I 
bistratamide J 
BKM120 
bleomycin A2  
bleomycin A5  
bleomycin B2 
bleomycin hydrochloride 
BML-210 
BMS-214662 
BMS-754807  
borrelidin  
bortezomib  
bosutinib +   
bosutinib hydrate 
bowdichione 
BPDZ 711 
brasilicardin A 
brasiliquinone A 
brasiliquinone B 
brasiliquinone C 
brasixanthone B 
brasixanthone C 
brasixanthone D 
brazilein  
brazilin  
brequinar  
brequinar sodium 
brevipolide A 
brevipolide B 
breynceanothanolic acid 
brivanib +  
brivanib alaninate 
bromophycolide A 
bromotopsentin 
bruceanol D 
bruceanol E 
bruceanol F 
bruceine D 
Brucella O-antigen 
Brucella sp. O-PS A-antigen 
Brucella sp. O-PS M-antigen 
bruceolide +  
bryostatin 1  
bryostatin 2  
bufalin  
buformin 
burseran 
busulfan  
butein  
C80 D-glucose mono(keto-meromycolate) 
cabazitaxel  
cabergoline  
cabozantinib +   
cabozantinib malate 
cadiyenol 
caerulomycin A 
caerulomycin C 
caerulomycin F 
caerulomycin G 
caerulomycin H 
caerulomycin I 
caerulomycin J 
caerulomycin K 
caerulomycinamide 
caerulomycinonitrile 
cafestol  
calcitriol +   
calicheamicin gamma1(I) 
callophycoic acid A 
callophycoic acid C 
callophycoic acid D 
callophycoic acid E 
callophycoic acid F 
callophycoic acid G 
callophycoic acid H 
callophycol A 
callophycol B 
calotropone 
camostat  
camostat mesylate 
camptothecin  
canertinib  
capecitabine  
capilliposide B 
carbamazepine-10,11-epoxide  
carbohydrate allergen +  
carbonarone A 
carboplatin  
cardivin A 
cardivin B 
cardivin C 
cardivin D 
carfilzomib  
carminomycin +  
carmustine  
carnosic acid  
carnosine +   
carvone +   
caseamemebrol A 
caseamemebrol B 
caseanigrescen A 
caseanigrescen B 
caseanigrescen C 
caseanigrescen D 
caudatin-3-O-beta-cymaropyranoside 
CBL0137 
CCT-018159 
CCT251545 
CD532 
celastrol  
celebixanthone +  
cembra-2,7,11-triene-4,6-diol 
centaureidin 
ceramide allergen +  
cerberin 
ceritinib  
cetrorelix +   
cetrorelix acetate 
CG-1521 
CGP-42112A  
CGS 15943  
CH5126766 
chaetoglobosin B 
chaetoglobosin D 
chaetoglobosin E 
chaetoglobosin F 
chaetoglobosin G 
chaetoglobosin J 
chaetoglobosin L 
chaetoglobosin Q 
chaetoglobosin T 
chelerythrine  
CHIR-98014  
chlorambucil  
chloramine T  
chlorotrianisene  
choline +   
chondramide A +  
chondramide B 
chondramide C +  
chondramide D 
chrysin +   
chrysosplenol C 
CHZ868 
cidofovir anhydrous +   
cidofovir dihydrate 
CIGB-300 
ciglitazone  
ciguatoxin ABC ring fragment 
ciguatoxin ABCDE ring fragment 
ciguatoxin JKLM ring fragment 
CII259-273 
ciliatamide B 
cirsilineol  
cis-9-nonadecenoic acid 
cisplatin  
cladoniamide G 
cladribine  
clavulone II  
clethroidoside C 
clethroidoside D 
clethroidoside F 
clionastatin A 
clionastatin B 
clodronic acid  
clofarabine  
clofibric acid +   
CNDAC +  
cobalt chloride hexahydrate 
cobalt dichloride +   
cobimetinib  
cobimetinib fumarate 
cocamidopropyl betaine 
cochinchinone A 
cochinchinoxanthone 
colanic acid 
colpol 
columbianadin 
comazaphilone D 
comazaphilone E 
comazaphilone F 
copanlisib +   
copanlisib dihydrochloride 
cordycepin triphosphate 
cordyol C 
corynoline 
costunolide +   
coumermycin A1 
CP-724714 
crassolide 
crassumolide A 
cratoxyarborenone A 
cratoxyarborenone B 
cratoxyarborenone C 
cratoxyarborenone D 
cratoxyarborenone E 
cratoxyarborenone F 
cremeomycin 
crenolanib 
crizotinib +   
cryptolepine  
cryptopleurine 
cucurbitacin E 2-O-beta-D-glucopyranoside 
cucurbitacin I +   
cudraflavone C 
cudratricusxanthone A  
cumingianoside A 
cumingianoside B 
cumingianoside C 
cumingianoside D 
cumingianoside E 
cumingianoside F 
curacozole 
curcumin +   
CX-5461 
cyclodepsipeptide 2 
cyclohexyl isocyanate  
cyclophosphamide +   
cyclophosphamide hydrate 
cystodytin D +  
cystodytin E +  
cystodytin F 
cystodytin G 
cystodytin H 
cystodytin I 
cystothiazole A 
cytarabine  
cytochalasin D  
cytoglobosin C 
cytoglobosin D 
cytotrienin A 
d(Gs)19dG 
D-alpha-D-Hepp-(1->6)-beta-D-Glcp 
D-glucaric acid +  
D-mannitol +   
dabrafenib +   
dabrafenib mesylate 
dacarbazine +   
dacomitinib  
dactolisib  
daidzein +   
daidzein(1-) 
daphnoretin 
dasatinib (anhydrous) +  
dasatinib monohydrate 
daunorubicin +   
DDM-838 
deacetyllaurenobiolide 
deacetyltanghinin 
decarboxysuprofen 
decarboxytiaprofenic acid 
decursinol 
deguelin  
dehydroabietic acid 
dehydrocostus lactone  
dehydroepiandrosterone 7-O-(carboxymethyl)oxime 
DEL-22379 
delanzomib 
delphinidin +   
delphinidin(1-) 
Delta(12)-prostaglandin J3 
Delta(9)-tetrahydrocannabinol +   
delta-tocotrienol  
demethoxycurcumin  
deoxypodophyllotoxin  
dequalinium +   
dequalinium chloride 
desferrioxamine E 
devazepide  
dexamethasone +   
dexormaplatin 
dexrazoxane hydrochloride 
DH334 
DH334(1+) +  
diallyl disulfide  
diallyl trisulfide  
dianversicoside A 
dianversicoside B 
dianversicoside C 
dianversicoside D 
dianversicoside E 
dianversicoside F 
dianversicoside G 
diarsenic trioxide  
diazepinomicin 
diaziquone  
diazomethane 
dibenzothiazol-2-yl disulfide  
dibenzoylmethane +   
dicerandrol A 
dicerandrol B 
dicerandrol C 
dicyclohexylmethane-4,4'-diisocyanate  
diethylstilbestrol +   
diflomotecan 
Dig-Cy5 
digoxin +   
dihydromotuporamine C 
diisocyanate +   
dilopholide 
dimethyl cardiolipin 
dinochrome A 
dioscin  
diosgenin +   
diosmetin +   
diphenylmethane monoisocyanate 
diphenylmethane-4,4'-diisocyanate  
diphosphatidyl propylene glycol 
diplotrin B 
Disperse Blue 124 
Disperse Red 1 
disulfiram  
diuvaretin 
DMH1 
Dnp-Asn-Gln 
Dnp-Gln 
Dnp-Nor-Gln 
Dnp-Sar-Gln 
Dnp-Thr-Gln 
Dnp-Trp-Gln 
docetaxel anhydrous +  
docetaxel trihydrate 
dolastatin 10 
doxazosin +   
doxifluridine  
dromostanolone propionate 
drug allergen +   
dT4 
dT6 
dT8 
dTT(6-4)TT 
dutomycin 
E-3810 
E-3810 free base 
E. coli 180/C3 O-specific polysaccharide 
E. coli O5:K4:H4 O-specific polysaccharide 
E. coli O65:K-:H- O-specific polysaccharide 
ebselen  
ecgonine benzoate  
edelfosine  
EG00229 
ekatetrone 
elaeodendroside B 
elaeodendroside F 
elaeodendroside G 
elaeodendroside T 
elaeodendroside U 
elaeodendroside W 
elaidylphosphocholine 
elephantin 
elesclomol +   
elesclomol-Cu(II) 
elisidepsin 
ellipticine  
elongatol A 
elongatol E 
emarginatine B 
emarginatine F 
embelin +   
emetine +   
emetine dihydrochloride +  
emetine dihydrochloride hydrate 
emodin +   
emodin(1-) 
enasidenib 
englerin A 
ENPAVHFFKNIVTPRTP 
ENPVVAFFKNIVTPRTP 
ENPVVHFFFNIVTPRTP 
ENPVVHFFKNIVTPRTP 
ENPVVHFFYNIVTPRTP 
enrofloxacin  
ent-kaur-16-en-19-oic acid 
enterobacterial common antigen 
entinostat +   
enzalutamide  
epi-silvestrol 
epi-tulipinolide 
epothilone A  
epothilone B  
erastin  
erdasporine A 
erdasporine B +  
erdasporine C 
ergolide 
ergosterol peroxide  
eribulin 
eribulin mesylate 
erlotinib +   
erlotinib hydrochloride  
erybraedin A 
esculeoside A 
esperamicin A1 
estramustine +   
estriol 3-O-(beta-D-glucuronide)  
estrone +   
etanidazole  
ethyl dihydrogen phosphate +   
ethyl hydrogen phosphate(1-) 
ethyl isothiocyanate 
ethyl methanesulfonate  
ethyl phosphate(2-) 
ethyl trans-caffeate  
ethylene glycol dimethacrylate  
ethylenediamine dihydrochloride 
etidronate disodium 
etidronic acid  
etoposide  
eucalyptal A 
eucalyptal B 
eucalyptal C 
eudistomin C 
eugeniin 
eugenol +   
eupaheliangolide A 
eupatilin  
eupatolide 
eupatorin  
euphornin L 
eurycomanone  
eurysterol A 
eurysterol A sulfonic acid 
eurysterol B 
eurysterol B sulfonic acid 
everolimus  
exemestane  
F390B 
F390C 
fangchinoline  
fazarabine 
FD-211 
ferroptocide 
ferruginol +   
fingolimod +  
fingolimod phosphate 
FINO2 
firocoxib 
flavokawain B  
floxuridine  
fluazinam  
flucofuron 
fludarabine phosphate 
fluorescein isothiocyanate +   
fluorescein-DNP hapten 
fluoxymesterone  
flutamide  
formaldehyde +   
formestane  
formycin A +  
fostriecin  
fotemustine  
FR901463 
FR901464 
FR901465 
framycetin +   
fruticoside A 
fucoidan  
fulvestrant  
fusarithioamide A 
fuzanin D 
FX1 
G-573 
gallic acid +   
gamma-glutamyl-Se-methylselenocysteine 
gamma-mangostin  
gamma-tocotrienol 
ganglioside GM2 (18:0) +  
GANT61 
gartanin 
gastrin-17  
gaudichaudiic acid F 
gaudichaudiic acid G 
gaudichaudiic acid H 
gaudichaudiic acid I 
GDC-0623 
GDC-0879 
gedunin +   
gefitinib +   
geldanamycin +   
gelomulide K 
gelomulide M 
gemcitabine +   
gemcitabine hydrochloride 
gemini-0072 
gemini-0097 
genistein +   
gentisyl alcohol 
geraniol +   
ghrelin  
GI254023X 
gibberosin K 
gibberosin L 
gigantetronenin 
gigantrionenin 
gilteritinib 
gilvusmycin 
gingerol  
ginkgetin  
ginkgolide B  
ginsenoside C-K  
ginsenoside F2  
ginsenoside Mc 
ginsenoside Mx 
ginsenoside Re  
ginsenoside Rf  
glasdegib 
glaucarubinone 
GlcpN-(1->1)-alpha-D-Galp 
glionitrin A 
globostellatic acid A 
globostellatic acid B 
globostellatic acid C 
globostellatic acid D 
globosumone A 
globosumone B 
globosuxanthone A 
glochierioside A 
glochierioside B 
Glu-Trp 
glucose 6-monomycolate (C85) 
glucuronoxylomannan  
glycerol mono(keto-meromycolate) 
glycerol monomycolate (C85) 
glyceryl monothioglycolate 
glycyrol  
glyoxal +   
glyoxal-lysine dimer 
gnidilatimonoein 
GPL C-II 
GPL P-I 
GPL P-II 
GPL P-IV 
GPL-1 
GPL-21 
GPL-25 
GPL-26 
GPL-4 
GPL-8 
GPL-9I 
granaticin 
grassypeptolide 
griffithane A 
griffithane B 
griffithane D 
GSK1059615 
GSK2656157  
GSK2879552 
GSK343  
GSK690693  
guanazole 
gummiferaoside A 
gummiferaoside B 
gummiferaoside C 
HA15 
hadacidin 
HC toxin  
hedychilactone D 
helenalin  
heliangin 
herbacetin  
hesperetin +   
hexahydrophthalic anhydride 
hexamethylene diisocyanate  
hexyl isocyanate 
HG-9-91-01 
hinokiflavone  
hippeastrine 
hispidulin  
histrelin +  
histrelin acetate 
holomycin +  
holothurin A3 
holothurin A4 
horminone +  
HS44 
hydrazinocurcumin 
hydroxycitronellal  
hydroxysafflor yellow A  
hydroxytyrosol +   
hydroxyurea  
hygrolidin 
hyperforin  
hyperxanthone C 
hyperxanthone E 
hypocrellin D 
hypothemycin 
ibrutinib  
icariside II  
ICI-164384  
ICRF-193 
idelalisib  
ifosfamide  
iFSP1 
igalan 
ikarugamycin +  
ilomastat  
imatinib +  
imatinib methanesulfonate 
IMID-2 
imiquimod  
immunogen +  
indanomycin 
indirubin 
indisulam 
indole-3-methanol +   
ingenol mebutate 
irilone +   
irinotecan  
irinotecan hydrochloride (anhydrous) +  
irinotecan hydrochloride hydrate 
isariotin F 
isobrucein A 
isochamuvaritin 
isoeugenol +   
isoflavipucine 
isoginkgetin 
isoiguesterin 
isoliquiritigenin +   
isoliquiritin 
isoorientin +   
isopentenyl diphosphate  
isopentenyl diphosphate(3-) 
isostrychnine 
isotretinoin  
isowigtheone hydrate 
ivosidenib 
ixabepilone 
ixazomib +   
ixazomib citrate 
ixerochinolide 
jacarelhyperol A 
jaceosidin  
jadomycin B 
jaspamide  
jaspamide B 
jaspamide C 
jaspamide D 
jaspamide E 
jaspamide F 
jaspamide G 
jaspamide H 
jaspamide J 
jaspamide K 
jaspamide L 
jaspamide M 
jaspamide N 
jaspamide O 
jaspamide P 
jasplakinolide D 
jasplakinolide Q 
jasplakinolide R1 
jerantinine A +  
jerantinine B 
jerantinine C +  
jerantinine D 
jerantinine E 
jerantinine F 
jineol 
JM335 
JP-8g 
JQ1 
JTE-607 dihydrochloride 
JTE-607 free base 
juglanin A 
juglanin B 
JWH-133 
K antigen 
kadlongilactone A 
kadlongilactone B 
kaempferol 3,7-di-O-alpha-L-rhamnoside 
kaempferol 3-O-(5-O-acetyl-alpha-D-apiofuranosyl)-7-O-alpha-L-rhamnopyranoside 
kaempferol 7-O-(2,3-di-E-p-coumaroyl-alpha-L-rhamnopyranoside) 
kaempferol 7-O-(2-E-p-coumaroyl-alpha-L-rhamnopyranoside) 
kahweol  
kansuiphorin A 
kansuiphorin B 
keto mycolic acid 
keto-meromycolic acid +  
Ki11502 
kidjoranin-3-O-alpha-diginopyranosyl-(1->4)-beta-cymaropyranoside 
kidjoranin-3-O-beta-digitoxopyranoside 
kievitone +  
kinanthraquinone 
kitastatin 1 
knipholone +  
koshikamide A2 
KP1019 
KP1339 
Ku-0063794  
kweichowenol B 
L-744,832 
L-778,123 (free base) +  
L-778,123 hydrochloride 
L-canaline 
L-glycero-alpha-D-manno-Hepp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->3)-L-glycero-alpha-D-manno-Hepp-(1->5)-alpha-Kdo 
L-idopyranose 6-monomycolate 
L-Thr-(N->6)-alpha-D-Galp6d3OAc-(1->3)-beta-D-GalpNAc 
lactogangliotetraosylceramide 
laminarin  
lamivudine  
lanperisone 
lanperisone hydrochloride 
lapachol  
lapatinib  
lasofoxifene  
laulimalide 
laurebiphenyl 
laurenobiolide +  
LB42908 
LDC4297 
leachianone A 
leflunomide  
lehualide F 
lehualide G 
lehualide H 
lehualide I 
lejimalide A 
lejimalide B 
lenalidomide  
lentinan  
lenvatinib 
lenvatinib mesylate 
letrozole  
leucospiroside A 
leuprolide +   
leuprolide acetate 
levamisole +   
LFM-A13 
lificiguat 
ligstroside 
linalool 6-hydroperoxide 
linalool 7-hydroperoxide 
linalool hydroperoxide +  
linifanib 
lipoarabinomannan  
liriodenine 
lissamine fast yellow 
lissamine fast yellow (acid form) 
lissoclibadin 1 
lissoclibadin 2 
lissoclibadin 3 
litreol  
LLP-3 
lomustine  
lonafarnib  
lonazolac 
lonazolac calcium 
longicalycinin A 
longirostrerone A 
longirostrerone B 
longirostrerone C 
longirostrerone D 
lonidamine +   
Lonsurf 
loracarbef anion 
lorlatinib  
lovastatin +   
LRRK2-IN-1 
lucanthone +   
lucialdehyde B 
lucialdehyde C 
lucidenic acid N  
luminespib 
lupulone 
luteolin +   
luzonial A 
luzonial B 
luzonidial B 
LY-2090314 
LY-2157299  
LY3009120 
lychnostatin 1 
lychnostatin 2 
lyratol C 
lyratol D 
Lys-GalA 
Lys-Thr-Trp-Gly-Lys-Asn-Leu-Val-Phe 
lysikokianoside 1 
maackiaflavanone A 
maackiaflavanone B 
maackiapterocarpan A 
macaflavanone G 
macaranone A 
macluraxanthone B 
macluraxanthone C 
maleic anhydride 
manassantin A 
manassantin B 
ManNAz-DBCO-Pam3CSK4 
manool 
manumycin A  
manzamine A +  
maoecrystal Z 
marimastat  
marineosin A 
marineosin B 
marinobufagenin  
masitinib  
maslinic acid +   
masoprocol  
maytansine +  
maytenfolone A 
MCB-613 
mechlorethamine hydrochloride 
meclofenamic acid  
medroxyprogesterone acetate  
mefuparib 
mefuparib hydrochloride 
megathyrin A 
megestrol +   
megestrol acetate  
melatonin +   
melittin  
melophlin P 
melophlin Q 
melophlin R 
melophlin S 
melphalan  
menadione +   
mercaptopurine +   
mertansine 
meso-tetrakis(N-methyl-4-pyridyl)porphine tetrakis(p-toluenesulfonate) 
meso-tetrakis(N-methyl-4-pyridyl)porphine(4+) +   
metachromin S 
metachromin T 
metal allergen +   
metal cation allergen +   
methacholine +   
metholone +  
methotrexate  
methoxsalen +   
methoxy mycolic acid 
methoxyacetic acid  
methyl (indol-3-yl)acetate 
methyl 4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-2-O-methyl-alpha-D-mannopyranoside 
methyl 5-aminolevulinate +  
methyl 5-aminolevulinate hydrochloride 
methyl dihydrogen phosphate  
methyl gamma-linolenate 
methyl isocyanate +   
methyl methacrylate  
methyl nonanoate 
methyl phosphate(2-) 
Methyl violet 2B 
Methyl violet 2B free base 
methylglyoxal-lysine dimer 
methylhexahydrophthalic anhydride 
methylseleninic acid  
methylselenol 
methyltestosterone  
methyltetrahydrophthalic anhydride 
miboplatin 
michaolide A 
michaolide B 
michaolide C 
michaolide D 
michaolide E 
michaolide F 
michaolide G 
michaolide H 
michaolide I 
michaolide J 
michaolide K 
miconazole +   
miconazole nitrate 
microclavatin 
midazolam +   
midazolam hydrochloride 
midostaurin  
migrastatin 
miltefosine  
minabeolide 1 
minheryin G 
minquartynoic acid 
mithramycin  
mitoguazone 
mitoguazone hydrochloride +  
mitoguazone hydrochloride hydrate 
mitomycin A 
mitomycin B 
mitomycin C  
mitoxantrone +   
mitoxantrone dihydrochloride 
MK-8353 
ML-210 
ML240 
MMP-9-IN-1 
mogrol +  
mollicellin B 
mollicellin C 
mollicellin E 
mollicellin F 
mollicellin H 
mollicellin J 
mollicellin K 
mollicellin L 
mollicellin M 
mollicellin N 
momelotinib 
monascin  
monascorubrin 
monastrol 
monobenzone  
monodictyochromone A 
monodictyochromone B 
monodictysin B 
monodictysin C 
morellic acid +  
morellin +  
morin  
moromycin A 
moromycin B 
morusin  
motixafortide 
MP-A08 
MTIC 
mucronulatol 
muramyl dipeptide  
mycophenolic acid +   
myo-inositol hexakisphosphate  
myriaporone 3 
Myricanone 
myricetin +   
myriocin  
myrsinoic acid A 
N(1),N(12)-diethylspermine  
N(2)-(5'-phosphopyridoxyl)-L-lysine 
N(2)-([biphenyl]-4-ylsulfonyl)-N-hydroxy-N(2)-isopropoxy-D-valinamide 
N(4)-[alpha-L-fucosyl-(1->3)-N-acetyl-4-O-glycosyl-D-glucosaminyl]-L-asparagine residue 
N(6)-(Delta(2)-isopentenyl)adenosine +  
N(6)-acetyl-N(2)-(5'-phosphonatopyridoxyl)-L-lysinate(2-) 
N(6)-acetyl-N(2)-(5'-phosphopyridoxyl)-L-lysine 
N(6)-carboxymethyl-L-lysine +  
N(6)-dansyl-L-lysine 
N(6)-Dnp-Lys-NH2 
N,N'-dibutylthiourea 
N,N'-diethylthiourea 
N,N'-diphenylthiourea  
N,N-dimethyltetradecanamide 
N,O-(Dnp)2-Tyr-Gln 
N,S-isopropylidene-D-penicillamine 
N-(2-[(2-aminoethyl)(methyl)amino]-5-\{[3-cyano-7-(cyclopropylamino)pyrazolo[1,5-a]pyrimidin-5-yl]amino\}phenyl)acetamide 
N-(2-methoxyethyl)-4-\{[6-(pyridin-4-yl)quinazolin-2-yl]amino\}benzamide 
N-(5'-phosphonatopyridoxyl)-D-alaninate(2-) 
N-(5'-phosphonatopyridoxyl)-L-alaninate(2-) 
N-(5'-phosphopyridoxyl)-D-alanine 
N-(5'-phosphopyridoxyl)-L-alanine 
N-(5-\{[(5-tert-butyl-1,3-oxazol-2-yl)methyl]sulfanyl\}-1,3-thiazol-2-yl)piperidine-4-carboxamide 
N-(p-hydroxyphenyl)glycine 
N-(p-nitrophenylphosphobutanoyl)glycine 
N-(trans-4'-nitro-4-stilbenyl)-N-methyl-5-aminopentanoic acid 
N-[(2S,3S,4R)-1-(alpha-D-galactosyloxy)-3,4-dihydroxy-11-phenylundecan-2-yl]hexacosanamide 
N-[(2S,3S,4R)-1-(alpha-D-galactosyloxy)-3,4-dihydroxy-13-phenyltridecan-2-yl]hexacosanamide 
N-[(2S,3S,4R)-1-(alpha-D-galactosyloxy)-3,4-dihydroxy-6-phenylhexan-2-yl]hexacosanamide 
N-[(2S,3S,4R)-1-(alpha-D-galactosyloxy)-3,4-dihydroxy-8-phenyloctan-2-yl]hexacosanamide 
N-[(2S,3S,4R)-1-(alpha-D-galactosyloxy)-3,4-dihydroxyoctadecan-2-yl]hexacosanethioamide 
N-[(3R,4R,5S,6R)-5-[(2S,3R,4R,5S,6R)-3-Acetamido-5-[(2S,3S,4S,5R,6R)-4-[(2S,3S,4S,5S,6R)-3-[(2S,3R,4R,5S,6R)-3-acetamido-5-[(2S,3R,4R,5R,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-[[(2S,3S,4S,5S,6R)-3-[(2S,3R,4R,5S,6R)-3-acetamido-5-[(2S,3R,4R,5R,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxymethyl]-3,5-dihydroxyoxan-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-2,4-dihydroxy-6-(hydroxymethyl)oxan-3-yl]acetamide 
N-[11-([1,1'-biphenyl]-4-yl)undecanoyl]-1-O-(alpha-D-galactopyranosyl)phytosphingosine 
N-[4-(4-nitrophenylphospho)butanoyl]-D-alanine 
N-[4-(4-nitrophenylphospho)butanoyl]-L-alanine 
N-[6-(4-fluorophenyl)hexanoyl]-1-O-(alpha-D-galactopyranosyl)phytosphingosine 
N-[6-([1,1'-biphenyl]-4-yl)hexanoyl]-1-O-(alpha-D-galactopyranosyl)phytosphingosine 
N-[8-([1,1'-biphenyl]-4-yl)octanoyl]-1-O-(alpha-D-galactopyranosyl)phytosphingosine 
N-\{4-[(3-bromophenyl)amino]quinazolin-6-yl\}but-2-ynamide 
N-\{beta-D-Man-(1->2)-beta-D-Man-(1->2)-beta-D-ManO[CH2]3S[CH2]2NHC(O)[CH2O]4C(O)[CH2]2S[CH2]2C(O)\}-YGKDVKDLFDYAQE-NH-[CH2O]3[CH2]2C(O)NHC(CO2H)[CH2]4N3 +  
N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 
N-acetyl-alpha-D-galactosamine +  
N-acetyl-alpha-D-galactosaminyl group +  
N-acetyl-alpha-D-galactosaminyl-(1->3)-[alpha-L-fucosyl-(1->2)]-beta-D-galactose derivative 
N-acetyl-alpha-neuraminic acid +  
N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucose +  
N-acetyl-alpha-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosamine 
N-acetyl-beta-D-galactosamine +  
N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide +  
N-acetyl-beta-D-galactosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl group 
N-acetyl-beta-D-glucosamine +   
N-acetyl-beta-D-glucosaminyl-(1->4)-N-acetyl-beta-D-glucosamine +  
N-acetyl-beta-neuraminic acid +   
N-acetyl-beta-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosamine 
N-acetylneuraminyl group 
N-acylphytosphingosine +   
n-butyl isocyanate 
N-desmethylenzalutamide 
N-ethyl-5'-carboxamidoadenosine  
N-glycoloyl-beta-D-glucosamine 
N-glycoloyl-beta-neuraminic acid 
N-hexacosanoylisoglobotriaosyl ceramide 
N-hydroxyguanidine 
N-isopropyl-N'-phenyl-p-phenylenediamine  
N-methylmesoporphyrin 
N-octanoylisoglobotriaosyl ceramide 
N-oleoyltaurine 
N-palmitoyl-S-[2,3-bis(palmitoyloxy)propyl]-Cys-Ser-Lys-Lys-Lys-Lys  
N-phenylglycine 
naphthazarin  
naringin  
nataloe-emodin +  
navitoclax  
nelarabine 
nelfinavir  
nelfinavir mesylate 
neoantigen +  
neobavaisoflavone +   
neocarzinostatin chromophore 
neohesperidin 
neomycin sulfate 
neratinib  
nickel atom +   
nickel sulfate +   
nidulalin A 
nigerapyrone B 
nigerapyrone D 
nigerapyrone E 
nigranoic acid 
nilotinib  
nilutamide  
nimustine  
nimustine hydrochloride 
nintedanib  
nintedanib esylate 
niraparib  
nitensidine E 
nitrososulfadiazine 
nitrososulfamethoxazole  
nitrososulfapyridine 
nitrosulindac 
NK154183A 
NK154183B 
nobiletin  
nocodazole  
nogalamycin 
nonanedioic acid +   
norathyriol +   
nortriptyline  
NS-398  
Nutlin +   
O-(2-aminoethyl)-L-serine 
O-(2-aminopropyl)-O'-(2-methyoxyethyl)octa(propylene glycol) 
O-(chloroacetylcarbamoyl)fumagillol  
O-(N-acetyl-alpha-D-galactosaminyl)-L-serine residue 
O-(N-acetyl-alpha-D-galactosaminyl)-L-threonine residue 
O-[N-acetyl-alpha-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosaminyl]-L-serine residue 
O-hydroxy(phenyl)phosphinoyl ecgonine methyl ester 
obochalcolactone 
obolactone 
obyanamide 
ochrocarpin A 
ochrocarpin B 
ochrocarpin C 
ochrocarpin D 
ochrocarpin E 
ochrocarpin F 
ochrocarpin G 
ochrocarpinone A 
ochrocarpinone B 
olaparib  
oleanolic acid 3-O-[O-beta-D-glucopyranosyl-(1->4)-O-beta-D-glucopyranosyl-(1->3)-O-alpha-L-rhamnopyranosyl-(1->2)-alpha-L-arabinopyranoside] 
oleocanthal 
oleuropein +   
oligomycin A  
oligomycin D 
oltipraz  
omacetaxine mepesuccinate  
onalespib 
oncrasin-1  
ophiobolin C 
orantinib  
orbiculin A 
orbiculin E 
orbiculin F 
orbiculin G +  
oregon green 488 
oridonin  
ormaplatin 
ornidazole  
oroxylin A +   
oroxylin A(1-) 
osimertinib  
osimertinib mesylate 
ospemifene  
ossamycin 
OSU-03012  
oviedomycin 
oxaline 
oxaliplatin +   
oxirane +   
oxypeucedanin hydrate acetonide 
oxyphenbutazone +   
oxyphenbutazone hydrate 
p-aminodiphenylamine +   
p-nitrobenzyl glutaryl glycinic acid 
p-nitrophenylphosphocholine 
P. aeruginosa immunotype 3 O-specific polysaccharide 
P. aeruginosa serotype O11 O-specific polysaccharide 
P. mirabilis 9B-m O-specific polysaccharide 
P. mirabilis O11 O-specific polysaccharide 
P. mirabilis O23 O-deacetylated O-specific polysaccharide 
P. mirabilis O24 O-specific polysaccharide 
P. mirabilis O29 O-specific polysaccharide 
P. mirabilis O43 O-specific polysaccharide 
P. mirabilis O6 O-specific polysaccharide 
P. stuartii O4 O-specific polysaccharide 
paclitaxel +   
palau'amide 
palbociclib  
palmitoleyl alcohol +  
palmityl acetate 
pannarin 
panobinostat  
panobinostat lactate 
papuamide B 
Para-LP-01 
paraminabeolide A 
pasireotide  
pasireotide aspartate 
pateamine 
patent blue V 
pazopanib  
pazopanib hydrochloride 
PD 0325901  
PD-166866 +   
PD158780 
PD173074  
pectolinarin 
pederin 
peloruside A 
pemetrexed  
pemetrexed disodium +  
pemetrexed disodium heptahydrate 
penicillin +   
penicillin allergen +   
penicilloyl group allergen +  
penta-O-acetyl-alpha-D-galactose 
peonidin +   
peonidin chloride  
peptide allergen +  
perillic acid +   
pevonedistat  
pexidartinib 
PF-00477736  
PHA-533533 
PHA-665752  
phantomolin 
phaseolotoxin 
Phe(4-NO2)-Gln 
phenethyl caffeate  
phenethyl isothiocyanate +   
phenformin  
phenolic phthiocerol +  
phenoxyacetic acid +   
phenyl isocyanate  
phenyl isothiocyanate 
phenylacetic acid +   
phenylarsine oxide  
phleomycin 
phleomycin D1 +  
phloretin +   
phomacin A 
phomacin B 
phomacin C 
phomoxanthone A 
phomoxanthone B 
phorbol 13-acetate 12-myristate  
phosphatidylinositol mannoside +  
phosphoantigen +   
phosphocholine +   
phthalaldehyde  
phthalic anhydride +   
phthalyl group 
phthiocerol A +  
physalin B 
physalin D 
physalin F 
physcion +   
phytosphingosine +   
PI-103 
piceatannol +  
picropodophyllotoxin  
pierreione A 
pierreione B 
PIM6 
pinocembrin +   
pipobroman 
pirazofurin 
PJ34 
PJ34 hydrochloride 
PK-11195  
plaunotol  
pleosporone 
plerixafor  
plitidepsin  
plumbagin  
PLX-4720  
PM-94128 
podophyllotoxin +   
poly(I:C)  
polyketomycin 
pomalidomide  
ponatinib  
porfimer 
porfimer sodium 
potassium dichromate  
PP121 
pracinostat 
pralatrexate 
prednisolone +   
prednisolone phosphate 
prednisone +   
prenyl diphosphate  
prenyl diphosphate(3-) 
prenylcandidusin A 
prenylcandidusin B 
prenylcandidusin C 
prenylterphenyllin 
prenylterphenyllin A 
prenylterphenyllin B 
prenylterphenyllin C 
primin 
prinomastat  
prinomastat hydrochloride 
pristane  
procarbazine  
procarbazine hydrochloride 
procyanidin B4 +  
prodigiosin  
promegestone  
propane-1,2-diol +   
prostaglandin J3 +  
Proteus genomospecies 3J-r O-specific polysaccharide 
protopanaxadiol +   
psorospermin  
pterostilbene  
purine-6-thiol  
puromycin +   
pyridine-2-thiol 
pyridoxatin 
pyrimidine-2-thiol 
pyrrolidine dithiocarbamate  
pyrvinium  
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 
quassimarin 
quaternium-15 
quercetin +   
quercetin 3,4'-dimethyl ether 
quercetin 3-O-beta-D-glucopyranoside  
quercetin 4'-O-beta-D-glucopyranoside  
quizartinib  
rac-crizotinib 
ravidomycin 
Reactive Red 6 hapten copper complex 
rediocide G 
regorafenib +   
regorafenib hydrate 
resorcinol monobenzoate 
respirantin 
retaspimycin 
retaspimycin hydrochloride 
reumycin +  
reversine 
rhamnacene +  
rhinacanthin C 
rhizoxin 
rhosin 
ribothymidine +  
ridaforolimus  
rifampicin +   
rigosertib 
rigosertib sodium 
Ro 48-8071 
Ro 48-8071 fumarate 
Ro 5-3335 
robustaflavone +  
robustaflavone 7,4',7''-trimethyl ether 
rocaglamide  
roducitabine 
rohitukine 
romidepsin  
rostratin A 
rostratin B 
rostratin C 
rostratin D 
rotenone  
rottlerin  
rotundifolioside A 
rotundifolioside H 
rotundifolioside I 
rotundifolioside J 
rotundifuran 
RSL3 
RSL5 
RU 58668  
rubiarbonol G 
rubiarbonone E 19-acetate 
rubiarboside G 28-acetate 
rubimaillin  
rubitecan  
rubiyunnanol A 
rubiyunnanol B 
rubraxanthone 
rucaparib  
ruxolitinib +   
ruxolitinib phosphate 
S-adenosyl-L-homocysteine  
S-allylcysteine  
S. flexneri serotype 1a O-polysaccharide (O factor 9-negative) 
S. flexneri serotype 1a O-polysaccharide (O factor 9-positive) 
S. flexneri serotype 1b O-polysaccharide (O factor 9-positive) 
S. flexneri serotype 2a O-polysaccharide (O factor 9-negative) 
S. flexneri serotype 2a O-polysaccharide (O factor 9-positive) 
S. flexneri serotype 2a O-specific polysaccharide 
S. flexneri serotype 2b O-specific polysaccharide 
S. flexneri serotype 3a O-specific polysaccharide 
S. flexneri serotype 5a O-polysaccharide (O factor 9-negative) 
S. flexneri serotype 5a O-polysaccharide (O factor 9-positive) 
S. flexneri serotype 5a O-specific polysaccharide 
S. flexneri serotype 5b O-specific polysaccharide 
S. flexneri serotype 6 O-polysaccharide (O factor 9-positive) 
S. flexneri serotype X O-specific polysaccharide 
S. flexneri serotype Y O-polysaccharide (O factor 9-negative) 
S. flexneri serotype Y O-polysaccharide (O factor 9-positive) 
saintopin 
salinosporamide A 
salsalate  
salvianolic acid B  
salvileucalin B 
samaderine B 
samaderine C 
samaderine E 
samaderine X 
samaderine Y 
samaderine Z 
sapacitabine 
saracatinib  
satraplatin  
SC-58125  
SC560 
SCH51344 
SCH772984  
schiprolactone A 
schizolaenone A 
schizolaenone B 
schweinfurthin G 
schweinfurthin H 
sciscllascilloside E-1 
scutebarbatine C 
scutebarbatine D 
scutebarbatine E 
scutebarbatine F 
scutebarbatine G 
scutellarin  
scutianthraquinone A 
scutianthraquinone B 
scutianthraquinone C 
scytalidamide A 
scytalidamide B 
Se-methyl-L-selenocysteine +   
Se-methylselenocysteine +   
secnidazole 
secoaggregatalactone A 
selumetinib  
semaxanib 
semustine  
sepantronium bromide 
sesterstatin 1 
sesterstatin 2 
sesterstatin 3 
Sg17-1-4 
sibiromycin 
silibinin  
silvestrol 
simalikalactone D 
sinularolide B 
sinularolide C 
sinularolide D 
sinularolide E 
sirolimus +   
sitoindoside IX 
SKF-96365 hydrochloride  
SN-38 +   
soblidotin 
sodium 2-amino-5-[(1-methoxy-2-methylindolizin-3-yl)carbonyl]benzoate 
sodium amoxicilloyl group 
sodium arsenite  
sodium aurothiomalate  
sodium aurothiosulfate  
sodium gallate 
sodium globostellatate A 
sodium globostellatate B 
sodium globostellatate C 
sodium globostellatate D 
sodium hydrogensulfite  
sodium meclofenamate monohydrate 
sodium methoxyacetate 
sodium stibogluconate  
solanine 
solasodine(1+) 
somocystinamide A 
sonidegib +   
sonidegib phosphate 
sophoraflavanone A 
sophoraflavanone L 
sorafenib +   
sotorasib 
spiculoic acid A 
spiruchostatin B  
spongotine A 
SQ 26,992 
squaric acid dibutyl ester 
SR9243  
stachsterol 
stattic  
steffimycin D 
steviol +   
stevioside +   
STM2457 
streptokordin 
streptonigrin  
streptozocin  
strongylin A 
strongylophorine-26 
SU4312 
SU6656  
sugiol +  
sulcofuron 
sulcofuron-sodium 
sulfamethoxazole +   
sulfamethoxazole hydroxylamine  
sulfapyridine hydroxylamine 
sulforaphane +   
sulindac +   
sulindac sulfide  
sunitinib +   
suramin  
suramin sodium 
surfactin  
surfactin A +   
surfactin B +   
surfactin C +   
surfactin D +   
swainsonine  
SZL-P1-41 
tabernaemontanine 
tabersonine +  
tacalcitol 
tacedinaline  
taiwanhomoflavone A 
taiwanhomoflavone-B 
TAK-580 
TAK-632 
talaroconvolutin A 
talmapimod 
tamibarotene  
tamoxifen +   
tamsulosin +   
tamsulosin hydrochloride +  
tanariflavanone D 
tandutinib 
tanespimycin  
tangeretin +   
tanghinigenin +  
tanghinin 
tasumatrol E 
tasumatrol F 
TDZD-8 
tectochrysin  
temozolomide  
teniposide  
tenovin-6 
tephrosin +   
terazosin +   
terreic acid 
terrequinone A 
tesevatinib 
tetrachlorophthalic anhydride 
tetradecaethylene glycol 
tetramethylpyrazine  
tetraoleyl cardiolipin 
tetrazolium violet  
TG101209 
thalidomide +   
thiodiglycol  
thiolutin 
thiostrepton  
thymoquinone  
THZ531 
tiazofurine  
tilorone  
tilorone dihydrochloride 
tioguanine +   
tipifarnib  
tipiracil 
tipiracil hydrochloride +  
tirapazamine  
tixocortol pivalate 
TMC-135A 
TMC-135B 
TMC-1A 
TMC-1B 
TMC-1C 
TMC-1D 
TMC-86A 
TMC-86B 
TMC-95A 
TMC-95B 
TMC-95C 
TMC-95D 
TMC-96 
Tnp-Gln 
toluene 2,4-diisocyanate  
toluene 2,6-diisocyanate  
toluene meta-diisocyanate +   
tomatine +  
tomaymycin +  
TOP-53 
topopyrone A 
topopyrone B 
topopyrone C 
topopyrone D 
topotecan  
toremifene  
torin 1  
torin 2 
torkinib 
toxoflavin 
toyocamycin 
trabectedin  
trametinib +   
trametinib dimethyl sulfoxide 
tranilast  
trans-2-hydroxyisoxypropyl-3-hydroxy-7-isopentene-2,3-dihydrobenzofuran-5-carboxylic acid 
trans-4-(dimethylphenylsilyl)-N-methylpiperidine N-oxide 
trans-astringin 
trans-rhaponticin +   
trapoxin A 
trehalose 6,6'-dimycolate 
triaziquone 
tributyrin  
tricetin +   
trichodermin 
trichodimerol 
trichothecin 
trierixin  
trifluridine +   
triforine  
trilobacin 
trilostane  
trimellitic anhydride  
triplatin tetranitrate 
triplatin(4+) +  
triptonide  
triptorelin  
troglitazone  
Trp-Gly-Ile-His-His 
Trp-Tyr-Gly-Tyr-His-His 
tschimganine 
tsugarioside C 
TTT-3002 
tubercidin +   
tubocapsanolide A +  
tubocapsanolide F 
tubulozole 
tulipinolide 
tumour antigen +  
tylosin  
tyrphostin AG 1478  
U0126 +   
U0126.EtOH 
ubiquinol-8 
UCS1025 A 
uracil +   
urdamycin A 
uvaretin 
vadimezan  
vandetanib +   
variecolorquinone A 
variecolorquinone B 
vatalanib +   
vatalanib succinate 
vedelianin +  
vemurafenib  
venetoclax  
verteporfin  
vincristine  
vincristine sulfate 
vincristine(2+) +  
vindesine +   
vindesine sulfate 
vinflunine 
vinorelbine +   
vinorelbine D-tartrate 
vinorelbine L-tartrate 
violacein  
viridicatumtoxin 
vismodegib  
vitetrifolin D 
vitexilactone 
vitexin +   
vorinostat  
wedelolactone  
withaferin A +   
withalongolide A 
withalongolide B 
withalongolide C 
withalongolide G 
withalongolide H 
withanolide D +  
wogonin +   
wortmannin +   
wrightiamine A 
WZ4002 
xanthohumol  
xanthomicrol 
xenoantigen +  
xestospongin C  
XL147  
XL765  
xylitol +   
xylocarpin J 
yadanziolide B 
yadanziolide T 
yahyaxanthone 
YM-216391 
zarzissine 
zhankuic acid A +  
zhankuic acid B 
zhankuic acid C 
ZM447439 
ZSTK-474 

Synonyms
Exact Synonyms: N-[(2S,3S,4R)-1-(alpha-D-galactopyranosyloxy)-3,4-dihydroxyoctadecan-2-yl]hexacosanamide
Related Synonyms: (2S,3S,4R)-1-O-(alpha-D-galactosyl)-N-hexacosanoyl-2-amino-1,3,4-octadecanetriol ;   1-O-(alpha-D-galactopyranosyl)-N-hexacosanoylphytosphingosine ;   Formula=C50H99NO9 ;   Galalpha-Cer(t18:0/26:0) ;   InChI=1S/C50H99NO9/c1-3-5-7-9-11-13-15-17-18-19-20-21-22-23-24-25-26-27-29-31-33-35-37-39-45(54)51-42(41-59-50-49(58)48(57)47(56)44(40-52)60-50)46(55)43(53)38-36-34-32-30-28-16-14-12-10-8-6-4-2/h42-44,46-50,52-53,55-58H,3-41H2,1-2H3,(H,51,54)/t42-,43+,44+,46-,47-,48-,49+,50-/m0/s1 ;   InChIKey=VQFKFAKEUMHBLV-BYSUZVQFSA-N ;   KRN 7000 ;   SMILES=CCCCCCCCCCCCCCCCCCCCCCCCCC(=O)N[C@@H](CO[C@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O)[C@H](O)[C@H](O)CCCCCCCCCCCCCC ;   alpha-GC(C26) ;   alpha-GalCer ;   alpha-GalCer(t18:0/26:0)
Alternate IDs: CHEBI:40662
Xrefs: Beilstein:7326597 ;   CAS:158021-47-7
Xref Mesh: MESH:C103873
Xrefs: PDB:1ZT4 ;   PDB:2PO6 ;   PDBeChem:AGH ;   PMID:11914907 ;   PMID:12473579 ;   PMID:15246159 ;   PMID:16007090 ;   PMID:16458002 ;   PMID:17431340 ;   PMID:17581592 ;   PMID:18418814 ;   PMID:18586489 ;   PMID:19502056 ;   PMID:20080535 ;   PMID:20616071 ;   PMID:21376639 ;   PMID:21394364 ;   PMID:29351991 ;   PMID:8866665 ;   Patent:CA2683681 ;   Reaxys:7326597

paths to the root