Submit Data |  Help |  Video Tutorials |  News |  Publications |  FTP Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
Parent Terms Term With Siblings Child Terms
epitope +   
fragrance +   
methanol +   
(+)-(1R)-1,12-dihydroxy-20-norabieta-5(10),8,11,13-tetraene 
(+)-(3R)-1,7-bis(4-hydroxyphenyl)-(6E)-6-hepten-3-ol 
(+)-(3R)-1-(3,4-dihydroxyphenyl)-7-(4-hydroxyphenyl)-(6E)-6-hepten-3-ol 
(+)-(3R)-1-(3,4-dihydroxyphenyl)-7-(4-hydroxyphenyl)heptan-3-ol 
(+)-(3R)-1-(3,4-dihydroxyphenyl)-7-phenyl-(6E)-6-hepten-3-ol 
(+)-(3R)-3-acetoxy-1-(3,4-dihydroxyphenyl)-7-(4-hydroxyphenyl)-(6E)-6-heptene 
(+)-(3R)-3-acetoxy-1-(3,4-dihydroxyphenyl)-7-(4-hydroxyphenyl)heptane 
(+)-(5S)-12-hydroxy-2-oxo-20-norabieta-1(10),8,11,13-tetraene 
(+)-(5S,10R)-10,12-dihydroxy-7-oxo-20-norabieta-8,11,13-triene 
(+)-(5S,6S,10R)-12-hydroxy-7-oxo-abieta-8,11,13-trien-20-oic acid6,20-lactone 
(+)-(5S,6S,7R,10R)-6,7,12-trihydroxyabieta-8,11,13-trien-20-oic acid 6,20-lactone 
(+)-(5S,6S,7S,8R,10R)-6-hydroxy-7,8-epoxy-12-oxo-abieta-9(11),13-dien-20-oic acid 6,20-lactone 
(+)-(5S,7R)-7-ethoxy-12-hydroxy-2-oxo-20-norabieta-1(10),8,11,13-tetraene 
(+)-(7''S,8S,8'R,8''R)-4,4''-dihydroxy-3,3',3'',5'-tetramethoxy-4',8''-oxy-8,8'-sesquineolignan-7''-ol 
(+)-(7''S,8S,8'R,8''S)-4,4''-dihydroxy-3,3',3'',5'-tetramethoxy-4',8''-oxy-8,8'-sesquineolignan-7''-ol 
(+)-(7'S,8S,8'S)-3',4,4'-trihydroxy-5,5'-dimethoxy-2,7'-cyclolignan 
(+)-(7'S,8S,8'S)-3',4,4'-trihydroxy-5-methoxy-2,7'-cyclolignan 
(+)-(7'S,8S,8'S)-3',4-dihydroxy-2',3,4',5-tetramethoxy-6',9-epoxy-2,7'-cyclolignan-9'-ol 
(+)-(7R,7'R,7''R,7'''R,8S,8'S,8''S,8'''S)-4'',4'''-dihydroxy-3,3',3'',3''',5,5'-hexamethoxy-7,9':7',9-diepoxy-4,8'':4',8'''-bisoxy-8,8'-dineolignan-7'',7''',9'',9'''-tetraol 
(+)-(7R,7'R,7''R,7'''S,8S,8'S,8''S,8'''S)-4'',4'''-dihydroxy-3,3',3'',3''',5,5'-hexamethoxy-7,9':7',9-diepoxy-4,8'':4',8'''-bisoxy-8,8'-dineolignan-7'',7''',9'',9'''-tetraol 
(+)-(7R,7'R,7''S,7'''S,8S,8'S,8''S,8'''S)-4'',4'''-dihydroxy-3,3',3'',3''',5,5'-hexamethoxy-7,9':7',9-diepoxy-4,8'':4',8'''-bisoxy-8,8'-dineolignan-7'',7''',9'',9'''-tetraol 
(+)-(7R,7'R,8S,8'S)-4'-hydroxy-3,3',4,5,5'-pentamethoxy-7,7'-epoxylignan-9,9'-diol 
(+)-(7S,8R,7'E)-4-hydroxy-3,5'-dimethoxy-4',7-epoxy-8,3'-neolign-7'-ene-9,9'-diol-9'-ethyl ether 
(+)-(7S,8R,8'R)-5,5'-dimethoxylariciresinol 
(+)-(7S,8S)-1',4-dihydroxy-3,3',5'-trimethoxy-7',8',9'-trinor-8,4'-oxyneolignan-7,9-diol 
(+)-(7S,8S)-4-hydroxy-3,3',5'-trimethoxy-8',9'-dinor-8,4'-oxyneolignan-7,9-diol-7'-oic acid 
(+)-(7S,8S)-guaiacylglycerol +  
(+)-(8R,8'R)-4-hydroxy-5-methoxy-1',2',3',4',5',6'-hexanor-2,7'-cyclolignan-7'-one 
(+)-(8S,8'R)-3',4,4'-trihydroxy-5,5'-dimethoxylignan 
(+)-(8S,8'R)-4,4'-dihydroxy-3,3',5'-trimethoxylignan 
(+)-(8S,8'R)-4,4'-dihydroxy-3-methoxylignan 
(+)-(8S,8'R)-4-hydroxy-3,3',4',5'-tetramethoxylignan 
(+)-(8S,8'R)-4-hydroxy-5-methoxy-1',2',3',4',5',6'-hexanor-2,7'-cyclolignan-7'-one 
(+)-(8S,8'R)-9'-acetoxy-4,4'-dihydroxy-3,3',5'-trimethoxylignan 
(+)-(8S,8'R)-9-acetoxy-4,4'-dihydroxy-3,3',5'-trimethoxylignan 
(+)-(S)-ar-turmerone  
(+)-(S)-dihydro-ar-turmerone 
(+)-3'-hydroxylarreatricin 
(+)-5'-methoxylariciresinol 
(+)-5-epi-aristolochene +  
(+)-7-isojasmonic acid +  
(+)-abscisic acid +   
(+)-albicanol 
(+)-alpha-gurjunene 
(+)-alpha-pinene 
(+)-alpha-viniferin  
(+)-angenomalin 
(+)-artemisinin +   
(+)-beta-phellandrene 
(+)-calanolide A 
(+)-catechin +   
(+)-catechin-3'-methyl ether 
(+)-cis-isohumulone 
(+)-conocarpan  
(+)-dehydrodiconiferyl alcohol 
(+)-dihydrocarveol 
(+)-endo-beta-bergamotene +  
(+)-epicatechin +   
(+)-gallocatechin gallate 
(+)-homalomenol A 
(+)-homalomenol B 
(+)-iridodial 
(+)-iridodial lactol 
(+)-isolariciresinol 
(+)-lariciresinol +   
(+)-lyoniresinol-3-alpha-O-beta-D-glucopyranoside 
(+)-minovincinine 
(+)-morelloflavone 
(+)-N-(methoxycarbonyl)-N-norboldine 
(+)-nootkatone  
(+)-nyasol 
(+)-pinoresinol 
(+)-pisatin 
(+)-pisiferal 
(+)-pisiferic acid 
(+)-pronuciferine 
(+)-schisandrin B  
(+)-sesamin +   
(+)-sesamin dicatechol 
(+)-tephrorin A 
(+)-tephrorin B 
(+)-tephrosone 
(+)-vestitol 
(+)-volkensiflavone 
(+-)-chartaceone A 
(+-)-chartaceone B 
(+-)-chartaceone C 
(+-)-chartaceone D 
(+-)-chartaceone E 
(+-)-chartaceone F 
(-)-(2S)-5,2'-dihydroxy-6'',6''-dimethylchromeno-(7,8:2'',3'')-3'-prenylflavanone 
(-)-(2S)-5,7,2'-trihydroxy-5'-(1''',1'''-dimethylallyl)-8-prenylflavanone 
(-)-(2S)-5,7,2'-trihydroxy-8,3'-diprenylflavanone 
(-)-(3S)-1,7-bis(4-hydroxyphenyl)-(6E)-6-hepten-3-ol 
(-)-(3S)-1-(3,4-dihydroxyphenyl)-7-(4-hydroxyphenyl)-(6E)-6-hepten-3-ol 
(-)-(3S)-1-(3,4-dihydroxyphenyl)-7-(4-hydroxyphenyl)heptan-3-ol 
(-)-(3S)-1-(3,4-dihydroxyphenyl)-7-phenyl-(6E)-6-hepten-3-ol 
(-)-(3S)-3-acetoxy-1-(3,4-dihydroxyphenyl)-7-(4-hydroxyphenyl)-(6E)-6-heptene 
(-)-(3S)-3-acetoxy-1-(3,4-dihydroxyphenyl)-7-(4-hydroxyphenyl)heptane 
(-)-(4S,5S,10R)-10,12,18-trihydroxy-7-oxo-20-norabieta-8,11,13-triene 
(-)-(4S,5S,10R)-12,18-dihydroxyabieta-8,11,13-trien-20-oic acid-18,20-lactone 
(-)-(4S,5S,10R,20R)-12,18-dihydroxy-7-oxo-abieta-8,11,13-trien-20-aldehyde 18,20-ethyl acetal 
(-)-(4S,5S,10R,20R)-12,18-dihydroxyabieta-8,11,13-trien-20-aldehyde 18,20-ethyl acetal 
(-)-(4S,5S,10R,20R)-12,18-dihydroxyabieta-8,11,13-trien-20-aldehyde18,20-methyl acetal 
(-)-(4S,5S,10R,20S)-12,18-dihydroxyabieta-8,11,13-trien-20-aldehyde 18,20-methyl acetal 
(-)-(4S,5S,7S,10R,20S)-7,12,18-trihydroxyabieta-8,11,13-trien-20-aldehyde 7,18,20-acetal 
(-)-(4S,5S,8R,10R)-8,18-dihydroxy-12-oxo-abieta-9(11),13-dien-20-oic acid 18,20-lactone 
(-)-(4S,5S,8R,10R,20S)-8,18-dihydroxy-12-oxo-abieta-9(11),13-dien-20-aldehyde 8,18,20-acetal 
(-)-(5R,10S)-12-hydroxy-7-oxo-20-norabieta-8,11,13-triene 
(-)-(5S,6S,7S,10R)-6,7,12-trihydroxyabieta-8,11,13-trien-20-oic acid 6,20-lactone 
(-)-(7''R,8''S)-4'',5,7-trihydroxy-3',3'',5'-trimethoxy-4',8''-oxyflavonolignan-7'',9''-diol 
(-)-(7''R,8''S)-4'',5,7-trihydroxy-3',5'-dimethoxy-4',8''-oxyflavonolignan-7'',9''-diol 
(-)-(7''S,8''S)-4'',5,7-trihydroxy-3',3'',5'-trimethoxy-4',8''-oxyflavonolignan-7'',9''-diol 
(-)-(7''S,8''S)-4'',5,7-trihydroxy-3',5'-dimethoxy-4',8''-oxyflavonolignan-7'',9''-diol 
(-)-(7'S,7''S,8R,8'S,8''R)-4,4''-dihydroxy-3',3'',5-trimethoxy-4',8''-oxy-2,7'-cyclo-8,8'-sesquineolignan-7''-ol 
(-)-(7'S,8S,8'R)-4,4'-dihydroxy-3,3',5,5'-tetramethoxy-7',9-epoxylignan-9'-ol-7-one 
(-)-(7R,7'R,7''R,8S,8'S,8''S)-4',4''-dihydroxy-3,3',3'',5,5',5''-hexamethoxy-7,9':7',9-diepoxy-4,8''-oxy-8,8'-sesquineolignan-7'',9''-diol 
(-)-(7R,7'R,7''R,8S,8'S,8''S)-4',4''-dihydroxy-3,3',3'',5,5'-pentamethoxy-7,9':7',9-diepoxy-4,8''-oxy-8,8'-sesquineolignan-7'',9''-diol 
(-)-(7R,7'R,7''R,8S,8'S,8''S)-4',4''-dihydroxy-3,3',3'',5-tetramethoxy-7,9':7',9-diepoxy-4,8''-oxy-8,8'-sesquineolignan-7'',9''-diol 
(-)-(7R,7'R,7''S,8S,8'S,8''S)-4',4''-dihydroxy-3,3',3'',5,5',5''-hexamethoxy-7,9':7',9-diepoxy-4,8''-oxy-8,8'-sesquineolignan-7'',9''-diol 
(-)-(7R,7'R,7''S,8S,8'S,8''S)-4',4''-dihydroxy-3,3',3'',5,5'-pentamethoxy-7,9':7',9-diepoxy-4,8''-oxy-8,8'-sesquineolignan-7'',9''-diol 
(-)-(7R,7'R,7''S,8S,8'S,8''S)-4',4''-dihydroxy-3,3',3'',5-tetramethoxy-7,9':7',9-diepoxy-4,8''-oxy-8,8'-sesquineolignan-7'',9''-diol 
(-)-(7R,7'R,8S,8'S)-4'-hydroxy-3,3',4,5,5'-pentamethoxy-7,9':7',9-diepoxylignane 
(-)-(7R,8R,8'R)-4,4'-dihydroxy-3,3',5'-trimethoxy-7,9'-epoxylignan 
(-)-(7R,8S)-guaiacylglycerol +  
(-)-(7R,8S,7''S,8''R)-3,3'',5,5'-tetramethoxy-4''-hydroxy-4',7-epoxy-8',9'-dinor-4,8''-oxy-8,3'-sesquineolignan-7'',9,9''-triol-7'-al 
(-)-(7R,8S,7'E)-3,4,5,5'-tetramethoxy-4',7-epoxy-8,3'-neolign-7'-ene-9,9'-diol 
(-)-(8R,8'S)-3,3',4-trimethoxy-4'-hydroxylignan 
(-)-11-hydroxy-9,10-dihydrojasmonic acid 11-beta-D-glucoside 
(-)-3,4-dimethoxy-3,4-desmethylenedioxycubebin 
(-)-5'-desmethylyatein 
(-)-5'-methoxyisolariciresinol 
(-)-alpha-amorphene 
(-)-alpha-cuprenene 
(-)-alpha-gurjunene +  
(-)-alpha-isocomene 
(-)-anaferine 
(-)-antofine  
(-)-argemonine +  
(-)-beta-caryophyllene 
(-)-beta-curcumene 
(-)-beta-phellandrene 
(-)-beta-santalene 
(-)-bursehernin +  
(-)-calanolide B 
(-)-coronaridine +  
(-)-cotinine +   
(-)-cubebin 
(-)-cubenol 
(-)-dehydrodiconiferyl alcohol 
(-)-demethoxylpinoresinol 
(-)-dihydrocarveol 
(-)-echitovenine 
(-)-endo-alpha-bergamotene 
(-)-endo-fenchol 
(-)-ephedrine  
(-)-epiafzelechin +  
(-)-epicatechin-5-gallate 
(-)-epicubenol 
(-)-epigallocatechin +   
(-)-epigallocatechin 3-gallate  
(-)-gallocatechin gallate 
(-)-homalomenol C 
(-)-kolavenyl diphosphate 
(-)-larreatricin 
(-)-leucophyllone 
(-)-matairesinol +  
(-)-medicarpin 
(-)-medioresinol 
(-)-methyl jasmonate 
(-)-minovincinine 
(-)-noscapine  
(-)-nyasol 
(-)-phaseolin 
(-)-phaseollinisoflavan +  
(-)-pinoresinol +  
(-)-pluviatolide +  
(-)-quinate +  
(-)-rotiorin 
(-)-sanguinolignan A 
(-)-sanguinolignan B 
(-)-sanguinolignan C 
(-)-sanguinolignan D 
(-)-sativan 
(-)-secoisolariciresinol +   
(-)-secologanin 
(-)-syringaresinol O,O'-bis(beta-D-glucoside) 
(-)-Tau-muurolol 
(-)-tortuosamine 
(-)-vestitol 
(-)-vincadifformine 
(-)-voacangine 
(1->4)-beta-D-mannan 
(10E,12Z,15Z)-9-hydroxy-10,12,15-octadecatrienoic acid methyl ester 
(10E,15Z)-9,12,13-trihydroxy-10,15-octadecadienoic acid 
(10Z)-heptadecenoate +  
(10Z)-heptadecenoic acid 
(11Z)-icos-11-enoic acid +  
(13R)-epi-8,13-epoxylabd-14-ene 
(13R)-manoyl oxide 
(16alpha,20R)-20,24-epoxy-2,16-dihydroxy-25,26,27-trinorcucurbita-1,5,23-triene-3,11,22-trione 2-O-beta-Dglucopyranoside 
(16alpha,20R,22S,23S)-16,23:22,25-diepoxy-2,20,22,23-tetrahydroxycucurbita-1,5-diene-3,11-dione 2-O-beta-D-glucopyranoside 
(16alpha,20R,24R)-24N,25-carbamoyloxy-2,16,20-trihydroxycucurbita-1,5-diene-3,11,22-trione 2-O-beta-D-glucopyranoside 
(16alpha,20R,24S)-2,16,20,25-tetrahydroxy-24-methoxycucurbita-1,5-diene-3,11,22-trione 2-O-beta-D-glucopyranoside 
(16alpha,20S,22S,23S)-16,23:22,25-diepoxy-2,22,23-trihydroxycucurbita-1,5-diene-3,11-dione 2-O-beta-D-glucopyranoside 
(1R,4R,5R,8S)-8-hydroxy-4,8-dimethyl-2-oxabicyclo[3.3.1]nonan-3-one 
(1R,4S)-fenchone 
(1R,5R,6S,7R,8S,10R)-8-hydroxy-4-oxopseudoguai-2(3),11(13)-dien-12,6-olide 
(1R,5R,6S,7S,8S,10R,11S)-6-hydroxy-4-oxopseudoguai-2(3)-en-12,8-olide 
(1S,2R,5R,6S,7R,8S,10R)-6-acetoxy-2-methoxy-4-oxopseudoguai-11(13)-en-12,8-olide 
(1S,2R,5R,6S,7S,8S,10R)-6-hydroxy-2-ethoxy-4-oxopseudoguai-11(13)-en-12,8-olide 
(1S,2R,5R,6S,7S,8S,10R)-6-hydroxy-2-methoxy-4-oxopseudoguai-11(13)-en-12,8-olide 
(1S,2S,5R,6S,7R,8S,10R)-6-acetoxy-2-methoxy-4-oxopseudoguai-11(13)-en-12,8-olide 
(1S,5R,6S,7S,8S,10R,11R)-6-hydroxy-4-oxopseudoguai-12,8-olide 
(1S,5S,7R,8S,10R)-14-acetoxy-4-oxopseudoguai-11(13)-en-12,8-olide 
(2,2,3-trimethylcyclopent-3-en-1-yl)acetonitrile 
(2-trans,6-trans)-farnesol +  
(20R)-28-hydroxylupen-30-al-3-one 
(20R)-ginsenoside Rg3 
(20S)-ginsenoside Rg3 +   
(20S)-ginsenoside Rh1  
(20S)-ginsenoside Rh2  
(21S)-21,22-epoxypolypoda-8(26)-13,17-trien-3beta-ol 
(2E)-3-(4-\{[1-hydroxy-1-(4-hydroxy-3-methoxyphenyl)-3-(sulfooxy)propan-2-yl]oxy\}-3-methoxyphenyl)prop-2-enoic acid 
(2E)-3-(4-\{[3-hydroxy-1-(4-hydroxy-3-methoxyphenyl)-1-(sulfooxy)propan-2-yl]oxy\}-3-methoxyphenyl)prop-2-enoic acid 
(2E)-3-[4-(\{1,3-dihydroxy-1-[3-methoxy-4-(sulfooxy)phenyl]propan-2-yl\}oxy)-3-methoxyphenyl]prop-2-enoic acid 
(2E)-4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
(2E)-4-hydroxy-3-methylbut-2-enyl diphosphate(3-) 
(2E)-hexenal 
(2E,4E)-2,4-hexadien-1-ol 
(2E,6E)-farnesyl monophosphate 
(2E,6E)-hedycaryol 
(2E,6Z)-nona-2,6-dien-1-ol 
(2E,6Z)-nona-2,6-dienal 
(2R)-2-[(1R)-4-methylcyclohex-3-en-1-yl]propanoic acid 
(2R)-2-hydroxynaringenin 
(2R,2'R,4R,4'R)-4,4'-dihydroxy-3,3',4,4'-tetrahydro-2,2'-binaphthalene-1,1'(2H,2'H)-dione 
(2R,3R)-3-hydroxy-5-methoxy-6,7- methylenedioxyflavanone 
(2R,3S)-glycosmisic acid 
(2S)-2'-hydroxy-7,8,3',4',5'-pentamethoxyflavan 
(2S)-2'-hydroxydemethoxymatteucinol 
(2S)-2,7-dihydroxy-5-methoxy-6,8-dimethylflavanone 
(2S)-5,7-dihydroxy-6,8-dimethylflavanone 
(2S)-5-hydroxy-7-methoxy-6,8-dimethylflavanone 
(2S)-6-(gamma,gamma-dimethylallyl)-3',4'-dimethoxy-6'',6''-dimethylpyran[2'',3'':7,8]flavanone 
(2S)-6-(gamma,gamma-dimethylallyl)-5-hydroxy-3',4'-dimethoxy-6'',6''-dimethylpyran[2'',3'':7,8]flavanone 
(2S)-6-formyl-8-methyl-7-O-methylpinocembrin 
(2S)-7,4'-dihydroxy-8-geranylflavanone 
(2S)-7-hydroxy-5-methoxy-8-methylflavanone 
(2S)-8-formyl-5-hydroxy-7-methoxy-6-methylflavanone 
(2S)-8-methylpinocembrin 
(2S)-eriodictyol 7-O-(6''-O-galloyl)-beta-D-glucopyranoside 
(2S)-poncirin 
(2S,3R)-glycosmisic acid 
(2S,3S)-2,3-dihydro-3-hydroxymethyl-2-(4-hydroxyphenyl)-5-(E)-propenylbenzofuran 
(2S,3S)-3,5,7-trihydroxy-6,8-dimethylflavanone 
(2S,4R)-hypoglycin A +  
(2S,4R)-hypoglycin B +  
(2S,4R)-rose oxide 
(2S,4S)-hypoglycin A +  
(2S,4S)-hypoglycin B +  
(2Z)-hexenal 
(3beta,16alpha)-16-hydroxy-13,28-epoxyoleanan-3-yl alpha-L-Rhap-(1->2)-beta-D-Glcp-(1->4)-[beta-D-Glcp-(1->2)]-alpha-L-arabinopyranoside 
(3E)-3-hexadecenoic acid 
(3E)-pent-3-en-2-one 
(3E,7E)-dolabella-3,7-dien-18-ol 
(3E,7E)-dolathalia-3,7,11-triene 
(3R)-1,2-didehydro-3-hydroxy-16-methoxy-2,3-dihydrotabersonine 
(3R)-1,2-didehydro-3-hydroxy-2,3-dihydrotabersonine 
(3R)-3-hydroxy-12'-apo-beta-carotenal 
(3R)-3-hydroxy-2,3-dihydrotabersonine 
(3R)-3-hydroxy-8'-apo-beta-carotenal 
(3R)-7,2'-dihydroxy-3',4'-dimethoxyisoflavan-7-O-beta-D-glucopyranoside 
(3R,4R)-(-)-6-methoxy-1-oxo-3-n-pentyl-3,4-dihydro-1H-isochromen-4-yl-acetate 
(3S,22S)-2,3:22,23-diepoxy-2,3,22,23-tetrahydrosqualene 
(3S,4R)-4' hydroxy-6,3' dimethoxyisoflavan-4-ol 
(3S,5R,6S)-beta-cryptoxanthin 5,6-epoxide 
(4-hydroxyphenyl)acetonitrile 
(4aR,10bS)-noroxomaritidine 
(4aS,10bR)-noroxomaritidine 
(4R)-limonene +  
(4R,7S)-7-isopropyl-4-methyloxepan-2-one 
(4S)-2-methylpentane-2,4-diol 
(4S)-4-hydroxy-L-isoleucine 
(4S)-4-hydroxy-L-isoleucine zwitterion 
(4S,5S,10R,20R)-12,18-dihydroxyabieta-8,11,13-trien-20-aldehyde 18,20-hemiacetal 
(4S,5S,10R,20S)-12,18-dihydroxyabieta-8,11,13-trien-20-aldehyde 18,20-hemiacetal 
(4Z)-2,8:7,12:11,15:14,18:17,22-pentaanhydro-4,5,6,9,10,13,19,20,21-nonadeoxy-L-arabino-L-allo-L-allo-docosa-4,9,20-trienitol 
(5R)-5-hydroxy-7-(4''-hydroxy-3''-methoxyphenyl)-1-phenyl-3-heptanone 
(5xi,7xi,10xi)-eudesma-4(14),11-diene +  
(5Z)-oct-5-enal 
(5Z,11Z,14Z)-icosatrienoic acid 
(5Z,11Z,14Z,17Z)-icosatetraenoic acid 
(5Z,9Z,12Z)-octadecatrienoic acid +  
(5Z,9Z,12Z,15Z)-octadecatetraenoic acid +  
(6S)-dehydrovomifoliol 
(6Z,9Z,12Z,15Z)-octadecatetraenoate 
(7'S)-parabenzlactone 
(7R)-7-hydroxylariciresinol 
(7R)-7-hydroxytaxiresinol 
(7S,8S)-methoxy-3',7-epoxy-8,4'-oxyneolignan-4,9,9'-triol 
(8E,10E,12Z)-octadecatrienoic acid +  
(8R)-3beta,8-dihydroxypolypoda-13E,17E,21-triene 
(8R)-8-hydroxynonanoic acid +  
(9Z)-heptadecenoic acid +  
(9Z,11E,13Z)-octadecatrienoic acid +  
(9Z,12Z)-hexadecadienoic acid +  
(E)-1,7-bis(4-hydroxyphenyl)-6-hepten-3-one 
(E)-1-(2,3-dihydro-1H-pyrrol-1-yl)-2-methyldec-8-ene-1,3-dione 
(E)-16-octadecenoic acid methyl ester 
(E)-2-pentenal 
(E)-3-(3,4-dihydroxybenzylidene)-5-(3,4-dihydroxyphenyl)dihydrofuran-2-one 
(E)-4,2',4'-trihydroxy-6'-methoxy-3',5'-dimethylchalcone 
(E)-beta-ocimene 
(E)-cinnamaldehyde +   
(E)-cinnamyl alcohol +   
(E)-dodec-2-enal +  
(E)-endo-beta-bergamoten-12-oic acid 
(E)-geranyl formate 
(E)-hept-2-enal +  
(E)-hex-2-enyl acetate 
(E)-hex-3-en-1-ol 
(E)-non-2-en-1-ol +  
(E)-non-2-enal 
(E)-oct-2-en-1-ol 
(E)-oct-2-enal 
(E)-sinapaldehyde +  
(E)-sinapaldehyde 4-O-beta-D-glucopyranoside 
(E)-trans-miyabenol C 
(E,E)-2,4-hexadienal  
(E,E)-piperic acid +   
(R)-(+)-perillyl alcohol 
(R)-(+)-verbenone 
(R)-1-p-menthene +  
(R)-2-hydroxynonanoic acid 
(R)-3-hydroxybutanenitrile 
(R)-4-hydroxy-1-methyl-L-proline 
(R)-7-butyl-6,8-dihydroxy-3-[(3E)-pent-3-en-1-yl]-3,4-dihydroisochromen-1-one 
(R)-amygdalin 
(R)-linalyl acetate +   
(R)-N-trans-feruloyloctopamine 
(R)-pantothenate 
(R)-rosmarinate 
(R)-rosmarinic acid 
(S)-(-)-alpha-terpineol 
(S)-1'-methylbutyl caffeate 
(S)-1'-methylhexyl caffeate 
(S)-1'-methyloctyl caffeate 
(S)-1,2,9,10-tetramethoxy-6-methylaporphine(1+) 
(S)-1-hydroxy-N-methylcanadine 
(S)-1-p-menthene +  
(S)-2-(3,5-dihydroxyphenyl)-5,7-dihydroxy-6,8-bis(3-methylbut-2-enyl)chroman-4-one 
(S)-2-(4-nitrobenzyl)-DOTA 
(S)-2-\{4-[2-(2-hydroxyethylthio)acetamido]benzyl\}-DOTA 
(S)-5,7-dihydroxy-2-(4-methoxyphenyl)-8-(3-methylbut-2-enyl)chroman-4-one 
(S)-atropinium 
(S)-canadine +  
(S)-corytuberine +   
(S)-glaucine +   
(S)-linalyl acetate +   
(S)-magnoflorine  
(S)-nandinine +  
(S)-naringenin +   
(S)-nicotine +   
(S)-nicotinium(1+) 
(S)-scoulerine +  
(S)-stylopine +  
(S)-tembetarine 
(S,S)-trans-1-isopropyl-2,3,3,5-tetramethyl-6-succinylindane 
(S,S,S)-nicotianamine 
(S,S,S)-nicotianamine trizwitterion 
(Z)-2-penten-1-ol 
(Z)-3-(3,4-dihydroxybenzylidene)-5-(3,4-dihydroxyphenyl)-2(3H)-furanone 
(Z)-alpha-bisabolene +  
(Z)-beta-ocimene 
(Z)-hex-3-en-1-ol +   
(Z)-hexadec-11-enal 
(Z)-icos-13-enoic acid 
(Z)-non-6-en-1-ol 
(Z)-non-6-enal 
->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)]-beta-D-Galp-yl group 
->4)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
->8)-alpha-Neu5Ac-(2->3)-[beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)]-beta-D-Gal-(1->4)-yl group +   
1'-acetoxychavicol acetate  
1'-acetoxyeugenol acetate 
1,2,3,4-tetrahydro-beta-carboline-3-carboxylic acid 
1,2,3,4-tetrakis-O-galloyl-alpha-D-glucose 
1,2,3-trimethoxybenzene 
1,2,3-trimethylbenzene +  
1,2-campholide +  
1,2-dehydro-2,3-secofriedelan-3-oic acid 
1,2-di-O-[1-(14)C]-palmitoyl-sn-glycero-3-phosphocholine 
1,2-di-O-palmitoyl-sn-glycero-3-phosphocholine 
1,2-diacetyltrichagmalin C 
1,2-diguaiacylpropane-1,3-diol 
1,3,4,5-tetracaffeoylquinic acid 
1,3,5-trihydroxyxanthone 
1,3,6-trihydroxy-2-hydroxymethyl-9,10-anthraquinone-3-O-(6'-O-acetyl)-beta-D-glucopyranoside 
1,3,6-trihydroxy-2-methyl-9,10-anthraquinone +  
1,3,6-trihydroxy-2-methyl-9,10-anthraquinone-3-O-(3'-O-acetyl)-alpha-L-rhamnopyranosyl-(1->2)-beta-D-glucopyranoside 
1,3,6-trihydroxy-2-methyl-9,10-anthraquinone-3-O-(6'-O-acetyl)-alpha-L-rhamnopyranosyl-(1->2)-beta-D-glucopyranoside 
1,3,6-trihydroxy-2-methyl-9,10-anthraquinone-3-O-(6'-O-acetyl)-beta-D-glucopyranoside 
1,3,6-trihydroxy-2-methyl-9,10-anthraquinone-3-O-(6'-O-acetyl)-beta-D-xylopyranosyl-(1->2)-beta-D-glucopyranoside 
1,3,6-trihydroxy-2-methyl-9,10-anthraquinone-3-O-alpha-L-rhamnopyranosyl-(1->2)-beta-D-glucopyranoside 
1,3,7-trihydroxy-2,4-diisoprenylxanthone 
1,3,8-trihydroxy-4-methyl-2,7-diprenylxanthone 
1,3-bis(p-hydroxyphenyl)pentane-1,4-diene +   
1,3-diacetylvilasinin 
1,3-dicaffeoylquinate 
1,3-dicaffeoylquinic acid 
1,3-dihydroxy-6-methoxy-2-methyl-9,10-anthraquinone 
1,3-diphenylurea +   
1,30-diacetyltrichagmalin F 
1,4-cineole 
1,6-dihydroxy-2-methyl-9,10-anthraquinone 
1,6:5,9:8,12:11,16-tetraanhydro-2,3,4,10,13,14-hexadeoxy-D-glycero-D-allo-D-gulo-heptadeca-2,13-dienitol 
1,7,8,9,10,10-hexachloro-4-methyl-4-azatricyclo[5.2.1.0(2,6)]dec-8-ene-3,5-dione 
1,7-bis (4-hydroxyphenyl)-1,4,6-heptatrien-3-one 
1,7-bis(4-hydroxyphenyl)-3-heptanone 
1,7-bis(4-hydroxyphenyl)hepta-4E-6E-dien-3-one 
1,7-dihydroxy-4-methoxyxanthone 
1,9-dideoxyforskolin  
1-(2,3-dihydro-1H-pyrrol-1-yl)-2-methyldecane-1,3-dione 
1-(2,6,6-trimethylcyclohex-2-en-1-yl)but-2-enone 
1-(2-hydroxy-4-methoxyphenyl)-3-(4-hydroxy-3-methoxyphenyl)propane 
1-(3,4-dihydroxyphenyl)-7-(4-hydroxyphenyl)-(6E)-6-hepten-3-ol 
1-(3,6-di-O-sulfo-beta-D-galactosyl)-N-lauroylsphingosine 
1-(3-O-sulfo-beta-D-galactosyl)-N-[(15Z)-tetracos-15-enoyl]sphingosine 
1-(3-O-sulfo-beta-D-galactosyl)-N-stearoylsphingosine 
1-(4-\{[1,3-dihydroxy-1-(4-hydroxy-3-methoxyphenyl)propan-2-yl]oxy\}-3,5-dimethoxyphenyl)propane-1,2,3-triol 
1-(4-hydroxy-3-methoxyphenyl)-7-(4-hydroxyphenyl)-(4E)-4-hepten-3-one 
1-(4-hydroxy-3-methoxyphenyl)-7-(4-hydroxyphenyl)-3-heptanone 
1-(4-hydroxyphenyl)-7-phenyl-(6E)-hept-6-en-3-one 
1-(9S,13S,12-oxophytodienoyl)-2-(7Z,10Z,13Z)-hexadecatrienoyl-3-(beta-D-galactosyl)-sn-glycerol 
1-(9Z,12Z,15Z)-octadecatrienoyl-2-(7Z,10Z,13Z)-hexadecatrienoyl-3-(beta-D-galactosyl)-sn-glycerol 
1-[3-(2,2,3-trimethylcyclopent-3-enyl)cyclohex-3-enyl]ethanol 
1-[4-(2,2,3-trimethylcyclopent-3-enyl)cyclohex-3-enyl]ethanol 
1-acetylindole-3-carboxaldehyde 
1-aminocyclopropanecarboxylic acid +  
1-aminocyclopropanecarboxylic acid zwitterion 
1-azelaoyl-sn-glycero-3-phosphocholine 
1-behenoylglycerol 
1-caffeoyl-beta-D-glucose 
1-chloro-2,4,6-trinitrobenzene  
1-chloro-2,4-dinitrobenzene  
1-cyano-8-(methylsulfinyl)heptane 
1-cyano-8-(methylsulfinyl)octane 
1-deoxycapsidiol 
1-dodecylpyrrolidin-2-one 
1-elaidoyl-sn-glycero-3-phosphocholine 
1-feruloyl-sn-glycerol 
1-heptanol  
1-hydroxy-2-methyl-9,10-anthraquinone 
1-icosanoylglycerol 
1-isomangostin 
1-methoxy-3-(aminomethyl)indole 
1-methoxyficifolinol 
1-methylnaphthalene  
1-monolinolein +  
1-monopalmitoylglycerol +  
1-nonanoyl-2-pentadecanoyl-sn-glycero-3-phosphocholine 
1-nonene +  
1-O-(1-O-hexadecanoyl-2-O-heptadecanoyl-sn-glycero-3-phosphono)-1D-myo-inositol 
1-O-(4-hydroxybenzoyl)-beta-D-glucopyranose 
1-O-(alpha-D-galactopyranosyl)-N-hexacosanoylsphinganine 
1-O-(alpha-D-galactopyranosyl)-N-pamitoylphytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-tetracosanyl-2-aminononane-1,3,4-triol 
1-O-(alpha-D-galactopyranuronosyl)-N-tetradecanoyldihydrosphingosine 
1-O-(alpha-D-galactosyl)-N-hexacosanoylphytosphingosine +   
1-O-3,4-dimethoxy-5-hydroxyphenyl-(6-O-3,5-dimethoxygalloyl)-beta-D-glucopyranoside 
1-O-3,4-dimethoxy-5-hydroxyphenyl-(6-O-vanilloyl)-beta-D-glucopyranoside 
1-O-[6-O-(3-phenylpropanoyl)-alpha-D-galactopyranosyl]-N-hexacosanoylsphinganine 
1-O-[6-O-(3-phenylpropanoyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-dodecanoyl-2-O-pentacosanoyl-sn-glycero-3-phosphocholine 
1-O-feruloyl-beta-D-glucose 
1-O-palmitoyl-2-O-[1-(14)C]-linoleoyl-sn-glycero-3-phosphocholine 
1-O-sinapoyl-beta-D-glucose 
1-octadecanoyl-2-nonanoyl-sn-glycero-3-phosphocholine 
1-oleoylglycerol +  
1-oxo-3beta,23-dihydroxyolean-12-en-28-oic acid 
1-oxo-3beta,23-dihydroxyolean-12-en-28-oic acid 28-O-beta-D-glucopyranoside 
1-oxo-3beta-hydroxyolean-18-ene 
1-p-menthene 
1-phenyl-1,2-propanedione  
1-phospho-alpha-D-galacturonic acid 
1-stearoyl-sn-glycerol +  
1-tetracosanoylglycerol 
1-undecene +  
10-hydroxycoronaridine 
10-hydroxyicajine 
10-undecenoate 
10-undecenoic acid +  
10H-phenothiazine +   
11,13-dihydro-8-deoxylactucin 15-glycoside 
11,20-dihydroxyferruginol +  
11,20-dihydroxysugiol 
11-hydroxyferruginol 
11-hydroxyicajine 
11-hydroxysugiol +  
11-oxocucurbitadienol 
11-sulfooxy-9,10-dihydrojasmonic acid 
11alpha-hydroxycucurbitadienol 
11beta,13-dihydro-8-deoxylactucin 
11beta,13-dihydro-8-deoxylactucin 15-oxalate 
11beta,13-dihydrolactucin 
11beta,13-dihydrolactucin 15-glycoside 
11beta,13-dihydrolactucin 15-oxalate 
11beta,13-dihydrolactucopicrin 
11beta,13-dihydrolactucopicrin 15-oxalate 
12(R)-HPETE methyl ester 
12(S)-HPETE methyl ester 
12-deoxyphorbol 20-acetate 13-(2-methylbutanoate) 
12-hydroxy-1-oxo-20-norabieta-5(10),6,8,11,13-pentaene 
12-hydroxyjasmonic acid +  
12-hydroxyoctadecanoic acid +  
12-hydroxyoctadecanoyl-CoA 
12-O-deacetyltrichilin H 
12-sulfooxy-9,10-dihydrojasmonic acid 
13(S)-HPODE methyl ester 
13,14,15,16-tetranorlabdane-8alpha,12,18-triol 
13-Docosenoic acid, methyl ester 
13-epi-manool 
14,15-dihydroajugapitin 
14,15-dihydroclerodin 
14-hydro-15-hydroxyajugachin A 
14-hydro-15-hydroxyajugapitin 
14-hydroxy-6,12-muuroloadien-15-oic acid 
14-hydroxyicajine 
14-methylhexadecanoic acid 
15-acetyldeoxynivalenol  
15-acetyltrichagmalin C 
15-acetyltrichagmalin E 
15-epi-lupulin B 
15-hydroxyajubractin C 
15-hydroxyazadiradione 
15-hydroxysolavetivone 
15-O-acetylbruceolide 
15-O-propionylbruceolide 
15alpha-stemmadenine 
15beta-stemmadenine 
16,23,29-trihydroxy-3-oxo-olean-12-en-28-oic acid 
16-epivellosimine 
16-heptadecenal 
16-hydroxy-10-oxohexadecanoic acid 
16-hydroxyhexadecanoate 
16-hydroxyhexadecanoic acid +  
16-hydroxyhexadecanoyl-CoA 
16-hydroxytriptolide 
16-oxohexadecanoic acid 
17-epi-17-hydroxyazadiradione 
17-epiazadiradione +  
17-hydroxyazadiradione 
17beta,21beta-epoxyhopan-3-one 
17beta-estradiol 6-O-(carboxymethyl)oxime 
18-hydroxyoleic acid +  
19,28-didehydroxyrubiarbonol A 
19alpha-hydroxyasiatic acid +  
19alpha-hydroxyasiatic acid-28-O-beta-D-glucopyrannoside 
1beta,4beta,7alpha-trihydroxyeudesmane 
1beta-hydroxy-6,7alpha-dihydroxyeudesm-4(15)-ene 
1beta-hydroxyfriedelin 
1D-1-O-methyl-myo-inositol 
1D-3-O-methyl-myo-inositol 
1D-4-O-methyl-myo-inositol 
1D-5-O-methyl-chiro-inositol 
1D-5-O-methyl-myo-inositol 
1D-myo-inositol 1,2,5,6-tetrakisphosphate 
1D-myo-inositol 1,2-cyclic phosphate 
2''-acetylastragalin 
2''-acetylpaeonoside 
2''-acetylpetiolaroside 
2''-O-rhamnosylscoparin 
2',3'-dihydrosalannin 
2',4',6'-trihydroxyacetophenone  
2',4'-dihydroxy-3'-methyl-6'-methoxychalcone 
2',4'-dihydroxy-6'-methoxy-3',5'-dimethylchalcone  
2',4'-dihydroxyacetophenone 
2',6'-dimethoxy-4'-hydroxyacetophenone 
2',7-dihydroxy-4',5'-methylenedioxyisoflavone 
2'-deoxyinosine 
2'-deoxymeranzin hydrate 
2'-hydroxy-3,7,8,4',5'-pentamethoxyflavone 
2'-hydroxybiochanin A 
2'-hydroxygenistein 
2'-O-methylodoratol 
2'-O-methylphaseollinisoflavan 
2,3-bis(hydroxymethyl)-7-hydroxy-6-methoxy-1-tetralone 
2,3-dihydro-2-(4-hydroxyphenyl)-5,6,7-trimethoxy-4H-1-benzopyran-4-one 
2,3-dihydro-2-(4-methoxyphenyl)-5,6,7-trimethoxy-4H-1-benzopyran-4-one 
2,3-dihydro-3beta-methoxy withaferin A 
2,3-dihydro-3beta-O-sulfate withaferin A 
2,3-dihydro-4',4'''-di-O-methylamentoflavone 
2,3-dihydrobiochanin A 
2,3-dihydrowithaferin A 
2,3-dihydroxybenzoic acid +   
2,3-dihydroxybenzoic acid 3-O-beta-D-xyloside 
2,3-dihydroxybutanedioate +  
2,3-dihydroxybutanedioic acid +  
2,4,6-trihydroxyphenylhexan-1-one 
2,4,6-trinitrobenzenesulfonic acid  
2,4,6-trinitrophenyl group +  
2,4-diacetylphloroglucinol 
2,4-diacetylphloroglucinol(1-) 
2,4-dinitrophenyl group +  
2,5,7-trihydroxy-2-(4-hydroxyphenyl)-2,3-dihydro-4H-chromen-4-one +  
2,5,7-trihydroxy-4'-methoxyisoflavanone 
2,5-di-tert-butylphenol 
2,6-di-O-(alpha-D-mannosyl)-1-O-(1,2-di-O-hexadecanoyl-sn-glycero-3-phosphono)-1D-myo-inositol 
2,6-diamino-7-hydroxy-azelaic acid 
2,6-dimethoxyphenol +  
2,8-dihydroxy-3,4,7-trimethoxydibenzofuran 
2-(2,4,5-trimethoxyphenyl)-5,6,7,8-tetramethoxy-4H-1-benzopyran-4-one 
2-(2,4-dihydroxyphenyl)-5-(E)-propenylbenzofuran 
2-(2-(4-methoxyphenyl)ethyl)chromone 
2-(2-hydroxy-4-methoxyphenyl)-5-(3-hydroxypropyl)benzofuran 
2-(2-phenylethyl)chromone 
2-(3,4,5-trimethoxyphenyl)-5,6,7,8-tetramethoxy-4H-1-benzopyran-4-one 
2-(4-hydroxy-3,5-dimethoxyphenyl)-3-(hydroxymethyl)-2,3-dihydro-7H-pyrano[2,3-g][1,4]benzodioxin-7-one 
2-(4-hydroxy-3-methoxyphenyl)-3-(hydroxymethyl)-2,3-dihydro-7H-pyrano[2,3-g][1,4]benzodioxin-7-one 
2-(4-hydroxyphenyl)-5-(E)-propenylbenzofuran 
2-(acetylamino)naphthalene-1,5-disulfonic acid 
2-(beta-D-glucopyranosyloxy)benzoic acid 
2-[3-(2,2,3-trimethylcyclopent-3-enyl)cyclohex-3-enyl]propan-2-ol 
2-\{[(R)-\{[4-(aminomethyl)phenyl]amino\}\{[(1R)-1-phenylethyl]amino\}methyl]amino\}ethane-1,1-diol 
2-acetamidofluorene +   
2-amino-1,3,4,5-icosanetetrol 
2-amino-1,3,4-tetradecanetriol 
2-amino-3-hydroxybutanoic acid +   
2-aminothiophenol  
2-azelaoyl-sn-glycero-3-phosphocholine 
2-carbomethoxy-9,10-anthraquinone 
2-chlorobenzoate 
2-chlorobenzoic acid +  
2-cis,4-trans-xanthoxin 
2-coumarate +  
2-coumaric acid +  
2-endo-amino-2-exo-benzoyl-3-exo-phenylnorbornane 
2-ethylfuran 
2-ethylhexan-1-ol +   
2-furoic acid +   
2-hexadecanoyl-sn-glycero-3-phosphoethanolamine 
2-hexen-1-ol +  
2-hydroxy-(22-27)-hexanorcucurbita-1,5,16-triene-3,11,20-trione 2-O-beta-D-glucopyranoside 
2-hydroxy-3-(2-methylidenecyclopropyl)butanedioic acid 
2-hydroxy-3-methoxystrychnine 
2-hydroxy-6-[2-(3,4-dihydroxyphenyl)-2-oxo-ethyl]benzoic acid 
2-hydroxy-6-[2-(3,4-dihydroxyphenyl-5-methoxy)-2-oxoethyl]benzoic acid 
2-hydroxy-6-[2-(4-hydroxyphenyl)-2-oxo-ethyl]benzoic acid 
2-hydroxyerucic acid 
2-hydroxymelatonin 
2-hydroxynonanoic acid 
2-hydroxyrubiarbonone E 
2-methoxy-1,4-naphthoquinone  
2-methoxy-4-vinylphenol 
2-methyl-3-sulfanylbutan-1-ol 
2-methylbutanal +  
2-methylpropanamine +  
2-methylpyrrolidine +   
2-methylthioethanol 
2-naphthol +   
2-nonanol +  
2-O-deacetyleuonine 
2-O-E-p-coumaroyl alphitolic acid 
2-O-methylswertianin 
2-oxindole-3-acetic acid +  
2-oxononanoic acid 
2-penten-1-ol +  
2-phenylethanol +   
2-phenylethyl 1H-indol-3-ylacetate 
2-propylphenol 
2-tetradecanoyl-sn-glycero-3-phosphocholine 
2-trans,4-trans-xanthoxin 
2-trans-abscisic acid D-glucosyl ester +  
20(29)-lupene-1beta,3alpha-diol 
20(29)-lupene-1beta,3beta-diol 
20,21,22,23-tetrahydro-23-oxoazadirone 
20-HETE methyl ester 
20-hydroxyecdysone  
20S,24S-dihydroxydammer-25-en-3-one 
23-epivepaol 
23-hydroxyursolic acid +  
24,25-dihydroxydammar-20-en-3-one 
24,25-epoxytirucall-7-ene-3,23-dione 
24-ethylcoprostanol 
24-methylenecycloartanol +  
24G7 epitope +   
25-O-methoxycimigenol 3-O-alpha-L-arabinopyranoside 
26-hydroxycastasterone 
28-deoxonimbolide  
29-hydroxyfriedelan-3-one 
2alpha,3alpha,23-trihydroxyolean-12-en-28-oic acid 
2alpha,3alpha,23-trihydroxyurs-12-en-28-oic acid 
2alpha,3alpha-dihydroxy-ent-isokaurene 
2alpha,3beta,23-trihydroxylup-20(29)-en-28-oic acid 
2alpha,3beta,23-trihydroxyolean-12-en-28-oic acid 28-O-beta-D-glucopynoside 
2alpha,3beta,23alpha-trihydroxyurs-12-en-28-oic acid 28-O-beta-D-glucopyranoside 
2alpha,3beta-dihydroxy-20(29)-lupen-28-oic acid 
2alpha,3beta-dihydroxylup-20(29)-ene 
2alpha,3beta-dihydroxyolean-13(18)-en-28-oic acid 
2alpha-acetoxy-28-acetylrubiarboside G 
2alpha-acetoxy-4alpha,6alpha-dihydroxy-1beta,5alphaH-guai-9(10),11(13)-dien-12,8alpha-olide 
2alpha-hydroxy-ent-isokaurene 
3',4'-O-disulfo-N-acetyllactosamine 
3',5'-cyclic GMP +   
3',5,7-trihydroxy-3,4',5'-trimethoxyflavone 
3',5-dihydroxy-3,4',5',7-tetramethoxyflavone 
3',5-dihydroxy-3,4',7-trimethoxyflavone 
3'-deoxyepisappanol 
3'-deoxysappanol 
3'-deoxysappanone B 
3'-hydroxy-4,6,4'-trimethoxyaurone 
3'-methoxyflavone 
3'-O-methylorobol 
3,15-di-O-acetylbruceolide 
3,15-di-O-propionylbruceolide 
3,3',4',5'-tetramethylmyricetin 
3,3',5'-trimethylmyricetin 
3,3',5-trihydroxybibenzyl 
3,3'-dimethylquercetin 
3,3-dimethylcystein-S-yl group 
3,3-dimethyloctane 
3,4'-dimethylkaempferol 
3,4,5-trimethoxybenzoic acid +  
3,4,5-trimethoxyphenol +  
3,4-di-O-methyl-alpha-L-rhamnose 
3,4-dichloroaniline +   
3,4-dihydrocoumarin  
3,4-dihydroxybenzoic acid +   
3,4-dimethoxybenzoic acid +  
3,4-dimethoxyphenylethylamine 
3,5-dimethoxy-1,6-dihydroxyxanthone 
3,5-dimethoxybenzoic acid +  
3,5-dimethoxytoluene 
3,6,9-trihydroxypterocarpan +  
3,6-di-O-sulfo-beta-D-galactosyl-(1->4)-6-O-sulfo-N-acetyl-beta-D-glucosamine 
3,6-di-O-sulfo-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
3,7,11-trimethyldodecan-1-ol 
3-(1H-indol-3-yl)propanoic acid  
3-(2-hydroxyphenyl)propanoate 
3-(2-hydroxyphenyl)propanoic acid 
3-(4,6-dihydroxy-3-oxocyclohexa-1,4-dien-1-yl)acrylic acid 
3-(5-oxoisoxazolin-2-yl)-L-alanine 
3-(5-oxoisoxazolin-4-yl)-L-alanine 
3-(indol-3-yl)pyruvate 
3-(indol-3-yl)pyruvic acid 
3-(methylaminomethyl)indole 
3-[(1S,2S,6S)-2-\{2-[(1S,2R,3R)-2-(3-ethoxy-3-oxopropyl)-3-(2-hydroxypropan-2-yl)-2-methyl-6-methylidenecyclohexyl]ethyl\}-1,3-dimethyl-6-(prop-1-en-2-yl)cyclohex-3-en-1-yl]propanoic acid 
3-\{[(5-nitrofuran-2-yl)methylidene]amino\}-1,3-oxazol-2-one 
3-acetyl-11-methoxy-1-tigloylazadirachtinin 
3-acetyl-7-tigloylvilasinin lactone 
3-acetylbenzamide 
3-acetyldeoxynivalenol  
3-carboxy-2,3-dihydroxypropanoate +  
3-coumaric acid +  
3-deacetylsalannin 
3-dehydroshikimic acid 
3-deoxy-D-arabino-hexonic acid 
3-deoxysappanone B 
3-dimethylallyl-4-hydroxybenzoic acid 
3-epi-14,15-dihydrocaryoptin 
3-epi-caryoptin 
3-epi-fagomine 
3-hexanone 
3-hexen-2-one 
3-hexenoic acid +  
3-hydroxy-2,4,4-trimethylpentyl 2-methylpropanoate 
3-hydroxy-2-hydroxymethyl-9,10-anthraquinone 
3-hydroxy-24,25,26,27-tetranortirucall-7-ene-23(21)-lactone 
3-hydroxy-3-methylbut-1-ene 
3-hydroxy-3-methylglutarate(1-) 
3-hydroxy-3-methylglutarate(2-) 
3-hydroxy-3-methylglutaric acid +  
3-hydroxy-4-methoxybenzoic acid +  
3-hydroxy-6-methoxy-1-methyl-4,5-diphenyl-2-piperidinone +  
3-hydroxybenzoate 
3-hydroxybenzoic acid +   
3-hydroxyhexane-2,5-dione 
3-hydroxylubimin 
3-mercaptohexanol +  
3-mercaptopentanol 
3-methoxyapigenin 
3-methyl-2-butanol 
3-methyl-2-pentanol 
3-methyl-3-sulfanylbutan-1-ol 
3-methylbut-2-enoic acid +  
3-methylbutanal 
3-methylbutyl hexanoate 
3-methylgalangin 
3-methylpentanol 
3-O-[2,3-di-O-acetyl-alpha-L-arabinopyranosyl]-hederagenin 28-O-alpha-L-rhamnopyranosyl-(1->4)-beta-D-glucopyranosyl-(1->6)-beta-D-glucopyranoside 
3-O-[3,4-di-O-acetyl-alpha-L-arabinopyranosyl]hederagenin 28-O-alpha-L-rhamnopyranosyl-(1->4)-beta-D-glucopyranosyl-(1->6)-beta-D-glucopyranoside 
3-O-[beta-D-glucopyranosyl]-28-O-[alpha-L-rhamnopyranosyl-(1->2)-beta-D-glucopyranosyl]arjunolic acid 
3-O-[beta-D-glucopyranosyl]-28-O-[alpha-L-rhamnopyranosyl-(1->2)-beta-D-glucopyranosyl]asiatic acid 
3-O-[beta-D-glucopyranosyl]-28-O-[alpha-L-rhamnopyranosyl-(1->2)-beta-D-glucopyranosyl]maslinic acid 
3-O-\{(1R)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl\}-2,6-bis-O-\{(1S)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl\}-beta-D-Man-(1->4) -beta-D-GlcNAc-(1->4)-3-O-[(1S)-2-hydroxy-1-\{[(2S)-1-hydroxypropan-2-yl]oxy\}ethyl]-D-GlcNAc-yl group 
3-O-acetyl-4'-O-demethylpapaveroxine +  
3-O-acetylpapaveroxine 
3-O-alpha-abequopyranosyl-alpha-D-mannopyranose 
3-O-beta-D-glucosyl-trans-caffeic acid 
3-O-feruloyl-D-quinic acid 
3-O-feruloylcycloartenol 
3-O-methyl-alpha-L-rhamnose 
3-O-methylcalopocarpin 
3-O-methylquercetin 7-O-beta-glucopyranosyl-4'-O-beta-D-glucopyranoside 
3-O-methylquercetin-7-O-beta-D-glucopyranoside 
3-O-sulfo-beta-D-galactose +  
3-O-vanillyceanothic acid 
3-octanone 
3-oxo-23-hydroxyurs-12-en-28-oic acid 
3-oxo-N-[(3S)-2-oxopyrrolidin-3-yl]dodecanamide 
3-phenylpropanal 
3-phenylpropionate 
3-phenylpropionic acid +   
3-phenylpropyl acetate 
30-acetyltrichagmalin F 
3alpha,6alpha-epoxy-4beta,5beta,27-trihydroxy-1-oxowitha-24-enolide 
3alpha-hydroxy-ent-sandaracopimaradiene 
3alpha-hydroxyolean-11,13(18)-dien-28-oic acid 
3alpha-hydroxyolean-11-en-28,13beta-olide 
3beta,22alpha-dihydroxyurs-12-en-28-oic acid 28-O-beta-D-glucopyranoside 
3beta,22S-dihydroxytirucalla-7,24-dien-23-one 
3beta,23-dihydroxyurs-12-en-28-oic acid 28-O-beta-D-glucopyranoside 
3beta,6beta,23-trihydroxyolean-12-en-28-oic acid 
3beta,6beta,23-trihydroxyolean-12-en-28-oic acid 28-O-beta-D-glucopyranoside 
3beta-[(alpha-L-arabinopyranosyl)oxy]-20beta-hydroxyursan-28-oic acid delta-lactone 
3beta-acetoxyolean-18-en-28-oic acid 
3beta-hydroxyatractylon 
3beta-hydroxycostunolide 
3beta-hydroxyurs-20-en-28-oic acid 
3beta-O-\{alpha-L-Rhap-(1->2)-beta-D-Glcp-(1->4)-[beta-D-Glcp-(1->2)]-alpha-L-Arap\}primulagenin A 
3S-hydrangenol 4'-O-alpha-L-rhamnopyranoysl-(1->3)-beta-D-glucopyranoside 
4',5,6,7-tetramethoxyflavone 
4'-demethyldeoxypodophyllotoxin 
4'-hydroxyacetophenone +   
4'-methoxy-5,7-dihydroxyflavanone +  
4'-O-methylbavachalcone 
4'-O-methylnorbelladine 
4,5-(methanoxy-2-methylethano)isolongifol-4-ene 
4,5-(methanoxyethano)isolongifol-4-ene 
4,5-methylenedioxy-6-hydroxyaurone 
4,6,3',4'-tetramethoxyaurone 
4,6-di-O-sulfo-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-ManpOMe 
4,7-dihydroxy-5-methylcoumarin +  
4-(18,20-dihydroxy-26-methoxy-25-methyloctacosyl)phenyl 3,6-di-O-methyl-beta-D-Glc-(1->4)-2,3-di-O-methyl-alpha-L-Rha-(1->2)-3-O-methyl-alpha-L-Rha 
4-(2,4,7-trioxa-bicyclo[4.1.0]heptan-3-yl)phenol 
4-(4-styrylphenylcarbamoyl)butyric acid 
4-(\{5-[(2-aminoethyl)amino]-2,4-dinitrophenyl\}amino)-TEMPO 
4-(methoxymethyl)phenol 
4-(sulfooxy)-cinnamic acid 
4-[(1S,2R)-3-(4-fluorophenyl)-2-hydroxy-1-(1,2,4-triazol-1-yl)propyl]benzonitrile 
4-[(1S,3aR,4S,6aR)-4-(1,3-benzodioxol-5-yl)tetrahydrofuro[3,4-c]furan-1-yl]-2-methoxyphenol 
4-[N'-(2-hydroxyethyl)thioureido]-L-benzyl EDTA 
4-aminobenzoate 
4-aminobenzoic acid +   
4-aminobutyl beta-D-xylopyranoside 
4-coumarate +  
4-coumaric acid +   
4-coumaroyltriacetic acid lactone 
4-epihederagenin 
4-epiisoinuviscolide 
4-ethenyl-1,2-dimethylbenzene 
4-hydroxy-2,5-dimethylfuran-3-one 
4-hydroxy-5-propionyl-1,3-di-O-methylpyrogallol 
4-hydroxybenzaldehyde 
4-hydroxybenzoate +  
4-hydroxybenzoic acid +   
4-hydroxychalcone  
4-hydroxycinnamaldehyde 
4-hydroxycinnamyl alcohol +  
4-hydroxycordoin 
4-hydroxyindole-3-carbaldehyde 
4-hydroxymellein 
4-hydroxyphenylacetate 
4-hydroxyphenylacetic acid +   
4-isopropylbenzyl alcohol 
4-mercapto-4-methylpentan-2-one 
4-methoxybenzoate 
4-methoxybenzoic acid +  
4-methoxyphenylacetic acid 
4-methyl-1,4-dihydropyridine-3,5-dicarbaldehyde 
4-methylbenzyl alcohol 
4-methylcatechol +   
4-methylheptane +  
4-methylpent-3-en-1-ol +  
4-methyltridecane 
4-methylumbelliferyl acetate  
4-nitrophenyl (4-carboxybutyl)phosphonate 
4-nitrophenyl methylphosphonate 
4-O-(2-acetamido-2-deoxy-beta-D-glucopyranosyl)-5-O-phosphono-D-ribitol 
4-O-(2-acetamido-2-deoxy-beta-D-glucopyranosyl)-D-ribitol +  
4-O-acetyl-2,3-di-O-methyl-alpha-L-fucopyranose 
4-O-beta-D-glucosyl-trans-4-coumaric acid 
4-oxopentanoate +  
4-oxopentanoic acid +   
4-terpineol +   
4alpha-hydroxypinoresinol 
4beta,10alpha-dihydroxy-5alphaH-guai-1(2),11(13)-dien-12,8alpha-olide 
4beta-[(beta-D-glucopyranosyl)hydroxy]-pinoresinol 
5''-methoxyhydnocarpin-D 
5'-CGAAAGUCCGAUCGGCGUAAUGUCA-3' RNA fragment 
5'-CGTGCTGTTTTTTTTTG-3' 
5'-CGUUCGCG-3' RNA fragment 
5'-GACCCCUG-3' RNA fragment 
5'-GUUUGGCGACGUCCCACAUGAGCC-3' RNA fragment 
5'-TCGAGCTGCCTTCAGTCGT-3' 
5,3'-di-O-methylluteolin 
5,6,7,8-tetramethoxy-3',4'-methylenedioxyisoflavone 
5,6,7-trimethoxyflavone  
5,6-dehydrotomatine 
5,7,2'-trihydroxy-6-methoxyflavone 
5,7,3',5'-tetrahydroxy-3,4'-dimethyoxyflavone 
5,7,3',5'-tetrahydroxyflavanone 
5,7,4'-trihydroxy-6,8-diprenylisoflavone 
5,7-dihydroxy-4'-methoxyflavone +   
5-(1-hydroxybutan-2-yl)isolongifol-5-ene 
5-(1-hydroxypropan-2-yl)isolongifol-5-ene 
5-(1-hydroxypropan-2-yl)isolongifolane 
5-(1-methoxybutan-2-yl)isolongifol-5-ene 
5-(1-oxopropan-2-yl)isolongifol-5-ene 
5-(2-amino-5,6-dimethyl-1H-benzimidazol-1-yl)pentanoic acid 
5-(2-hydroxyethyl)isolongifol-5-ene 
5-(2-methoxyethyl)isolongifol-5-ene 
5-(3-buten-1-ynyl)-2,2'-bithiophene 
5-(3-hydroxybutan-2-yl)isolongifol-5-ene 
5-(3-hydroxypropyl)-2-(2-methoxy-4-hydroxyphenyl)benzofuran 
5-(6-O-malonyl-beta-D-glucosyloxy)-indole-3-carboxylic acid 
5-(\{4-[2-(1-oxidopiperidin-1-yl)ethyl]phenyl\}amino)-5-oxopentanoic acid 
5-(undeca-3,5,7-trien-1-yl)-2-furyl hydrogen carbonate 
5-(undeca-3,5,7-trien-1-yl)furan-2-ol +  
5-[(4,6-diamino-1,3,5-triazin-2-yl)amino]-4-hydroxy-3-[(2-sulfophenyl)diazenyl]naphthalene-2,7-disulfonic acid 
5-[(4-nitrobenzyl)(phosphonomethyl)amino]valeric acid 
5-[(E)-caffeoyl]shikimate 
5-[(E)-caffeoyl]shikimic acid 
5-[10-(5-methoxy-1,5-dioxopentyl)-1,7-dioxa-4,10-diazacyclododec-4-yl]-5-oxopentanoic acid methyl ester 
5-amino-2-chlorobenzotrifluoride 
5-aminolevulinic acid +   
5-aminopentanal 
5-ammoniopentanal 
5-bromo-8-methoxy-1-methyl-beta-carboline 
5-chloro-7-iodoquinolin-8-ol  
5-heptadecylresorcinol 
5-hydroxy-3,3',4',7-tetramethoxyflavone 
5-hydroxy-3-(4-hydroxy-3-methyl-but-2-enyl)-8,8-dimethyl-2-(2,4,5-trihydroxy-phenyl)-8H-pyrano[2,3-f]chromen-4-one 
5-hydroxy-6,7-dimethoxy-2-methylchromone 
5-hydroxy-8-methoxy-4-phenylisoquinolin-1(2H)-one 
5-hydroxy-L-tryptophan 
5-hydroxybenzofuran-2-one 
5-hydroxyconiferyl alcohol +  
5-hydroxyvomicine 
5-methoxy-N,N-dimethyltryptamine 
5-methoxyindole-2-carboxylic acid  
5-methoxypsoralen  
5-O-demethylpaxanthonin +  
5-O-phosphono-alpha-D-ribofuranosyl diphosphate 
5-tricosylresorcinol 
5alpha-campestan-3-one 
5alpha-ergosta-7,22-dien-3beta-ol 
6'',7''-dihydro-5',5'''-dicapsaicin 
6'-O-galloylalbiflorin 
6,8-dimethylisogenistein 
6,8-diprenylnaringenin 
6-(alpha-D-glucosaminyl)-1D-myo-inositol 1,2-cyclic phosphate 
6-[(1,2-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,3-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,4-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,5-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1-deoxy-D-ribityl)methyl]-5-[(1E)-3-oxobut-1-en-1-yl]uracil 
6-[(2-hydroxyethyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(3-hydroxypropyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(4-aminobenzyl)amino]-2,3,4,5-tetrahydropyridinium 
6-[(4-hydroxybutyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(5-hydroxypentyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-\{4-[hydroxy-(4-nitrophenoxy)phosphoryl]butyrylamino\}hexanoic acid 
6-acetylnimbandiol 
6-C-(alpha-L-arabinosyl)-8-C-(beta-L-arabinosyl)apigenin 
6-C-(alpha-L-arabinosyl)-8-C-(beta-L-arabinosyl)chrysoeriol 
6-C-[2'-O-alpha-L-rhamnopyranosyl-(1''->2')]-alpha-L-arabinopyranosylluteolin 
6-C-[2-O-alpha-L-rhamnopyranosyl-(1''->2')]-beta-D-xylopyranosylluteolin 
6-deacetylnimbin 
6-deoxy-alpha-L-Talp2,3Ac2-(1->3)-beta-D-Glcp-yl group 
6-deoxy-alpha-L-Talp2Ac3Me-(1->3)-beta-D-Glcp-yl group 
6-desmethylsideroxylin 
6-hydroxy-4',5,7-trimethoxyflavone 
6-methoxy-2,6-dimethyloctanal 
6-methoxytaxifolin 
6-methyl-5-[(1E)-3-oxobut-1-en-1-yl]uracil 
6-methylcoumarin 
6-methylsalicylic acid 
6-O-alpha-D-glucopyranosyl-D-fructofuranose +  
6-O-sinapoyl-D-glucono-1,5-lactone 
6-Oxabicyclo[3.1.0]hexane-2-undecanoic acid methyl ester 
6-tuliposide B 
6alpha-acetoxyisoinuviscolide 
6beta-hydroxyferruginol 
6H-dibenzo[b,d]pyran-6-one +  
7,3',5'-trimethylmyricetin 
7,3'-dihydroxy-4'-methoxy-8-methylflavan 
7,4'-dimethylkaempferol 
7,8-diaminononanoic acid +  
7,8-dihydroxyflavone 
7-(4''-hydroxy-3''-methoxyphenyl)-1-phenyl-4E-heptene-3-one 
7-(4''-hydroxy-3''-methoxyphenyl)-5-methoxy-1-phenyl-3-heptanone 
7-(beta-D-glucosyl)-cis-zeatin 
7-(methylsulfinyl)heptylamine 
7-acetyl-16,17-dehydro-16-hydroxyneotrichilenone 
7-benzoylnimbocinol 
7-deacetyl-17-epinimolicinol 
7-deacetyl-7-benzoylepoxyazadiradione 
7-deacetyl-7-benzoylgedunin 
7-deacetylgedunin 
7-dehydroabietanone 
7-demethoxyegonol 
7-demethoxyegonol oleate 
7-demethoxyegonol-9(Z),12(Z)linoleate 
7-demethoxylegonol acetate 
7-demethoxylegonol-2-methylbutanoate 
7-demethylsuberosin +  
7-deoxyloganetic acid +  
7-deoxyloganetic alcohol 
7-deoxyloganetic aldehyde 
7-deoxyloganetin 
7-deoxyloganic acid 
7-epi-alpha-eudesmol 
7-epi-ent-eudesmane-5,11-diol 
7-hydroxy-2',4',5'-trimethoxyisoflavone 
7-hydroxy-5-methoxy-6,8-dimethylflavone 
7-hydroxy-5-methoxy-6,8-dimethylisoflavone 
7-methoxytricin 
7-methylxanthine 
7-O-methylmyricetin 
7-O-methyltectorigenin 
7-O-methylvitexin 2''-O-beta-L-rhamnoside 
7-O-methylvitexin 2''-O-beta-L-rhamnoside(1-) 
7-tridecanol 
8,5'-diferulic acid 
8-(1,1-dimethylallyl)kaempferide 
8-(2-hydroxyethyl)-6-methyllumazine 
8-(3,3-dimethylallyl)chrysin 
8-(methylsulfinyl)octyl isothiocyanate 
8-(methylsulfinyl)octylamine 
8-(methylthio)octylamine 
8-[2-[4-(5,5-dimethyl-1,3-dioxan-2-yl)butylidene]hydrazinyl]-8-oxooctanoic acid methyl ester 
8-acetoxyheterophyllisine 
8-amino-7-oxononanoic acid 
8-benzyl-7-hydroxy-4,10-dioxo-1-phenyl-6-oxa-3,9-diaza-7-phosphatetradecan-14-oic acid 7-oxide 
8-C-alpha-L-arabinopyranosyl-7-O-beta-D-glucopyranosylnaringenin 
8-deoxylactucin 15-oxalate 
8-deoxylactucin-15-glycoside 
8-desmethylsideroxylin 
8-epi-inunolide 
8-epihelenalin 
8-epiinuviscolide 
8-geranylumbelliferone 
8-HPETE methyl ester +  
8-hydroxy-12-oxoabieta-9(11),13-dien-20-oic 8,20-lactone 
8-prenyldaidzein 
8alpha,19-dihydroxylabd-13E-ene-15-oic acid 
9'-hydroxyabscisic acid 
9(S)-HOTrE 
9(S)-HPODE 
9,10,18-trihydroxyoctadecanoic acid 
9,10-dimethoxypterocarpan-3-O-beta-D-glucoside 
9,10-epoxy-18-hydroxyoctadecanoic acid +  
9,12,13-trihydroxyoctadec-10-enoic acid 
9,13(R)-epoxylabd-14-ene 
9-(beta-D-glucosyl)-cis-zeatin 
9-(beta-D-glucosyl)-trans-zeatin 
9-(methylsulfinyl)nonamide 
9-(methylsulfinyl)nonanoic acid 
9-aminononanoic acid 
9-deoxy-9-acetamido-alpha-N-acetylneuraminyl-(2->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
9-deoxy-9-acetamido-N-acetyl-alpha-neuraminic acid 
9-deoxy-hymatoxin A 
9-HODE +   
9-hydroxynonanoic acid +  
9-oxononanoic acid +   
9-ribosyl-trans-zeatin 
9-ribosyl-trans-zeatin 5'-diphosphate 
9-ribosyl-trans-zeatin 5'-monophosphate 
9-ribosyl-trans-zeatin 5'-triphosphate 
9beta-pimara-7,15-diene-3beta-ol 
[3)-6-deoxy-alpha-L-Talp-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2,4Ac2-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2Ac-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2Me-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp4Ac2Me-(1->3)-beta-D-Glcp-(1->]n 
[3)-alpha-D-Galp-(1->3)-beta-D-Galf2Ac-(1->]n 
[3)-beta-D-Glcp-(1->]5 
[3)-beta-D-Glcp6,NAc2-(1->] residue 
[3)-beta-D-GlcpNAc-(1->4)-alpha-L-Rhap-(1->]n 
[3-(2,2,3-trimethylcyclopent-3-enyl)cyclohex-3-enyl]methanol 
[4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->3)-beta-D-QuiNAc-(1->2)-beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->]n 
[4)-alpha-D-Galp-(1->3)-beta-D-Galf-(1->]n 
[4)-alpha-D-Glcp-(1->4)-alpha-D-Glcp-(1->4)-alpha-D-Glcp-(1->] residue 
[4)-beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->]n 
[4-(2,2,3-trimethylcyclopent-3-enyl)cyclohex-3-enyl]methanol 
[epicatechin-(4beta->8)]5-epicatechin 
[N-(4-cyanophenyl)-N'-(diphenylmethyl)guanidine]acetic acid  
abacopterin A 
abacopterin B 
abacopterin C 
abietatriene 
abietic acid +   
abrusoside A 
absinthin 
abyssinone I 
abyssinone VI 
acacetin-8-C-neohesperidoside 
acalyphin 
acenaphthoquinone  
acetaldehyde oxime +   
acetosyringone +  
acetyl aleuritolic acid 
acetylcaranine 
achillin 
aconine 
acremoauxin A 
acronidine 
acronycidine 
acrophylline 
acroptilin 
acrovestone +  
acrylonitrile +   
acteoside  
actinidine  
actinodaphnine 
aculeacin A 
acuminatin 
adonixanthin 
ADP alpha-D-glucoside 
afrormosin  
afzelechin +  
afzelechin-(4alpha->8)-afzelechin 
afzelin  
aglaiabbreviatin A 
aglaiabbreviatin B 
aglaiabbreviatin C 
aglaiabbreviatin D 
aglaiabbreviatin E 
aglaiabbreviatin F 
agrocinopine A 
agrocinopine B 
agrocinopine C 
agrocinopine D 
AICA ribonucleotide  
aigialone 
ajaconine 
ajubractin A 
ajubractin B 
ajubractin C 
ajubractin D 
ajubractin E 
ajugaciliatin A 
ajugaciliatin B 
ajugaciliatin C 
ajugaciliatin D 
ajugaciliatin E 
ajugaciliatin F 
ajugaciliatin G 
ajugaciliatin H 
ajugaciliatin I 
ajugaciliatin J 
ajugacumbin A 
ajugacumbin A chlorohydrin 
ajugacumbin F 
ajugalide B 
ajugalide C 
ajugamarin A1 
ajugamarin A1 chlorohydrin 
ajugamarin A2 
ajugamarin A2 chlorohydrin 
ajugamarin B1 
ajugamarin G1 
ajugamarin H1 
ajuganipponin A 
ajuganipponin B 
ajugapantin A 
ajugapitin 
ajugatakasin A 
ajugatakasin B 
akuammicine 
akuammigine 
alangicine 
alangimarckine 
alangimarine 
alangiside 
alantolactone +   
alatolide 
albafuran A 
albiflorin +   
albizoside A 
albizoside B 
albizoside C 
aliphatic nitrogen antifungal agent +  
alizarin +   
all-cis-octadeca-6,9,12,15-tetraenoic acid +  
all-trans-neoxanthin  
all-trans-phytoene  
all-trans-phytofluene  
all-trans-zeta-carotene 
allantoic acid 
alliin +   
alliin zwitterion 
allolicoisoflavone A 
allose +   
allyl alcohol +   
allyl methyl disulfide  
Aloe emodin  
alpha,gamma-onoceradienediol 
alpha-(1->3)-galactobiose +  
alpha-aminoorcein +  
alpha-benzoyloxypaeoniflorin 
alpha-bergamotene +  
alpha-bergamotenoic acid 
alpha-cadinol 
alpha-campholenaldehyde +  
alpha-carotene +   
alpha-colubrine 
alpha-cubebene 
alpha-D-Abep-(1->3)-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-D-GlcNAc +  
alpha-D-Gal-(1->3)-beta-D-Gal-(1->3)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-galactosaminyl-(1->3)-[alpha-L-fucosyl-(1->2)]-beta-D-galactosyl derivative(1+) 
alpha-D-galactosyl-(1->2)-alpha-D-galactose 
alpha-D-galactosyl-(1->2)-beta-D-galactose +  
alpha-D-galactosyl-(1->2)-D-galactosyl group 
alpha-D-galactosyl-(1->3)-1D-myo-inositol 
alpha-D-galactosyl-(1->3)-D-galactose +  
alpha-D-galactosyl-(1->3)-D-galactosyl group 
alpha-D-galactosyl-(1->4)-beta-D-galactosyl group +  
alpha-D-galacturonate 
alpha-D-GalNAc-(1->2)-beta-D-Man-(1->4)-[beta-D-Glc-(1->2)]-alpha-D-Man-(1->5)-alpha-Kdo 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-GalNpAc-(1->3)-beta-D-GalpNAc 
alpha-D-Galp-(1->2)-[alpha-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp 
alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-[alpha-D-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-D-Galp +  
alpha-D-Galp-(1->3)-[alpha-D-Galp-(1->4)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group +  
alpha-D-Galp-(1->3)-beta-D-Manp 
alpha-D-Galp-(1->4)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-D-Galp-(1->4)-beta-D-GalpNAc-(1->3)-D-Galp 
alpha-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GalpN-(1->4)-alpha-D-GalpA-yl group 
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-yl group +  
alpha-D-GalpNAc-(1->3)-beta-D-Galp +  
alpha-D-GalpNAc-(1->4)-[alpha-D-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Glcp-(1->3)-alpha-L-Rhap 
alpha-D-Glcp-(1->6)-alpha-D-Glcp-(1->6)-beta-D-Glcp +  
alpha-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-D-GalpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN-4P-(1->6)-alpha-D-GlcN-1P 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc 
alpha-D-Man-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->3)-[alpha-D-Man-(1->2)-alpha-D-Man-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-mannose +  
alpha-D-mannose 6-phosphate +  
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-D-Manp +  
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-alpha-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc +  
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-D-Manp-(1->6)-beta-D-Manp +  
alpha-D-Manp6P-(1->3)-alpha-D-Manp-(1->3)-alpha-D-Manp-(1->3)-alpha-D-Manp-(1->2)-D-Manp +  
alpha-D-Rhap-(1->2)-alpha-D-Rhap-(1->3)-alpha-D-Rhap 
alpha-D-Rhap-(1->3)-alpha-D-Rhap 
alpha-D-Rhap-(1->3)-alpha-D-Rhap-(1->2)-alpha-D-Rhap 
alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo 
alpha-D-Rhap4NFo-(1->3)-alpha-D-Rhap4NFo +  
alpha-D-Xylp-(1->6)-beta-D-Glcp 
alpha-guaiene 
alpha-humulene +   
alpha-hydroxyorcein +  
alpha-KDN-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-D-Glcp 
alpha-KDN-(2->6)-beta-D-Galp-(1->4)-D-GlcpNAc 
alpha-Kdo-(2->8)-[alpha-Kdo-(2->4)]-alpha-Kdo 
alpha-L-Araf-(1->2)-beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
alpha-L-Fuc-(1->2)-[alpha-D-Gal-(1->3)]-beta-D-Gal +  
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-D-GlcNAc 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]GlcNAc-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc 
alpha-L-Fuc-(1->3)-[beta-D-Gal-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-L-Fuc-(1->3)-[beta-D-Gal-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-L-Fuc-(1->3)-beta-D-GalNAc-(1->4)-beta-D-GlcNAc-yl group 
alpha-L-fucose +  
alpha-L-fucosyl group +  
alpha-L-fucosyl-(1->2)-beta-D-galactosyl group 
alpha-L-fucosyl-(1->4)-N-acetyl-beta-D-glucosamine +  
alpha-L-Fucp-(1->2)-(1->3)-[alpha-D-Galp]-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[beta-D-Galp-(1->3)-alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-D-Glcp 
alpha-L-Fucp-(1->2)-[beta-D-Galp-(1->3)-alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-\{alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->6)\}-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-Glcp6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-GlcpNAc6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-Glcp +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-Glcp6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-[alpha-Neup5Ac-(2->3)-beta-D-Galp6S-(1->4)]-beta-D-GlcpNAc 
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->4)-[beta-D-Galp3S-(1->3)]-beta-D-GlcpNAc 
alpha-L-FucpNAc-(1->3)-D-FucpNAc 
alpha-L-rhamnopyranose +   
alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->2)-alpha-L-Rhap 
alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap 
alpha-L-Rhap-(1->3)-alpha-D-Galp 
alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc 
alpha-mangostin  
alpha-mycolic acid 
alpha-N-acetylneuraminyl-(2->3)-D-galactosyl group +  
alpha-N-acetylneuraminyl-(2->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->6)]-D-GalNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-Neu5Ac-(2->6)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-D-Gal +  
alpha-Neu9,NAc2-(2->6)-GalNAc 
alpha-Neup5,9Ac2-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5,9Ac2-(2->6)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->3)-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-D-GalpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-D-Galp-yl group 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[beta-D-Galp-(1->4)-beta-D-Glcp-(1->6)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1->6)]-2,5-anhydro-D-Man 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-D-GalpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp6S-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)]-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->6)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)]-D-GalpNAc +  
alpha-Neup5Ac-(2->6)-beta-D-Galp 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-GalpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac +  
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +   
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-[beta-D-GalpNAc-(1->4)]-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-yl group 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-beta-Neup5Ac 
alpha-Neup5Ac-(2->8)-beta-Neup5Ac 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-D-Glcp-yl group 
alpha-Neup5Gc-(2->6)-alpha-D-GalpNAc 
alpha-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-D-Glcp-yl group 
alpha-NeupNAc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S 
alpha-nimolactone 
alpha-nootkatol 
alpha-onocerin 
alpha-phellandrene +  
alpha-pinene +   
alpha-pinene oxide 
alpha-santalenoic acid 
alpha-santonin +   
alpha-selinene 
alpha-terpinene +   
alpha-terpineol +   
alpha-tocopherol +   
alpha-tocotrienol  
alphitonin 
altenusin  
amabiline 
amaralin 
amaranthin 
amaryllisine 
amataine 
ambiguine H 
ambiguine I 
amentoflavone +   
amide antifungal agent +   
ammodendrine 
amocarzine 
amomol A 
amomol B 
ampelopsin B 
amphotericin B methyl ester  
amygdalin +  
amylose +   
anabasine +   
ananolignan B 
ananolignan C 
ananolignan D 
ananolignan E 
ananolignan F 
ananolignan G 
ananolignan H 
ananolignan I 
ananolignan J 
ananolignan K 
ananolignan L 
ananolignan M 
ananolignan N 
anethole +   
angelic acid +  
angelitriol 
angelol-J 
anisole +   
ankorine 
anthemis glycoside +  
antheraxanthin 
anthraflavic acid  
anthragallol 
antibiotic antifungal agent +   
antifungal drug +   
antimycin A  
apigenin 7,4'-dimethyl ether 
apigenin-7-O-gentiobioside 
apiin +  
apocynin  
Arabidopsis thaliana metabolite +   
arcapillin 
ardisianoside A 
ardisianoside B 
ardisianoside C 
ardisianoside D 
ardisianoside E 
ardisimamiloside E 
argpyrimidine 
aristolochene +  
aristoloterpenate-I 
arjunolic acid +   
aromaticin 
artemoin +  
artemoin A 
artemoin B 
artemoin C 
artemoin D 
asarone +   
ascaridole  
ascochlorin 
ascomycin  
ascorbyl dipalmitate 
asebogenin 
aspalathin  
asparagoside F 
asperentin +   
asphodelin A +  
asphodelin A-4'-O-beta-glucoside 
astaxanthin  
astilbin  
astragalin heptaacetate 
astragaloside I 
astragaloside II 
astragaloside IV  
asukamycin 
athyriol 
atisine 
atovaquone  
atropine +   
atropinium 
aurafuron A 
auraptene  
aureothin 
aureusidin +   
auriculoside 
australifungin 
avicularin 
axillarin 
azadirachtin +   
azadirachtin B 
azadiradione +   
azadiradionolide 
azadirone +  
azaleatin 
azaserine 
azetidine-2-carboxylic acid +  
azoxybacilin 
azulene +  
baccatin III +   
bacilysocin 
backebergine 
baicalein +   
baicalin  
BAR0329 
barogenin 
barringtogenol C +  
bauhinoxepin F 
bauhinoxepin I 
bauhinoxepin J 
bayogenin 3-O-cellobioside 
beauvericin  
belladine 
benzaldehyde  
benzethonium chloride  
benzoate +   
benzoic acid +   
benzophenone +   
benzothiazole +   
benzoylaconine  
benzoylhypaconine  
benzoylmesaconine  
benzyl 2,5-dihydroxybenzoate 
benzyl alcohol +   
benzyl benzoate  
benzyl beta-D-glucopyranoside 
benzyl cinnamate  
benzyl thiol 
benzylamine +   
benzylpenamaldate group 
benzylpenamidyl group 
benzylpenicanyl group 
benzylpenicillenyl group 
benzylpenicillin +   
benzylpenicilloic acid 
benzylpenicilloyl group +  
benzylpenilloic acid 
beryllium atom +   
beta-(1->3)-galactobiose +  
beta-(4-hydroxyphenyl)ethyl-4-O-E-caffeoyl-O-[beta-D-apiofuranosyl-(1->2)]-beta-D-glucopyranoside 
beta-alanine betaine 
beta-aminoorceimine +  
beta-aminoorcein +  
beta-aminopropionitrile +   
beta-aminopropionitrile hemifumarate 
beta-amyrin +   
beta-benzoyloxypaeoniflorin 
beta-bisabolene +  
beta-bitter acid +  
beta-carotene +   
beta-carotene 5,6-epoxide +  
beta-cellobiose +  
beta-colubrine 
beta-cryptoxanthin +  
beta-cubebene 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)]-alpha-D-Araf-(1->5)-alpha-D-Araf +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)]-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)]-alpha-D-Araf-(1->5)-alpha-D-Araf-yl group +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-alpha-D-Araf-(1->5)-alpha-D-Araf 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe 
beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->3)-\{beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-[alpha-L-Fuc-(1->6)]-beta-D-GlcNAc 
beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->3)-\{beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
beta-D-Gal-(1->3)-[beta-D-GlcNAc-(1->6)]-D-GalNAc +  
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
beta-D-Gal-(1->4)-alpha-D-Glc-(1->3)-[alpha-D-GlcNAc-(1->2)]-alpha-L-Hep 
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-[beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->4)]-alpha-D-Man-(1->3)-[beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-D-GlcNAc +  
beta-D-galactose +   
beta-D-galactosyl-(1->3)-alpha-D-mannose 
beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl group 
beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl group 
beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl group 
beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl group +  
beta-D-Galf-(1->3)-alpha-D-Manp 
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-GalNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-D-Glc +  
beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
beta-D-GalNAc-(1->4)-beta-D-GalNAc-yl group 
beta-D-Galp-(1->2)-beta-D-Galp +  
beta-D-Galp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->3)-L-glycero-alpha-D-manno-Hepp-(1->5)-Kdo 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-yl group 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcpNAc +  
beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-D-GalpNAc +  
beta-D-Galp-(1->3)-[beta-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-\{alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcNAc-(1->6)\}-D-GalNAc +  
beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp-(1->3)-beta-D-GalpNAc +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-D-Glcp +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-yl group +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-D-Galp-yl group 
beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp +  
beta-D-Galp-(1->3)-D-GalpNAc +  
beta-D-Galp-(1->3)-D-GlcpNAc +  
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->6)-[beta-D-Galp-(1->3)]-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-D-Glcp +  
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp6S +  
beta-D-Galp-(1->4)-alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-alpha-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcNAcp-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->4)-beta-D-Glcp6S 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-\{alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-[alpha-D-Manp-(1->3)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-D-GalpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)-alpha-D-GalpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->3-)-alpha-D-GalpNAc 
beta-D-Galp3S-(1->3-)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp +  
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp6S 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc6S +  
beta-D-Galp3S-(1->4)-beta-D-Glcp 
beta-D-Galp3S-(1->4)-beta-D-Glcp6S 
beta-D-Galp3S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-beta-D-GlcpNAc6S 
beta-D-Galp4S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp6S-(1->4)-beta-D-Glcp 
beta-D-Galp6S-(1->4)-beta-D-Glcp6S 
beta-D-Galp6S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp6S-(1->4)-beta-D-GlcpNAc6S 
beta-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp 
beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->3)-alpha-D-GalpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-D-Galp 
beta-D-GalpNAc-(1->4)-[alpha-Neup5Gc-(2->3)]-beta-D-Galp +  
beta-D-GalpNAc-(1->4)-[alpha-Neup5Gc-(2->3)]-beta-D-Galp-(1->4)-R group +  
beta-D-GalpNAc-(1->4)-alpha-D-GalpNAc 
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
beta-D-GalpNAc-(1->4)-D-GlcpNAc +  
beta-D-GlcNAc-(1->4)-MDP-Lys(L18) 
beta-D-Glcp(1->6)-alpha-D-GlcpNAc-(1->3)-alpha-L-QuipNAc-(1->3)-beta-D-GlcpNAc 
beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-GlcpO[CH2]5CO2Me 
beta-D-Glcp-(1->6)-beta-D-Glcp +  
beta-D-GlcpA-(1->3)-beta-D-Galp +  
beta-D-GlcpA-(1->3)-beta-D-GlcpNAc 
beta-D-GlcpA-(1->6)-beta-D-Galp 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->4)]-[beta-D-GlcpNAc-(1->6)]-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-alpha-D-GalpNAc +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-D-Manp +  
beta-D-GlcpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-GlcpNAc-(1->4)-[beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc +  
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->6)-alpha-D-GalpNAc +  
beta-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc6S-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-glucosamine +   
beta-D-glucose +   
beta-D-glucose 6-phosphate 
beta-D-glucosyl-N-(octadecanoyl)sphinganine 
beta-D-mannose +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-alpha-D-Manp +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-beta-D-Manp +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-D-Manp +  
beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->3)-beta-D-QuiNAc-yl group 
beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-yl group 
beta-D-Tyvp-(1->3)-beta-D-GalpN-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpN6,OMe2 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc6,OMe2 
beta-D-Tyvp2Me-(1->3)-beta-D-GalpN6,OMe2 
beta-D-Tyvp2Me-(1->3)-beta-D-GalpNAc-OMe 
beta-damascenone  
beta-elemene +  
beta-erythroidine +   
beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-R group +  
beta-gurjunene 
beta-hydroxyorcein +  
beta-ionone +   
beta-isosalicin 
beta-L-fucosyl-(1->3)-N-acetyl-beta-D-glucosamine 
beta-lapachone  
beta-maaliene 
beta-melibiose 
beta-myrcene  
beta-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-NeupNAc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-nimolactone 
beta-nootkatol 
beta-onocerin 
beta-peltatin 
beta-phellandrene +  
beta-pinacene 
beta-pinene +   
beta-sanshool 
beta-sesquiphellandrene 
beta-sitosterol 3-O-acetate 
beta-sitosterol glucoside-3'-O-hexacosanoicate 
beta-terpineol 
beta-thujaplicin  
beta-thujene 
beta-tocopherol  
beta-tocotrienol  
betaine aldehyde 
betavulgarin 
betulinic acid +   
bianfugenine 
bigelovin 
bikaverin 
biliatresone 
biochanin A +   
biochanin A 7-O-beta-D-glucoside 
bixin dialdehyde 
borrelidin  
botanical anti-fungal agent +   
botrallin 
botryosphaerin H 
brasilinolide A 
brasilinolide B 
Brassica napus metabolite +   
brassicasterol +  
brassinolide 23-O-alpha-D-glucoside 
brazilein  
brazilin  
breynceanothanolic acid 
bridged diphenyl antifungal agent +   
bromophycolide A 
broussin 
bruceine D 
bruceolline E 
bruceolline F 
bruceolline H 
bruceolline I 
bruceolline J 
bruceolline K 
bruceolline L 
bruceolline M 
bruceolline N 
brugunin A 
bryotoxin A 
buddlenol A 
buddlenol B 
buddlenol C 
buddlenol E 
bulbocapnine +  
bullatantriol 
burchellin 
burrodin 
butrin 
butyl anthranilate 
butyl benzoate 
butyl formate 
butyl hexadecanoate 
C-2'-decoumaroyl-aloeresin G 
cabraleadiol 
cabraleadiol monoacetate 
cabraleahydroxylactone 
cabraleahydroxylactone acetate 
cabralealactone 
cabraleone 
cadabicine sulfate 
cadaverine +   
cadaverine(2+) +  
CAF-603 
cafestol  
caffeic acid +   
caffeic acid quinone 
caffeine +   
caffeoylglycolic acid methyl ester 
cajanol  
callipeltin A 
calophyllin B 
calycanthaceous alkaloid +  
Camellia sinensis metabolite +  
camphene +   
camphor +   
camptothecin  
candidachalcone 
candidoside 
cangorinine E-1 
cangoronin 
cannabidiol +   
cannabigerol  
canophyllal 
capensinidin 
capilliposide B 
capsanthin +   
capsanthin 5,6-epoxide 
capsiate  
caracurine VII  
caranine +  
carbendazim  
carnosic acid  
carpaine 
carpesiolin 
carthamidin +  
carveol +   
caryoptin 
casbene 
cassaidine 
cassaine 
cassameridine 
cassiaoccidentalin B 
cassiarin B 
cassiatannin A 
castasterone 23-O-alpha-D-glucoside 
casticin  
catechol +   
catecholate(1-) 
catecholate(2-) 
catiguanin A 
catiguanin B 
cauloside D 
ceanothic acid 
cedr-8(15)-en-9-ol 
celacinnine 
celastolide 
cellobiose +  
centaureidin 
cercosporamide 
cerulenin  
chaetoglobosin L 
chaetoviridin A 
chaetoviridin B 
chalcone +   
chamaejasmenin A 
chamaejasmenin D 
chartaceone A +  
chasmanine 
chaulmoogric acid +  
chlorflavonin 
chlorogenate 
chlorogenic acid  
chloromonilicin 
CHOH group 
cholest-4-en-3-one +   
choline +   
chorismic acid +  
chrysanthemic acid +   
chrysazin +   
chrysene +   
chrysin +   
chrysin 5,7-dimethyl ether  
chrysophanol +   
chrysopine +  
chrysosplenetin  
chrysosplenol C 
ciguatoxin ABC ring fragment 
ciguatoxin ABCDE ring fragment 
ciguatoxin JKLM ring fragment 
CII259-273 
cimifoetiside A 
cimifoetiside B 
cinnamic acid +   
cinnamtannin A2 
cinnamtannin B-1 
cinnamtannin D-1 
cinnamyl acetate 
cinnamyl alcohol +   
cirsilineol 
cirsiliol  
cis-11,14,17-eicosatrienoic acid methyl ester 
cis-11,14-eicosadienoic acid methyl ester 
cis-11-eicosenoic acid methyl ester 
cis-13,16-Docosadienoic acid methyl ester 
cis-3-hexenal 
cis-4,7,10,13,16,19-docosahexaenoic acid methyl ester 
cis-4-coumarate 
cis-4-hydroxy-D-proline betaine 
cis-5,8,11,14,17-eicosapentaenoic acid methyl ester 
cis-caffeic acid +   
cis-cis-nepetalactol 
cis-cis-nepetalactone 
cis-ferulic acid +  
cis-heme d hydroxychlorin gamma-spirolactone methyl ester 
cis-isogeraniol 
cis-sesquisabinene hydrate 
cis-sinapic acid 
cis-trans-nepetalactone 
cis-zeatin 
citrafungin A 
citrafungin B 
citral +   
citramalate(2-) +  
citramalic acid +  
citronellal +   
citronellic acid +  
citronellol +   
citronellol acetate  
civetone 
CJ-01 
clarinoside 
cleistanthins +  
clerodin 
clethroidoside A 
clethroidoside B 
clethroidoside C 
clethroidoside D 
clethroidoside E 
clethroidoside F 
clethroidoside G 
clethroidoside H 
clionasterol 
closantel  
cneorin-NP36 
cocaine  
cochalic acid 
cochinchinone A 
cochinchinone G 
cochinchinoxanthone 
cochinensoxanthone 
cohibin +  
colchicine +   
columbianadin 
columbianetin acetate 
combretanone A 
combretanone B 
combretanone C 
combretanone D 
combretanone E 
combretanone F 
combretanone G 
combretic acid A 
combretic acid B 
combretol 
conazole antifungal agent +   
concanamycin A  
conessine 
confertin 
coniferin 
coniferol +  
coniferyl aldehyde +   
coniferyl benzoate 
coprostanol +  
cordycepin triphosphate 
cordysinin E 
corianin 
coriatin 
cornusalterin A 
cornusalterin B 
cornusalterin C 
cornusalterin D 
cornusalterin E 
cornusalterin F 
cornusalterin G 
cornusalterin H 
cornusalterin I 
cornusalterin J 
cornusalterin K 
cornusalterin L 
coumaphos  
coumarin +   
coumestan +   
coumestrol +   
crassicauline A 
cremastranone +  
crinosterol 
crocin-1  
crotonic acid +  
cryptocaryol A 
cryptocaryol B 
cryptocaryol C 
cryptocaryol D 
cryptocaryol E 
cryptolepine  
crystal violet  
crystal violet cation +   
CT2108A 
CT2108B 
CTBT 
cucurbitacin E 2-O-beta-D-glucopyranoside 
cucurbitacin I +   
cucurbitacin I 2-O-beta-D-glucopyranoside 
cucurbitacin J +  
cucurbitacin J 2-O-beta-D-glucopyranoside 
cucurbitacin K 2-O-beta-D-glucopyranoside 
cudraflavone B  
cudraflavone C 
cuminaldehyde 
cumingianoside A 
cumingianoside B 
cumingianoside C 
cumingianoside D 
cumingianoside E 
cumingianoside F 
curcumin +   
curcumin 4'-O-beta-D-gentiotetraside 
curcumin 4'-O-beta-D-gentiotrioside 
Cuscuta propenamide 2 
cyanidin 3-O-(2''-O-galloyl-beta-D-galactopyranoside) 
cyanidin 3-O-(6-O-acetyl-beta-D-glucoside) 
cyanidin 3-O-beta-D-galactoside +  
cyanidin 3-O-beta-D-galactoside(1-) 
cyanin +  
cyclanoline 
cycloartenol +   
cyclodopa 5-beta-D-glucoside 
cycloeucalenone 
cyclolaudenol 
cyclomorusin A 
cyclomulberrin +  
cyclosporin A +   
cyclotetradecane +  
cylindol A 
cystothiazole A 
cytisine  
D-alpha-D-Hepp-(1->6)-beta-D-Glcp 
D-erythrose +   
D-galactopyranuronate +  
D-glucosyl salicylate +  
D-glycero-D-gulo-heptopyranose 
D-lyxonic acid +  
D-lyxono-1,4-lactone 
D-lyxosylamine 
D-manno-heptulose +  
D-psicose +  
D-ribulose 1,5-bisphosphate 
D-tagatose +  
D-valinate 
D-valinium 
daidzein +   
daidzein 7-(6-O-acetyl-beta-D-glucoside) 
daidzein 7-O-beta-D-glucoside +   
daidzein(1-) 
dalcochinin-8'-O-beta-D-glucoside 
danielone 
daturadiol 
daucosterol 
dauricine +   
decan-2-one 
decanal  
decanoate +  
decanoic acid +   
decarboxysuprofen 
decarboxytiaprofenic acid 
decussatin 
dehydrodiconiferyl alcohol +  
delphinidin +   
delphinidin 3-O-beta-D-glucoside 
delphinidin(1-) 
Delta(9)-tetrahydrocannabinol +   
delta-cadinol 
delta-elemene 
delta-guaiene 
delta-terpineol acetate 
delta-tocopherol  
delta-tocotrienol  
demethoxyaschantin 
demethylsqualene 
demethylzeylasteral 
deoxyaconitine 
deoxyflindissone 
deoxyhumulone 
deoxypodophyllotoxin  
deoxyviolacein 
dequalinium +   
dequalinium chloride 
desfuranoazadiradione 
desmethyl tocotrienol 
desmethylxanthohumol 
diacetone alcohol 
diallyl disulfide  
dianversicoside A 
dianversicoside B 
dianversicoside C 
dianversicoside D 
dianversicoside E 
dianversicoside F 
dianversicoside G 
diarylheptanoid +   
DIBOA +  
dicarboximide antifungal agent +   
dichlorodiaportinolide 
dichlorvos  
dichotomide III 
dichotomide IV 
dichotomide V 
dichotomide VI 
dichotomoside D 
diethylstilbestrol +   
diffutin 
Dig-Cy5 
digoxigenin +   
digoxin +   
dihomolinoleate 
dihomolinoleic acid +  
dihydroanhydropodorhizol 
dihydroartemisinic acid 
dihydrocarveol +  
dihydrocarvone +  
dihydrochalcone +   
dihydroconiferyl alcohol +  
dihydroconiferyl alcohol glucoside 
dihydroferulate 
dihydroferulic acid +  
dihydrofukinolide 
dihydrogenistin 
dihydrolicoisoflavone A 
dihydromyrcenol 
dihydrooroxylin A 
dihydropinosylvin 
dihydroresveratrol +   
dihydrosanguinarine +   
dihydroxyacetone +   
dihydrozeatin +  
DIMBOA +  
DIMBOA glucoside +  
Dimethyl adipate  
dimethyl fumarate  
dimethyl maleate  
Dimethyl suberate 
dimethylselenide +  
dioncophylline A 
dioscin  
diosmetin +   
diosphenol 
diphenyl ether +   
diphenyl sulfone +   
diplotasin 
diplotrin A 
diplotrin B 
diplotrin C 
dipropyl disulfide  
dipsacussaponin A 
disodium maleate 
djalonensone 
Dnp-Asn-Gln 
Dnp-Gln 
Dnp-Nor-Gln 
Dnp-Sar-Gln 
Dnp-Thr-Gln 
Dnp-Trp-Gln 
docosane +  
docosanoic acid +  
dodecan-1-ol +   
dodecanal 
dodecane +   
dodecanoate +  
dodecanoic acid +   
dodecyldimethylamine N-oxide 
dolabradiene +  
dolichodial 
dotriacontan-1-ol +  
dotriacontanal 
dracorubin 
dregamine 
drimendiol 
dT4 
dT6 
dT8 
dTDP-alpha-L-rhamnose 
dTT(6-4)TT 
duvoglustat +   
dysolenticin A 
dysolenticin B 
dysolenticin C 
dysolenticin D 
dysolenticin E 
dysolenticin F 
dysolenticin G 
dysolenticin H 
dysolenticin I 
ecgonine benzoate  
edudiol 
egonol +  
egonol acetate +  
egonol beta-D-glucoside 
egonol oleate +  
egonol-2'''-methyl butanoate +  
egonol-2-methylpropanoate 
egonol-9(Z),12(Z)linoleate +  
egonolbutanoate 
egonolpropanoate 
elaiophylin 
elemol 
ellagic acid +   
ellipticine  
embelin +   
emetine +   
emodepside  
emodin +   
emodin(1-) 
enfumafungin 
ENPAVHFFKNIVTPRTP 
ENPVVAFFKNIVTPRTP 
ENPVVHFFFNIVTPRTP 
ENPVVHFFKNIVTPRTP 
ENPVVHFFYNIVTPRTP 
ent-3beta-hydroxycassa-12,15-dien-2-one 
ent-atiserene 
ent-cassa-12,15-dien-2-one 
ent-cassa-12,15-dien-2beta,3beta-diol 
ent-cassa-12,15-dien-2beta-ol 
ent-kaur-16-en-19-oic acid 
epi-cedrol 
epi-isochromophilone II 
epi-progoitrin 
epi-tulipinolide 
epichlicin 
epimelibiose 
epipinoresinol 
epizonarene 
epoxyazadiradione +  
eprinomectin  
ergolide 
ergothioneine +   
ergothioneine thione form 
erucamide  
erybraedin A 
erylatissin C 
erythritol +  
erythrodiol +  
erythronate +  
erythronic acid +  
esculetin +   
essential oil +   
estriol 3-O-(beta-D-glucuronide)  
ethane +   
ethoprophos  
ethyl (2E,4Z)-deca-2,4-dienoate 
ethyl 3,4-dihydroxybenzoate  
ethyl 3-(methylthio)propionate 
ethyl benzoate 
ethyl butyrate 
ethyl dihydrogen phosphate +   
ethyl formate 
ethyl gallate 
ethyl hexadecanoate 
ethyl hydrogen phosphate(1-) 
ethyl isobutyrate 
ethyl lansiolate 
ethyl linoleate 
ethyl linolenate 
ethyl nonanoate 
ethyl octadecanoate 
ethyl oleate 
ethyl phosphate(2-) 
ethylparaben  
ethylpyrazine 
euchrenone-a7 
eucommiol 
eugeniin 
eugenin 
eugenol +   
eupatolide 
Euphosalicin 
eurysterol A 
eurysterol A sulfonic acid 
eurysterol B 
eurysterol B sulfonic acid 
euscaphic acid 
euxanthone 
exalamide 
fagopyritol A1 
fagopyritol B1 
fangchinoline  
farnesane +   
farnesene +  
farnesol +   
fatsicarpain A 
fatsicarpain B 
fatsicarpain C 
fatsicarpain D 
fatsicarpain E 
fatsicarpain F 
fatsicarpain G 
fellutamide C 
fellutamide D 
fenbendazole +   
fenchone +   
ferreirin 
ferruginol +  
ferulic acid +   
feruloylagmatine +  
ficusequilignan A 
fisetin +   
fisetin 8-C-glucoside 
fisetinidol +  
flubendazole  
flucofuron 
fluorescein-DNP hapten 
foresaconitine 
foresticine 
formononetin +   
formononetin 7-O-glucoside-6''-O-malonate 
formononetin 7-O-rutinoside 
formyl 7-oxo-11E-tetradecenoate 
forrestine 
forskolin +   
FR171456 
FR207944 
FR901469 
FR901469 hydrochloride 
fragin zwitterion 
friedelin +  
fruticoside A 
fruticoside B 
fruticoside C 
fruticoside D 
fruticoside E 
fruticoside F 
fruticoside G 
fucoxanthin  
fungicide +   
furanocandin 
fusaripeptide A 
fusarithioamide A 
fustin +  
futoenone 
galacturonic acid +  
galangin +   
galangin 3,5,7-trimethyl ether 
galanthamine  
galaxolide  
galgravin 
gallate +  
gallic acid +   
gamma-aminoorceimine +  
gamma-aminoorcein +  
gamma-carotene +  
gamma-curcumene 
gamma-elemene 
gamma-Glu-Ala 
gamma-Glu-Ala(1-) 
gamma-glutamyl-beta-cyanoalanine 
gamma-glutamyl-Se-methylselenocysteine 
gamma-hydroxyorcein +  
gamma-linolenic acid +   
gamma-mangostin  
gamma-nonanolactone 
gamma-octalactone 
gamma-sanshool 
gamma-terpinene +   
gamma-tocopherol +   
gamma-tocotrienol 
gancaonin I 
gardenin B  
gartanin 
GDP-alpha-D-mannose +  
GDP-beta-L-fucose 
gedunin +   
genistein +   
genistein 8-C-glucoside 
genisteine 
genistin 7-O-gentiobioside 
gentiacaulein 
gentianose 
gentiobiose +   
gentisein 
gentisin 
gepinacin 
geraldone 
geranial +   
geranic acid  
geraniol +   
geranyl acetate  
geranyl acetone 
geranyl benzoate 
geranylgeraniol +   
geranyllinalool +  
germacrene B +  
germacrene D-4-ol 
gibberellin A1 +  
gibberellin A10 
gibberellin A110 
gibberellin A15 (lactone form) +  
gibberellin A18 
gibberellin A19 
gibberellin A20 +  
gibberellin A24 
gibberellin A29 
gibberellin A3 +   
gibberellin A3(1-) 
gibberellin A4 +  
gibberellin A44 
gibberellin A5 
gibberellin A53 +  
gibberellin A63 
gibberellin A67 
gibberellin A68 
gibberellin A7 
gibberellin A72 
gibberellin A8 +  
gibberellin A9 +  
gibberellin A98 
gigantetronenin 
gigantrionenin 
gingerenone B 
gingerol  
ginkgolide +   
ginsenoside C-K  
ginsenoside C-Y 
ginsenoside F1  
ginsenoside F2  
ginsenoside Mc 
ginsenoside Mx 
ginsenoside Rb1  
ginsenoside Rb2  
ginsenoside Rb3 
ginsenoside Rc  
ginsenoside Rd +   
ginsenoside Re  
ginsenoside Rf  
ginsenoside Rg2  
glabranin 
glepidotin A 
glepidotin B 
gliotoxin  
glochidone 
glochidonol 
glochierioside A 
glochierioside B 
glomosporin 
glucarate(2-) +  
glucaric acid +   
glucitol +   
glucoibarin 
glucosinolate +   
glucosinolic acid +   
glyasperin C 
glyasperin D 
glyasperin F 
glyceollin III 
glyceollin IV 
glyceraldehyde 3-phosphate +   
glycerol 2-phosphate  
glycitein +   
glycitein 7-(6-O-acetyl-beta-D-glucoside) 
glycitein 7-O-beta-D-(2'',4'',6''-O-triacetyl)glucopyranoside 
glycitin +   
glycosmisic acid +  
glycosmisic acid 4'-sulfate 
glycosmisic acid sulfate 
glycycarpan 
glycycoumarin  
glycyrin  
glycyrol  
glycyrrhetinic acid +   
glycyrrhizinic acid  
glycyrrhizol A 
glyflavanone A 
glyinflanin H 
glyoxal-lysine dimer 
GM 193663 
gondoate 
gordonoside I 
gordonoside J 
gordonoside K 
gordonoside L 
gordonoside M 
gordonoside N 
gordonoside O 
gordonoside P 
gossypetin +   
gossypin 
gramine 
grandiflorenic acid 
graveolide 
griffithane A 
griffithane B 
griffithane C 
griffithane D 
guaia-4,6-diene 
guaiacol +   
guaiacylglycerol beta-coniferyl ether 
guaiacylglycerol beta-scopoletinyl ether 
guangsangon K 
guangsangon L 
guangsangon M 
guangsangon N 
guignardone N 
gummiferaoside A 
gummiferaoside B 
gummiferaoside C 
guvacine +  
guvacoline 
gypenoside LXXV 
gypenoside XVII 
gypsosaponin A 
gypsosaponin B 
gypsosaponin C 
haematoxylin +  
hamacanthin A +  
harman +   
HBOA +  
hederagenin +   
hederagenin 28-O-beta-D-glucopyranoside 
hederagenin 3-O-arabinoside 
helenalin  
helvolic acid methyl ester 
henicosan-1-ol +  
henicosane +  
heptachlor  
heptacosan-1-ol 
heptacosane +  
heptacosanoic acid +  
heptadecan-1-ol +  
heptadecanal 
heptadecane +  
heptane +   
heptanoate +  
heptanoic acid +   
herbacetin  
hermannioside A 
hermannioside B 
hernancorizin 
hesperetin +   
hex-3-en-1-ol +   
hexacosan-1-ol +   
hexacosanal 
hexacosane +   
hexadecafluorononanoic acid +   
hexadecane +   
hexadecanoic acid +   
hexahomomethionine S-oxide 
hexan-1-ol +   
hexan-3-ol 
hexanoate +   
hexanoic acid +   
hexyl octanoate 
himachalene +  
hirsutidin 
hispaglabridin A 
hispidol 
hispidulin  
hoerhammericine +  
hokbusine A 
homoeriodictyol chalcone 
homoferreirin 
homogentisate 
homogentisic acid 
homostachydrine 
hookerianamide J 
hop-17(21)-ene +  
hopan-22-ol +  
hopane-29-acetate 
HS44 
huperzine A  
hydramacrophyllol A 
hydramacrophyllol B 
hydrangeic acid 4'-O-beta-D-glucopyranoside 
hydrangenol +  
hydrangenol 4'-O-beta-D-apiofuranosyl-(1->6)-beta-D-glucopyranoside 
hydrangenol 4'-O-beta-D-glucopyranoside 
hydrangenol 8-O-beta-D-glucopyranoside 
hydroquinone O-beta-D-glucopyranoside +   
hydroxycitronellal  
hydroxymalonic acid 
hydroxymethyl group +   
hydroxysafflor yellow A  
hygrine +  
hypaconine 
hypaphorine 
hyperaspidinol A 
hyperforin  
hyperixanthone A 
hypodiol 
hypoglaunine B 
hypoglaunine C 
hypoglycin B 
hypolaetin +  
hyponine D 
hyponine E 
hyponine F 
hypothemycin 
hypothiocyanous acid 
iberin  
ibogaine +   
ibogamine +   
icajine  
icariside II  
icosane +   
icosanoic acid +  
imidazole antifungal agent +   
indole-3-acetamide 
indole-3-acetate 
indole-3-acetic acid +   
indole-3-acetonitrile +  
indole-3-butyric acid +   
indole-3-carbaldehyde 
indole-3-methanol +   
indole-5-carboxylic acid 
inuchinenolide B 
inuchinenolide C 
inunolide 
inuviscolide  
ionone +   
ipsdienone 
iridin 
irigenin +  
irisxanthone 
isatin +   
isatinone A 
isatinone B 
isavuconazonium +  
isoaigialone B 
isoalantolactone  
isoamylol +   
isoathyriol 
isobornyl formate 
isobrucine 
isobrucine N-oxide 
isobutrin 
isobutyrate +  
isobutyric acid +   
isochamaejasmenin B 
isochamaejasmin 
isoderrone 
isoetin 
isogentisin 
isogeraniol +  
isoginkgetin 
isohemiphloin 
isoliquiritin 
isomangiferin 
isoorientin 2''-O-glucoside 
isoorientin 2''-O-rhamnoside +  
isoorientin 7,3'-dimethyl ether 
isopentenyl diphosphate  
isopentenyl diphosphate(3-) 
isopentylamine 
isophorone +   
isoprene +   
isopseudostrychnine 
isorhamnetin 3-O-robinobioside 
isoscoparin 2''-O-[6-(E)-feruloylglucoside] 
isosilybin 
isosojagol 
isostrychnine 
isostrychnine N-oxide 
isotalatizidine 
isotaxiresinol 
isovalerate 
isovaleric acid +   
isowighteone 
ivain II 
ivermectin  
jacarelhyperol B 
Jacobaea metabolite +  
jasmonate(1-) +  
jasmonic acid +  
jawsamycin 
juvenile hormone I 
juvenile hormone II 
juvenile hormone III  
juvenile hormone III bisepoxide 
juvenile hormone III skipped bisepoxide 
kadsurenin C 
kadsurenin K 
kadsurenin L 
kadsurenin M 
kaempferol +   
kaempferol 3,7-di-O-alpha-L-rhamnoside 
kaempferol 3,7-di-O-beta-D-glucoside 
kaempferol 3-O-(5-O-acetyl-alpha-D-apiofuranosyl)-7-O-alpha-L-rhamnopyranoside 
kaempferol 3-O-[alpha-L-rhamnopyranosyl(1->2)-beta-D-galactopyranosyl]-7-O-alpha-L-rhamnopyranoside 
kaempferol 3-O-[alpha-L-rhamnopyranosyl(1->2)-beta-D-glucopyranosyl]-7-O-alpha-L-rhamnopyranoside 
kaempferol 3-O-alpha-L-[6'''-p-coumaroyl-beta-D-glucopyranosyl-(1->2)-rhamnopyranoside] 
kaempferol 3-O-alpha-L-arabinopyranosyl-7-O-alpha-L-rhamnopyranoside 
kaempferol 3-O-alpha-L-glucopyranoside 
kaempferol 3-O-beta-D-allopyranoside 
kaempferol 3-O-beta-D-apiofuranosyl-7-O-alpha-L-rhamnopyranoside 
kaempferol 3-O-beta-D-galactopyranosyl-7-O-alpha-L-rhamnopyranoside 
kaempferol 3-O-beta-D-galactoside  
kaempferol 3-O-beta-D-glucofuranoside 
kaempferol 3-O-beta-D-glucopyranosyl-7-O-alpha-L-rhamnopyranoside 
kaempferol 3-O-beta-D-glucoside +   
kaempferol 3-O-beta-D-glucosyl-(1->2)-beta-D-glucoside  
kaempferol 3-O-beta-D-glucosyl-(1->2)-beta-D-glucosyl-(1->2)-beta-D-glucoside 
kaempferol 3-O-beta-D-glucosylgalactoside 
kaempferol 3-O-gentiobioside-7-O-rhamnoside 
kaempferol 4'-O-beta-D-glucopyranoside 
kaempferol 5-O-beta-D-glucopyranoside 
kaempferol 7-O-beta-D-glucopyranoside 
kaempferol-3-O-beta-D-glucopyranosyl-7-O-beta-D-glucopyranoside +  
kaempferol-3-rutinoside 
kahweol  
kainic acid +   
kalopanaxsaponin A  
kalopanaxsaponin B 
kalopanaxsaponin C 
kanzonol P 
keto mycolic acid 
khekadaengoside K 
kinocoumarin 
kolaflavanone 
kuraridinol 
kurarinol  
kuwanone G  
kuwanone H  
L-2,4-diaminobutyric acid +  
L-alpha-(methylidenecyclopropyl)glycine 
L-ascorbic acid +   
L-asparagine +   
L-canaline 
L-canavanine 
L-canavanine sulfate 
L-citrulline zwitterion +  
L-Cys(IAN) 
L-djenkolic acid 
L-dopa +  
L-galactono-1,4-lactone 
L-glycero-alpha-D-manno-Hepp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->3)-L-glycero-alpha-D-manno-Hepp-(1->5)-alpha-Kdo 
L-idopyranose 6-monomycolate 
L-indospicine 
L-isoleucinate 
L-isoleucine +   
L-isoleucinium +  
L-leucinate +  
L-leucine +   
L-leucinium +  
L-lysinate 
L-lysine +   
L-lysinium(1+) +  
L-lysinium(2+) +  
L-m-tyrosine 
L-methioninate +   
L-mimosine  
L-phenylalaninate +  
L-phenylalanine +   
L-phenylalaninium +  
L-pipecolate 
L-pipecolic acid +  
L-proline betaine  
L-selenomethionine zwitterion +  
L-Thr-(N->6)-alpha-D-Galp6d3OAc-(1->3)-beta-D-GalpNAc 
L-threonic acid +  
L-threoninate 
L-threonine +   
L-threoninium +  
L-tryptophan +   
L-tryptophanate +  
L-tryptophanium +  
L-tryptophanyl radical +  
L-valinate 
L-valinium +  
lactiflorin 
lactinolide 
lactucin +  
lactucin 15-glycoside 
lactucin 15-oxalate 
lactucopicrin 
lactucopicrin 15-oxalate 
lamesticumin A 
lamesticumin B 
lamesticumin C 
lamesticumin D 
lamesticumin E 
lamesticumin F 
lancerin 
lanosta-9(11),24-dien-3-one 
lanosterol +   
Lansamide 4 
lansic acid +  
lansic acid 3-ethyl ester 
lansiolic acid +  
lansioside A 
lathyrane diterpenoid +  
lavandulol +  
lawsone  
laxiracemosin H 
leptomycin A 
leptomycin B  
leptorumol 
leptosidin 
lespeflorin G10 
lespeflorin G2 
lespeflorin G3 
lespeflorin G5 
lespeflorin G8 
leucascandrolide A congener 
levamisole +   
lichexanthone 
licoagroside B 
licoarylcoumarin 
licocoumarone  
licoricidin +   
licoricone 
licorisoflavan A 
ligstroside 
lilaline 
limonene 1,2-epoxide +  
linalool +   
linoleate +  
linoleic acid +   
liquiritigenin +   
liquiritin  
liriodenine 
lochnericine 
loganic acid 
loganin +   
lonchocarpenin 
lotisoflavan 
LSM-36666 
lubimin +  
lucidumoside C 
lumichrome 
lupeol +   
lutein +   
lutein 5,6-epoxide 
luteoliflavan 
luteolin +   
luteolin 6-C-[beta-D-glucosyl-(1->2)-alpha-L-arabinoside] 
luteolin 7-O-beta-D-glucoside +   
luteolin 7-O-beta-D-glucoside-4'-(Z-2-methyl-2-butenoate) 
luteolin-4'-O-beta-D-glucopyranoside 
luteolin-7-O-alpha-L-rhamnoside 
lyciumoside II 
lycopene +   
lycorine  
Lys-GalA 
Lys-Thr-Trp-Gly-Lys-Asn-Leu-Val-Phe 
lysikokianoside 1 
lysophosphatidylcholine (0:0/18:1) 
lysophosphatidylcholine (0:0/18:3) 
lysophosphatidylcholine (18:1/0:0) +   
lysophosphatidylcholine (18:3/0:0) +  
lysophosphatidylethanolamine (0:0/18:2) +  
lysophosphatidylethanolamine (18:2/0:0) +  
m-tolualdehyde  
maackiapterocarpan A 
macarangin 
macaranone B 
madecassic acid +   
madecassoside  
madhucoside A 
madhucoside B 
mahuannin D 
maleate(2-) +  
maleic acid +   
mallotophilippen E +  
malonylapiin 
malonyldaidzin 
malonylgenistin 
malonylglycitin 
mangiferin  
maniladiol 
mannitol +   
mannobiose +  
mannopine 
manool 
maprounic acid +  
marianoside A 
marianoside B 
marinobufagenin  
maritimetin 
marmesinin 
maslinic acid +   
matairesinoside 
matteucinol +  
maysin 
maytansine +  
mebendazole  
mediomycin A 
mediomycin B 
melibiose +   
menthofuran +   
mesaconate(2-) 
mesaconic acid +  
mesaconine 
mesembryanthemoidigenic acid 
meso-3,3'-didemethoxynectandrin B 
meso-dihydroguaiaretic acid 
mesuaxanthone A 
mesuaxanthone B 
methacholine +   
methionine +   
methoxsalen +   
methoxy group 
methoxy mycolic acid 
methoxyacrylate strobilurin antifungal agent +   
methoxycarbanilate strobilurin antifungal agent +  
methoxyiminoacetamide strobilurin antifungal agent +  
methoxyiminoacetate strobilurin antifungal agent +   
methyl (+)-pentacycloanammoxate 
methyl (5Z,7E,11Z,14Z)-9-hydroperoxy-20-hydroxyicosa-5,7,11,14-tetraenoate 
methyl (5Z,9E,11Z,14Z)-8-hydroperoxy-20-hydroxyicosa-5,9,11,14-tetraenoate 
methyl 12-hydroperoxy-20-hydroxy-(5Z,8Z,10E,14Z)-icosatetraenoate 
methyl 12-methyltetradecanoate 
methyl 2-diazo-2-acetamidohexanoate 
methyl 3,4,5-trihydroxybenzoate  
methyl 3,4-dicaffeoylquinate 
methyl 3,4-dihydroxybenzoate 
methyl 3-hydroxybut-2-enoate +   
methyl 3-hydroxypalmitate +  
methyl 4,23,29-trihydroxy-3,4-seco-olean-12-en-3-oate-28-oic acid 
methyl 4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-2-O-methyl-alpha-D-mannopyranoside 
methyl 6-(pentacyclo[6.4.0.0(2,7).0(3,6).0(9,12)]dodec-4-yl)hexanoate 
methyl 8-(tetracyclo[6.4.0.0(2,7).0(3,6)]dodec-10-yl)octanoate 
methyl 8-[2-(2-formyl-vinyl)-3-hydroxy-5-oxo-cyclopentyl]-octanoate 
methyl 8-[3,5-epidioxy-2-(3-hydroperoxy-1-pentenyl)-cyclopentyl]-octanoate 
methyl acetate 
methyl arachidate 
methyl arachidonate +  
methyl behenate 
methyl cis-10-heptadecenoate 
methyl cis-10-pentadecenoate 
methyl cis-15-tetracosenoate 
methyl dec-2-ene-4,6,8-triynoate +  
methyl decanoate 
methyl dihydrogen phosphate  
methyl erucate 
methyl ester +   
methyl farnesoate +  
methyl formate 
methyl gamma-linolenate 
methyl henicosanoate 
methyl heptadecanoate 
methyl hexanoate +  
methyl icosapentaenoate 
methyl isobutyrate 
methyl L-cysteinate +  
methyl lansiolate 
methyl laurate  
methyl linoleate +  
methyl linolelaidate 
methyl linolenate 
methyl myristoleate 
methyl N-methylanthranilate 
methyl nonadecanoate 
methyl nonanoate 
A fatty acid methyl ester obtained from the formal condensation of methanol and nonanoic acid; a colourless liquid with a fruity odour, used in perfumes and flavours, and for medical research.
methyl octanoate +  
methyl oleate  
Methyl palmitate  
methyl palmitoleate 
Methyl pentacosanoate 
methyl pentadecanoate 
methyl phosphate(2-) 
methyl propenyl ketone +  
Methyl stearate 
methyl syringate 
methyl tetracosanoate 
methyl tetradecanoate 
methyl tricosanoate 
methyl tridecanoate 
methyl tuberonate 
methyl undecanoate 
methyl undecenate 
methyl vanillate +  
methylglyoxal-lysine dimer 
methylisothiazolinone +   
methylophiopogonone A 
methylophiopogonone B 
methyloxidanyl 
methylparaben  
methylsqualene 
mevastatin +   
miconazole nitrate 
millewanin G 
miltefosine  
mirificin 
mitchellene A 
mitchellene B 
mitchellene C 
mitchellene D 
mitchellene E 
mogroside IE 
monardaein 
monensin A  
monolignol +  
monotesone A 
morphine +   
morpholine antifungal agent +   
morusin  
mucidin 
mucrolidin 
mucronulatol 
mucusisoflavone A 
mucusisoflavone B 
mucusisoflavone C 
multiflorin B 
multinoside A 
multiplolide A 
multiplolide B 
musk xylene  
myrcenol 
myrciacitrin II 
myrciacitrin V 
Myricanone 
myricetin +   
myricetin 3-O-beta-D-glucopyranoside +  
myricetin-3-O-arabinofuranoside 
myricetin-3-O-beta-D-xylopyranoside 
myricitrin +   
myriocin  
myristoleate 
myristoleic acid +  
myrtenic acid 
N(1),N(8)-bis(coumaroyl)spermidine 
N(1),N(8)-bis(coumaroyl)spermidine(1+) 
N(1),N(8)-bis(sinapoyl)-spermidine 
N(1),N(8)-bis(sinapoyl)-spermidine(1+) 
N(1),N(8)-bis-(dihydrocaffeoyl)spermidine 
N(2)-(5'-phosphopyridoxyl)-L-lysine 
N(5)-ethyl-L-glutamine 
N(5)-ethyl-L-glutamine zwitterion 
N(6)-(Delta(2)-isopentenyl)adenosine +  
N(6)-acetyl-N(2)-(5'-phosphonatopyridoxyl)-L-lysinate(2-) 
N(6)-acetyl-N(2)-(5'-phosphopyridoxyl)-L-lysine 
N(6)-dansyl-L-lysine 
N(6)-Dnp-Lys-NH2 
N,N-dimethyltetradecanamide 
N,O-(Dnp)2-Tyr-Gln 
N-(5'-phosphonatopyridoxyl)-D-alaninate(2-) 
N-(5'-phosphonatopyridoxyl)-L-alaninate(2-) 
N-(5'-phosphopyridoxyl)-D-alanine 
N-(5'-phosphopyridoxyl)-L-alanine 
N-(indole-3-acetyl)-L-aspartate(2-) 
N-(indole-3-acetyl)-L-aspartic acid 
N-(indole-3-acetyl)glutamate(2-) 
N-(indole-3-acetyl)leucine +  
N-(indole-3-acetyl)phenylalanine 
N-(indole-3-acetyl)valine 
N-(p-nitrophenylphosphobutanoyl)glycine 
N-(trans-4'-nitro-4-stilbenyl)-N-methyl-5-aminopentanoic acid 
N-[(+)-7-isojasmonyl]-L-isoleucine 
N-[4-(4-nitrophenylphospho)butanoyl]-D-alanine 
N-[4-(4-nitrophenylphospho)butanoyl]-L-alanine 
N-[5-(1-naphthylmethyl)-1,3-thiazol-2-yl]cyclohexanecarboxamide 
N-\{beta-D-Man-(1->2)-beta-D-Man-(1->2)-beta-D-ManO[CH2]3S[CH2]2NHC(O)[CH2O]4C(O)[CH2]2S[CH2]2C(O)\}-YGKDVKDLFDYAQE-NH-[CH2O]3[CH2]2C(O)NHC(CO2H)[CH2]4N3 +  
N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 
N-acetyl-alpha-D-galactosamine +  
N-acetyl-alpha-D-galactosaminyl group +  
N-acetyl-alpha-D-galactosaminyl-(1->3)-[alpha-L-fucosyl-(1->2)]-beta-D-galactose derivative 
N-acetyl-alpha-D-galactosaminyl-L-serine residue 
N-acetyl-alpha-neuraminic acid +  
N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucose +  
N-acetyl-alpha-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosamine 
N-acetyl-beta-D-galactosamine +  
N-acetyl-beta-D-galactosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl group 
N-acetyl-beta-D-glucosamine +   
N-acetyl-beta-D-glucosaminyl-(1->4)-N-acetyl-beta-D-glucosamine +  
N-acetyl-beta-neuraminic acid +   
N-acetyl-beta-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosamine 
N-acetylneuraminyl group 
N-benzoyl-L-phenylalaninol +   
N-benzyl-N-methyl-2-(3-oxo-1,2-benzothiazol-2-yl)acetamide 
N-benzyladenine 
N-benzylhexadecanamide 
N-butylbenzenesulfonamide  
N-carbamoyl-L-cysteine 
N-deethylaconine 
N-feruloylserotonin 
N-glycoloyl-beta-D-glucosamine 
N-methylanthranilic acid +  
N-methylmesoporphyrin 
N-methylnicotinate  
N-methylnicotinic acid 
N-methylphenylethanolamine 
N-methylphenylethanolaminium 
N-methylproline 
N-methylproline zwitterion 
N-methylserotonin 
N-nonanoylglycine 
N-octanoylisoglobotriaosyl ceramide 
N-trans-feruloyl-4'-O-methyldopamine 
naled  
naphthalene +   
naphthazarin  
nataloe-emodin +  
negundin B 
neobavaisoflavone +   
neocarlinoside 
neocarthamin 
neoeriocitrin  
neoeuonymine 
neohesperidin 
neohesperidin dihydrochalcone  
neojiangyouaconitine 
neoline 
neophytadiene 
neoschaftoside 
neothyonidioside 
neotriptophenolide 
nepetaside 
neral +   
nerol +  
nerol oxide 
neryl acetate 
nevadensin  
nezukol 
nickel atom +   
nigerone 
nigrasin A 
nigrasin B 
nigrasin C 
nigrasin D 
nigrasin E 
nigrasin F 
nigrasin G 
nigrasin H 
nigrasin I 
nigrasin j 
nikkomycin Z 
nimbin +  
nimbocinol +  
nimolicinol 
nipponogenin E 
nitroxoline  
NK154183A 
NK154183B 
NK372135A 
NK372135B 
NK372135C 
nobiletin  
nocardione A 
nodakenetin +  
nolinospiroside F 
nonacosan-10-ol +  
nonacosan-10-one 
nonacosane +  
nonacosanoic acid +  
nonadec-1-ene 
nonadecane +  
nonan-1-ol +   
nonan-2-one 
nonanal +   
nonane +   
nonanedioic acid +   
nonanedioic acid monoglycoside 
nonanoate +  
nonanoic acid +   
nonanoyl group 
nonanoyl-CoA 
norathyriol +   
norbelladine +  
nordihydroguaiaretic acid +   
noreugenin 
noreugenin(1-) 
norlignan +   
norrubrofusarin 
norswertianin 
notoginsenoside R1  
novacine 
NP-101A 
O-(2-aminopropyl)-O'-(2-methyoxyethyl)octa(propylene glycol) 
O-[N-acetyl-alpha-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosaminyl]-L-serine residue 
O-beta-D-glucosyl-trans-zeatin 
O-hydroxy(phenyl)phosphinoyl ecgonine methyl ester 
o-tolualdehyde 
oblonganoside A 
obolactone 
oceanalin A 
ocimene +  
ocotillone 
octacosan-1-ol +  
octacosanal 
octacosane +  
octacosanoic acid +  
octadec-9-enoic acid +   
octadecan-1-ol +   
octadecane +   
octadecanoate +  
octadecanoic acid +   
octan-1-ol +   
octan-2-ol +   
octanal  
octyl acetate 
octyl benzoate 
octyl beta-D-glucopyranoside 
octyl gallate  
odoratol +  
ohchinin acetate 
okanin  
oleamide  
oleanolate 
oleanolic acid +   
oleanolic acid 3-O-[O-beta-D-glucopyranosyl-(1->4)-O-beta-D-glucopyranosyl-(1->3)-O-alpha-L-rhamnopyranosyl-(1->2)-alpha-L-arabinopyranoside] 
oleanolic aldehyde 
oleate +  
oleic acid +   
oleocanthal 
oleonitrile 
oleuropein +   
oleuropein (dialdehyde form) 
oleuropein aglycone 
ombuin 
omega-3 fatty acid +   
ononin 
onosmin A +  
ophioglonin +  
ophioglonin 7-O-beta-D-glucopyranoside 
ophioglonol +  
ophioglonol 4'-O-beta-D-glucopyranoside 
oplodiol 
orbiculin G +  
orcein 
oregon green 488 
oridonin  
ornaline 
ornidazole  
orobol +  
orotidine 
oroxylin A 7-O-beta-D-glucuronide 
ortho-vanillin  
oryzalexin A 
oryzalexin D 
oryzalexin E 
osthenol 
otophylloside B 
ouabain  
oxalate(1-) +  
oxalate(2-) +   
oxalic acid +   
oxamyl  
oxfendazole  
oxofangchirine 
oxolinic acid 
oxonantenine 
oxonitine 
oxyayanin A 
oxyayanin B 
oxypaeoniflorin 
oxypeucedanin 
p-cumate +  
p-cumic acid +  
p-cymene +   
p-hydroxybenzyl alcohol  
p-menth-4(8)-en-3-one +   
p-mentha-1,3,8-triene 
p-menthan-3-one +   
p-methoxybenzaldehyde  
p-nitrobenzyl glutaryl glycinic acid 
p-nitrophenylphosphocholine 
p-tolualdehyde  
P. aeruginosa serotype O11 O-specific polysaccharide 
pachypodol 
paclobutrazol  
paeoniflorigenone 
paeoniflorin sulfonate 
paeonilactinone 
paeonoside decaacetate 
pallidol  
palmariol B 
palmarumycin C8 
palmatine +   
palmitoleyl alcohol +  
palmityl acetate 
pancixanthone B 
paniculatin 
panose 
pantothenic acid +   
papulacandin A 
papulacandin B 
papulacandin C 
papulacandin D 
parameritannin A-1 
parathion-methyl  
parfumine 
pavine 
paxanthonin +  
pectate 
pectin +  
pectolinarigenin +  
pectolinarin 
pedilstatin 
pedunculosumoside A 
pedunculosumoside B 
pedunculosumoside C 
pedunculosumoside D 
pedunculosumoside E 
pedunculosumoside F 
pedunculosumoside G 
pelargonidin +   
pelargonidin 3-(6-p-coumaroyl)glucoside 
pelargonidin 3-O-beta-D-glucoside +   
pelargonidin 3-O-sophoroside 
pelargonidin chloride 
pelargonin 
pentacosan-1-ol +  
pentacosane +  
pentadecanal +  
pentadecane +  
pentadecanoate 
pentadecanoic acid +  
pentahomomethionine S-oxide 
pentamidine  
pentan-1-ol +   
pentan-2-one 
pentanal +   
peonidin 3-O-beta-D-glucoside 
peregrinol +  
perfluorononanoic acid  
perillene 
perillyl alcohol +   
petasin 
petiolaroside +  
petiolaroside decaacetate 
petroselinic acid +  
petunidin +  
peucedanin 
PF 1163A 
PF 1163B 
Phe(4-NO2)-Gln 
Phe-Leu 
phenazine-1-carboxylic acid  
phenethyl benzoate 
phenolic phthiocerol +  
phenylacetate +  
phenylacetic acid +   
phleomycin D1 +  
phloretic acid  
phloretin +   
phlorizin  
phlorizin chalcone  
phomalevone B 
phosphatidylethanolamine 36:3 +  
phosphatidylserine 40:0 
phosphatidylserine 40:1 
phosphatidylserine 40:2 
phosphatidylserine 40:3 
phosphocholine +   
phthalaldehyde  
phthiocerol A +  
phylloquinone +   
phyllospadine 
physalin +  
physcion +   
phytocassane +  
phytol +   
phytotoxin +   
phytuberin 
piceatannol +  
picropodophyllotoxin  
picrotin +   
picrotoxin  
picrotoxinin +   
pierreione A 
pierreione B 
pierreione C 
pierreione D 
pinane +   
pinen-10-yl vicianoside 
pinitol +   
pinocarveol +  
pinocembrin 7-rhamnosylglucoside 
pinocembrin chalcone 
pinoquercetin 
pinostrobin 
pipataline 
piperazine adipate 
pipercallosidine 
pipercallosine 
piperidine +   
piperine  
piperitone +  
piperlactam S 
piperonal 
piscerythramine 
pisoniamide 
pisonianone 
pisonin A 
pisonin B 
pisonin C 
pisonin D 
pisonin E 
pisonin F 
pisonivanol 
pisonivanone 
pisonolic acid 
plakortide F free acid 
plantaginin 
plantagoside 
plaunotol  
pneumocandin B0 +   
podophyllotoxin +   
polygonimitin B 
polyhexamethylene biguanide 
polyhexamethylene biguanide hydrochloride 
polysulfur  
pomecin A 
pradimicin +  
precocene I 
premnaspirodiene 
prenyl diphosphate  
prenyl diphosphate(3-) 
prephenate(2-) +  
prephenic acid +  
primetin 
progoitrin 
prop-2-yn-1-ol +   
propane-1-thiol  
propanesulfenic acid 
propiophenone +   
propyl acetate 
propyl benzoate 
propyl butyrate 
propylparaben  
protobassic acid +  
protopine +   
protostrychnine 
pseudobaptigenin +  
pseudobaptigenin(1-) 
pseudobrucine 
pseudoephedrine 
pseudoephedrine hydrochloride 
pseudoionone 
pseudolaratriene 
pseudopelletierine 
pseudostrychnine 
psoralen +   
psoralidin  
psorospermin  
pterolinus A 
pterolinus B 
pterolinus C 
pterolinus D 
pterolinus E 
pterolinus F 
pterolinus G 
pterolinus H 
pterolinus I 
puerarin +   
purpurin  
pyrantel  
pyridin-2-ol  
pyridoxamine +   
pyridoxamine dihydrochloride 
pyridoxamine hydrochloride 
pyridoxaminium(1+) +  
pyrimidine antifungal agent +   
pyrogallol +   
pyrrole-2-carboxylic acid 
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 
quadrangularin A 
quercetagetin +   
quercetin +   
quercetin 3,4'-di-O-beta-D-glucoside 
quercetin 3,7-di-O-beta-D-glucoside 
quercetin 3-(6''-p-hydroxybenzoylgalactoside) 
quercetin 3-O-(2'',3''-digalloyl)-beta-D-galactopyranoside 
quercetin 3-O-(6-O-malonyl-beta-D-glucoside) 
quercetin 3-O-[alpha-L-rhamnopyranosyl(1->2)-beta-D-galactopyranosyl]-7-O-alpha-L-rhamnopyranoside 
quercetin 3-O-[beta-D-xylosyl-(1->2)-beta-D-glucoside] 
quercetin 3-O-alpha-L-rhamnopyranosyl-(1->2)-alpha-L-arabinopyranoside 
quercetin 3-O-beta-D-galactopyranoside +   
quercetin 3-O-beta-D-glucopyranoside  
quercetin 3-O-beta-D-glucosyl-(1->2)-beta-D-glucoside +  
quercetin 3-O-beta-D-glucosyl-(1->2)-beta-D-glucosyl-(1->2)-beta-D-glucoside 
quercetin 3-O-gentiotetroside 
quercetin 3-O-rhamnoside-7-O-glucoside 
quercetin 4'-O-beta-D-glucopyranoside  
quercetin 5,7,3',4'-tetramethyl ether 
quercetin 7,3',4'-trimethyl ether 
quercetin 7,4'-di-O-beta-D-glucoside 
quercetin-3-O-alpha-D-arabinofuranoside 
quercetin-3-O-beta-D-xylopyranoside 
quercitrin  
quillaic acid alpha-L-Arap-(1->4)-alpha-L-Arap-(1->3)-beta-D-Xylp-(1->4)-alpha-L-Rhap-(1->2)-beta-D-fucopyranosyl ester 
quinic acid +   
quinovose +  
radicicol  
raffinose +   
raspberry ketone  
rataniaphenol I 
rataniaphenol II 
rataniaphenol III 
rauvomitine 
Reactive Red 6 hapten copper complex 
rebaudioside +   
regelidine 
regelin 
rel-(+)-(7'S,8S,8'S)-4,4'-dihydroxy-3',5,5'-trimethoxy-2,7'-cyclolignan 
rel-(-)-(7S,7'R,8S,8'R)-4,4'-dihydroxy-3,3',5'-trimethoxy-7,7'-epoxylignan 
rel-2alpha,3alpha,19alpha,23-tetrahydroxyolean-12-en-28-oic acid 
rel-2alpha,3alpha,23-trihydroxy-19-oxo-18,19-seco-urs-11,13(18)-dien-28-oic acid 
rel-2alpha,3beta,23-trihydroxy-12,17-dien-28-norursane 
rel-2alpha,3beta,23-trihydroxy-19-oxo-18,19-seco-12,17-dien-28-norursane 
reserpine  
resiniferatoxin  
reticuline +  
retuline 
Reynoutria sachalinensis extract 
rhamnacene +  
rhamnocitrin 
rhamnose +   
rhizopycnolide A 
ribitol +   
robinetin  
robinetinidol +  
robinin  
roburic acid 
rose oxide +  
rosinidin 
rosmarinic acid +   
rotiorinol A 
rotiorinol C 
rotundifolioside A 
rotundifolioside H 
rotundifolioside I 
rotundifolioside J 
rotundifuran 
rubesanolide D 
rubiadin  
rubianol-e 3-O-(6'-O-acetyl)-beta-D-glucopyranoside 
rubianthraquinone 
rubiarbonol A +  
rubiarbonol A 3-O-beta-D-glucopyranosyl-(1->2)-beta-D-glucopyranoside 
rubiarbonol A 7-acetate 
rubiarbonol F 
rubiarbonol G 
rubiarbonol K 
rubiarbonol L 
rubiarbonone A 
rubiarbonone B 
rubiarbonone C  
rubiarbonone E 19-acetate 
rubiarboside G 28-acetate 
rubiarboside G 28-al 
rubimaillin  
rubinaphthin A methyl ester 
rubixanthin 
rubiyunnanol A 
rubiyunnanol B 
rubiyunnanol C 
rubrorotiorin 
rubusoside +   
rutarin 
S-adenosyl-L-homocysteine  
S-allylsulfenic acid 
S-methylcysteine  
S-propyl propanethiosulfinate 
S-sulfo-L-cysteine 
sabinene +  
safrole  
sakuranetin +  
sakuranin 
salannin +  
salicifoliol 
salicylaldehyde +   
salicylate +   
salicylic acid +   
salvianolic acid B  
salviol 
salzmannianoside A 
salzmannianoside B 
sandaracopimaric acid 
sanggenol H 
santin 
sapinmusaponin Q 
sapinmusaponin R 
saponaceol A 
sarmentogenin +  
scalusamide A 
sch 54445 
sch 725432 
schaftoside 
sciscllascilloside E-1 
sclareol 
sclerodol B 
scopoletin +   
scopolin 
scullcapflavone II 
scutebarbatine C 
scutebarbatine E 
scutebarbatine F 
scutebarbatine G 
Se-methylselenomethionine +  
sebacate(2-) 
sebacic acid +   
secnidazole 
secoxyloganin 
selenomethionine +   
selina-4(15),7(11)-diene 
selinene +  
selinone 
semi-beta-carotenone 
semilicoisoflavone B 
senbusine A 
senecionine +   
senegasaponin a +  
senegasaponin b +  
senegin II 
senegin III 
sennosides +  
serratol 
sesaminol +  
sesaminol 2-O-beta-D-gentiobioside 
sesaminol 2-O-beta-D-glucoside 
sesquisabinene A 
sesquisabinene B 
sexangularetin 
shikimate +  
shikimic acid +   
sideroxylin +  
sieboldianoside A 
sigmoidin G 
silibinin  
simulanol 
sinapine 
sinapyl alcohol +  
sinefungin  
sinensetin  
sinomendine 
sitoindoside I 
sitoindoside IX 
sitosterol +  
smaditerpenic acid C 
sn-glycerol 3-phosphate 
sodium 4-hydroxybenzoate 
sodium amoxicilloyl group 
sodium arsenite  
sodium ascorbate 
sodium benzoate +   
sodium ferulate 
sojagol 
solanesol  
solanidine +   
solanine 
solasodine  
solasodine(1+) +  
solavetivone +  
sophoraflavanone B  
sophoraflavanone G 
sophoranone  
sophorose +   
sorbose +   
sordaricin 
sordarin +  
sorocenol H 
spathodic acid 
spathulenol  
spinosin 
sporothriolide 
squalene +   
stachyose +  
stearonitrile 
stemphyperylenol 
stepharanine 
stepharine 
sterebin L 
sterol demethylation inhibitor +   
steviolbioside 
stevioside +   
stichloroside C1 
stigmast-5-ene-3beta,7alpha-diol 
stigmastane-3beta,5alpha,6beta-triol 
stigmastanol 
stigmasterol +   
stigmasterol 3-O-acetate 
streptoverticillin 
strobilurin antifungal agent +   
strobilurin B 
strobopinin 
strychnine N-oxide 
stryvomitine 
styrene +   
suberosin 
sugiol +  
sulcatone 
sulcofuron 
sulcofuron-sodium 
sulfamethoxazole +   
sulforaphane +   
suramin  
surfactin  
surfactin A +   
surfactin B +   
surfactin C +   
surfactin D +   
swainsonine 
swertianin +  
swertianolin +  
swertisin 
synephrine +   
syringaldehyde +  
syringaresinol +   
syringic acid +   
syringin 
syringomycin E 
tabernaemontanine 
taiwankadsurin B 
taiwanschirin D 
talosin A 
talosin B 
tambulin 
tanariflavanone A 
tanariflavanone B 
tanegool 
tangeretin +   
tau-cadinol 
tavaborole 
taxiresinol 
tea tree oil  
tectochrysin  
tectoridin  
tectorigenin +   
tephrocandidin A 
tephrocandidin B 
tephrowatsin A 
termilignan B 
terpinolene +   
tetracosan-1-ol +  
tetracosane +  
tetracosanoic acid +   
tetradecaethylene glycol 
tetradecanal 
tetradecane +   
tetrahydroalstonine 
tetrahydroswertianolin 
tetramisole 
tetratriacontan-1-ol +  
tetratriacontane 
thalicpureine 
theaflavin  
theobromine  
theograndin II 
theopalauamide 
thiabendazole  
thiadiazole antifungal agent +  
thiamine(1+) monophosphate +  
thujone +   
thunberginol F +  
thunberginol F 7-O-beta-D-glucopyranoside 
thymonin 
tianshic acid 
tianshic acid methyl ester 
tiglic acid +  
tinyatoxin 
tirucalla-7,24-dien-3beta-ol 
Tnp-Gln 
tolfenpyrad 
tolybyssidin A 
tolybyssidin B 
tomatine +  
toralactone 
torvanol A 
trachelosperogenin B 
trans-13-docosenamide 
trans-2,3-epoxydeca-4,6,8-triyn-1-ol 
trans-3-coumarate 
trans-4-(dimethylphenylsilyl)-N-methylpiperidine N-oxide 
trans-4-coumarate 
trans-4-coumaric acid +  
trans-4-hydroxy-L-proline +  
trans-4-hydroxy-L-proline betaine 
trans-5-O-caffeoyl-D-quinate 
trans-5-O-caffeoyl-D-quinic acid 
trans-benzylideneacetone 
trans-cinnamic acid +   
trans-cinnamyl acetate 
trans-cis-nepetalactone 
trans-diptoindonesin B 
trans-isoeugenol +   
trans-isogeraniol 
trans-methylferulate 
trans-resveratrol +   
trans-sinapate 
trans-sinapic acid +  
trans-zeatin 
traseolide +  
tremuloidin 
triacetin  
triacontanal 
Triacontanoic acid methyl ester 
triazole antifungal agent +   
tribuloside 
trichagmalin A 
trichagmalin B 
trichagmalin C +  
trichagmalin D 
trichagmalin E +  
trichagmalin F +  
trichanolide