Submit Data |  Help |  Video Tutorials |  News |  Publications |  FTP Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
Parent Terms Term With Siblings Child Terms
(+)-alpha-tocopherol +   
(12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 
(3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 
(4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 
2,2'-dithiobis\ 
2,2'-dithiobis\ 
2,2'-dithiodiethanol  
2-(methyldithio)pyridine-N-oxide 
3,4-dimethylindolyl precursor of nosiheptide 
3-(\{cis-4-[(2-\{[2-(acetylamino)ethyl]disulfanyl\}ethyl)carbamoyl]cyclohexyl\}carbamoyl)pyrazine-2-carboxylic acid 
3-methylindolyl precursor of nosiheptide 
4,4'-dipyridyl disulfide  
4,4'-disulfanyldibutanoic acid 
6,6'-dithiobis\ 
6,6'-dithiodi[1-(2-acetamido-4-amino-2,4-dideoxy-alpha-D-fucosyloxy)hexane] 
6,6'-dithiodi[1-(alpha-D-galacturonosyloxy)hexane] 
6,6'-dithiodi\ 
A41030A 
A47934 
abarelix 
Ac-(D)Phe-Pro-boroArg-OH 
Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 
Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 
acenocoumarol +   
acetylsalicylic acid +   
aculeacin A 
afamelanotide  
albiglutide 
aldrithiol  
allyl methyl disulfide  
alpha-amanitin  
amoxicilloyl polylysine 
amyloid-beta +  
anagrelide +   
anidulafungin 
anisindione 
AP4 hapten 
apixaban 
aranotin 
Arthrofactin 
astaxanthin  
astressin  
astressin 2B  
atromentin 
bacitracin A +   
benzylpenicilloyl polylysine 
beta-endorphin  
betrixaban 
bis(2-methylundecan-2-yl) disulfide 
bivalirudin  
calcitonin  
calcitonin (human synthetic) 
calcitonin (pork natural) 
calpastatin peptide Ac 184-210 
captopril disulfide 
carbetocin 
carperitide 
chetomin  
chloroorienticin B 
chloropeptin I 
chloropeptin II 
cholesteryl 6-O-[15-(ethyldisulfanyl)pentadecanoyl]-beta-D-galactoside 
CIGB-300 
cilostazol  
cinnamycin 
cis-1,2-dithiane-4,5-diol 
cis-4,5-bis(trimethylsiloxy)-1,2-dithiane 
clopidogrel +   
clopidogrel sulfate 
CoA-disulfide 
CoA-glutathione 
CoA-glutathione(5-) 
CoM-S-S-CoB 
complestatin A 
complestatin B 
CORM 3 
corticorelin 
corticotropin  
corticotropin-releasing hormone +   
cosyntropin  
curacozole 
cyanophycin macromolecule +  
Cys-Gly disulfide 
cystamine  
cystine +   
D-penicillamine disulfide 
dabigatran +   
dabigatran etexilate 
dabigatran etexilate methanesulfonate 
daptomycin 
DASKALRSSGMP 
defensin +  
degarelix 
dermaseptin s3(1-16)-NH2 
dermatan sulfate  
desirudin 
desmopressin +   
devancoaminyl vancomycin 
dextran  
dextran sulfate  
diallyl disulfide  
dibenzothiazol-2-yl disulfide  
dibenzyl disulfide 
dicoumarol  
dieckol  
dimethyl disulfide 
dipropyl disulfide  
disulfiram  
dithionitrobenzoic acid  
DKATIGFEVQEE 
DPDPE  
DSGEGDFLAEGGGVR 
DuP-714 
edoxaban 
edoxaban tosylate +  
edoxaban tosylate hydrate 
EDTA disodium salt dihydrate 
elcatonin 
elf18 
enfuvirtide  
ENPAVHFFKNIVTPRTP 
ENPVVAFFKNIVTPRTP 
ENPVVHFFFNIVTPRTP 
ENPVVHFFKNIVTPRTP 
ENPVVHFFYNIVTPRTP 
eptifibatide  
eribaxaban 
ethylenediaminetetraacetic acid  
exendin-3 
exendin-4 
felypressin 
fondaparinux  
FPAWFTKLYPRT 
fusaripeptide A 
ganirelix  
gastrin +   
GCB 
ghrelin  
ginsenoside Rg2  
glionitrin A 
gliotoxin  
glutathione amide disulfide 
glutathione amide disulfide dizwitterion 
glutathione disulfide  
glycyrrhizinic acid  
Gonadorelin hydrochloride 
heparin  
homocystines +  
insulin +   
IPA-3 
IPQVWRDWFKLP 
isocomplestatin 
isorhamnetin +   
JNK inhibitor I 
KGKGKGKGKGENPAVHFFKNIVTPRTP 
KGKGKGKGKGENPVVAFFKNIVTPRTP 
KGKGKGKGKGENPVVHFFFNIVTPRTP 
KGKGKGKGKGENPVVHFFKNIVTPRTP 
KGKGKGKGKGENPVVHFFYNIVTPRTP 
kisspeptin-54 
koshikamide A2 
L-cysteine glutathione disulfide 
L-cystine di-2-naphthylamide 
L-cystine mono-2-naphthylamide 
lancovutide 
lantibiotic +  
lehualide K 
lepirudin  
A heterodetic cyclic peptide composed of 65 amino acids joined in sequence and cyclised by three disulfide bridges between cysteine residues 6-14, 16-28 and 22-39. It is a highly specific inhibitor of thrombin and used as an anticoagulant in patients with heparin-induced thrombocytopenia.
linaclotide 
liraglutide  
lixisenatide 
LSM-37009 
LSM-37015 
LSM-37045 
LSM-37094 
LSM-37129 
LSM-37138 
LSM-37175 
LSM-37192 
LSM-37213 
mastoparans +   
melagatran +   
melittin  
Methyl (methylthio)methyl disulfide 
methyl 6-O-[15-(ethyldisulfanyl)pentadecanoyl]-beta-D-galactoside 
Methyl propyl disulfide 
microcystin +   
Mirabamide C 
Mirabamide G 
Mirabamide H 
motixafortide 
mycothione 
N,N'-[disulfanediyldi(ethane-2,1-diyl)]bis[2-(1H-indol-3-yl)ethan-1-amine] 
N-[(4-amino-2-methyl-5-pyrimidinyl)methyl]-N-[5-hydroxy-3-(2-oxolanylmethyldisulfanyl)pent-2-en-2-yl]formamide 
N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 
N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 
Nafarelin 
Nafarelin acetate hydrate 
nesiritide 
Neurokinin A  
Neurokinin B 
nociceptin  
normethylfondaparinux +   
omega-conotoxin GVIA  
omega-conotoxin MVIIA 
ovothiol A disulfide 
oxytocin  
P-factor 
p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 
pantethine 
peginesatide 
penicilloyl polylysine 
peptide YY 
phenindione  
phenprocoumon  
phenyl 6-O-[15-(ethyldisulfanyl)pentadecanoyl]-beta-D-galactoside 
plumbagin  
poly(glycyl-L-arginine) 
polyanethol sulfonic acid macromolecule +  
polyanethol sulfonic acid polymer 
polymyxin +   
PR-39  
pramlintide 
procyanidin B1 +  
prostaglandin E1 +   
protein polypeptide chain +   
QINTAKWWKTHF 
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 
ristocetin 
rivaroxaban  
romidepsin  
rostratin A 
rostratin B 
rostratin C 
rostratin D 
secretin human 
Sermorelin 
sodium citrate +   
sodium citrate dihydrate 
sodium polyanethol sulfonate macromolecule +  
sodium polyanethol sulfonate polymer 
somatostatin +   
somatostatin-28 
somocystinamide A 
spiruchostatin B  
STAT3 inhibitor peptide 
Streptomyces coelicolor calcium-dependent antibiotic CDA4b 
suberosin 
SW-163E 
syringomycin +  
teduglutide 
teriparatide 
terlipressin 
tesamorelin 
Thiamine disulfide 
thiazomycin 
thiocyanogen 
thiostrepton  
thiram  
thymalfasin 
ticlopidine +   
tirofiban +  
trans-1,2-dithiane-4,5-diol +  
troglitazone  
tropodithietic acid 
trypanothione disulfide  
UK 63052 
UK 63598 
UK 65662 
Vaby A 
Vaby B 
Vaby C 
Vaby D 
Vaby E 
vancomycin aglycone +   
Varv E 
vasopressin +   
vasotocin  
victorin C 
viomycin +  
VSWKTWFPNLAV 
warfarin  
warfarin potassium 
warfarin sodium 
WHWLQLKPGQPMY 
ximelagatran  
YIIKGLFWDPAC +  
YIIKGVFWDPAC +  
YSPFHKWFPSMH 

Synonyms
Exact Synonyms: L-leucyl-L-threonyl-L-tyrosyl-L-threonyl-L-alpha-aspartyl-L-cysteinyl-L-threonyl-L-alpha-glutamyl-L-seryl-glycyl-L-glutaminyl-L-asparagyl-L-leucyl-L-cysteinyl-L-leucyl-L-cysteinyl-L-alpha-glutamyl-glycyl-L-seryl-L-asparagyl-L-valyl-L-cysteinyl-glycyl-L-glutaminyl-glycyl-L-asparagyl-L-lysyl-L-cysteinyl-L-isoleucyl-L-leucyl-glycyl-L-seryl-L-alpha-aspartyl-glycyl-L-alpha-glutamyl-L-lysyl-L-asparagyl-L-glutaminyl-L-cysteinyl-L-valyl-L-threonyl-glycyl-L-alpha-glutamyl-glycyl-L-threonyl-L-prolyl-L-lysyl-L-prolyl-L-glutaminyl-L-seryl-L-histidyl-L-asparagyl-L-alpha-aspartyl-glycyl-L-alpha-aspartyl-L-phenylalanyl-L-alpha-glutamyl-L-alpha-glutamyl-L-isoleucyl-L-prolyl-L-alpha-glutamyl-L-alpha-glutamyl-L-tyrosyl-L-leucyl-L-glutamine (6->14),(16->28),(22->39)-tris(disulfide)
Related Synonyms: 1-Leu-2-Thr-63-desulfohirudin ;   Formula=C287H440N80O111S6 ;   H-Leu-Thr-Tyr-Thr-Asp-Cys(1)-Thr-Glu-Ser-Gly-Gln-Asn-Leu-Cys(1)-Leu-Cys(2)-Glu-Gly-Ser-Asn-Val-Cys(3)-Gly-Gln-Gly-Asn-Lys-Cys(2)-Ile-Leu-Gly-Ser-Asp-Gly-Glu-Lys-Asn-Gln-Cys(3)-Val-Thr-Gly-Glu-Gly-Thr-Pro-Lys-Pro-Gln-Ser-His-Asn-Asp-Gly-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-Gln-OH ;   Hbw-023 ;   InChI=1S/C287H440N80O111S6/c1-24-132(17)225-280(470)345-162(87-126(5)6)236(426)306-111-209(396)320-181(116-370)267(457)344-176(101-220(416)417)238(428)307-105-203(390)316-152(61-74-213(402)403)243(433)321-146(40-29-32-80-288)241(431)339-171(96-198(298)385)259(449)326-153(56-69-194(294)381)250(440)351-186(121-482-479-118-183-240(430)310-107-202(389)313-148(54-67-192(292)379)233(423)303-108-206(393)317-170(95-197(297)384)258(448)322-147(41-30-33-81-289)242(432)350-187(272(462)359-225)122-483-480-119-184(269(459)323-150(60-73-212(400)401)235(425)304-110-208(395)319-180(115-369)266(456)342-174(99-201(301)388)265(455)357-223(130(13)14)278(468)355-183)352-254(444)165(90-129(11)12)335-270(460)185-120-481-484-123-188(354-263(453)178(103-222(420)421)347-283(473)230(137(22)375)362-264(454)168(93-141-48-52-144(378)53-49-141)346-282(472)228(135(20)373)361-232(422)145(291)86-125(3)4)273(463)363-229(136(21)374)281(471)330-158(65-78-217(410)411)249(439)348-179(114-368)239(429)309-106-204(391)315-151(55-68-193(293)380)244(434)340-172(97-199(299)386)260(450)334-164(89-128(9)10)253(443)353-185)271(461)358-224(131(15)16)279(469)364-227(134(19)372)277(467)311-112-205(392)314-149(59-72-211(398)399)234(424)305-113-210(397)356-231(138(23)376)286(476)367-85-37-45-191(367)276(466)331-160(42-31-34-82-290)284(474)365-83-35-43-189(365)274(464)328-154(57-70-195(295)382)248(438)349-182(117-371)268(458)338-169(94-142-104-302-124-312-142)257(447)341-173(98-200(300)387)261(451)343-175(100-219(414)415)237(427)308-109-207(394)318-177(102-221(418)419)262(452)337-166(91-139-38-27-26-28-39-139)255(445)327-155(62-75-214(404)405)245(435)325-159(66-79-218(412)413)251(441)360-226(133(18)25-2)285(475)366-84-36-44-190(366)275(465)329-157(64-77-216(408)409)246(436)324-156(63-76-215(406)407)247(437)336-167(92-140-46-50-143(377)51-47-140)256(446)333-163(88-127(7)8)252(442)332-161(287(477)478)58-71-196(296)383/h26-28,38-39,46-53,104,124-138,145-191,223-231,368-378H,24-25,29-37,40-45,54-103,105-123,288-291H2,1-23H3,(H2,292,379)(H2,293,380)(H2,294,381)(H2,295,382)(H2,296,383)(H2,297,384)(H2,298,385)(H2,299,386)(H2,300,387)(H2,301,388)(H,302,312)(H,303,423)(H,304,425)(H,305,424)(H,306,426)(H,307,428)(H,308,427)(H,309,429)(H,310,430)(H,311,467)(H,313,389)(H,314,392)(H,315,391)(H,316,390)(H,317,393)(H,318,394)(H,319,395)(H,320,396)(H,321,433)(H,322,448)(H,323,459)(H,324,436)(H,325,435)(H,326,449)(H,327,445)(H,328,464)(H,329,465)(H,330,471)(H,331,466)(H,332,442)(H,333,446)(H,334,450)(H,335,460)(H,336,437)(H,337,452)(H,338,458)(H,339,431)(H,340,434)(H,341,447)(H,342,456)(H,343,451)(H,344,457)(H,345,470)(H,346,472)(H,347,473)(H,348,439)(H,349,438)(H,350,432)(H,351,440)(H,352,444)(H,353,443)(H,354,453)(H,355,468)(H,356,397)(H,357,455)(H,358,461)(H,359,462)(H,360,441)(H,361,422)(H,362,454)(H,363,463)(H,364,469)(H,398,399)(H,400,401)(H,402,403)(H,404,405)(H,406,407)(H,408,409)(H,410,411)(H,412,413)(H,414,415)(H,416,417)(H,418,419)(H,420,421)(H,477,478)/t132-,133-,134+,135+,136+,137+,138+,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,159-,160-,161-,162-,163-,164-,165-,166-,167-,168-,169-,170-,171-,172-,173-,174-,175-,176-,177-,178-,179-,180-,181-,182-,183-,184-,185-,186-,187-,188-,189-,190-,191-,223-,224-,225-,226-,227-,228-,229-,230-,231-/m0/s1 ;   InChIKey=FIBJDTSHOUXTKV-BRHMIFOHSA-N ;   LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ ;   LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ (disulfide bridge: 6->14; 16->28; 22->39) ;   NH2-LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ-OH ;   Refludan ;   SMILES=C(N1[C@H](C(N[C@H](C(N2[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC(=O)O)C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N3[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(=O)O)CCC(=O)N)=O)CC(C)C)=O)CC4=CC=C(O)C=C4)=O)CCC(=O)O)=O)CCC(=O)O)=O)CCC3)=O)[C@H](CC)C)=O)CCC(=O)O)=O)CCC(=O)O)=O)CC=5C=CC=CC5)=O)CC(=O)O)=O)=O)=O)CC(=O)N)=O)CC=6N=CNC6)=O)CO)=O)CCC(=O)N)=O)CCC2)=O)CCCCN)=O)CCC1)([C@@H](NC(=O)CNC([C@@H](NC(=O)CNC([C@@H](NC([C@@H](NC([C@H]7NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@H]8NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@H]9NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CSSC9)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC(C)C)N)=O)[C@H](O)C)=O)CC%10=CC=C(C=C%10)O)=O)[C@H](O)C)=O)CC(=O)O)=O)=O)[C@H](O)C)=O)CCC(=O)O)=O)CO)=O)=O)CCC(=O)N)=O)CC(=O)N)=O)CC(C)C)=O)=O)CC(C)C)=O)CSSC8)=O)CCC(=O)O)=O)=O)CO)=O)CC(=O)N)=O)C(C)C)=O)CSSC7)=O)=O)CCC(=O)N)=O)=O)CC(=O)N)=O)CCCCN)=O)=O)[C@H](CC)C)=O)CC(C)C)=O)=O)CO)=O)CC(=O)O)=O)=O)CCC(=O)O)=O)CCCCN)=O)CC(=O)N)=O)CCC(=O)N)=O)=O)C(C)C)=O)[C@H](O)C)=O)CCC(=O)O)=O)[C@H](O)C)=O ;   [Leu1, Thr2]-63-desulfohirudin ;   hirudin variant-1 ;   lepirudin (rDNA) ;   lepirudin recombinant
Xrefs: CAS:138068-37-8 ;   DrugBank:DB00001 ;   Drug_Central:2995 ;   KEGG:D06880
Xref Mesh: MESH:C083544
Xrefs: PMID:15280202 ;   PMID:19707378 ;   PMID:22234363 ;   PMID:28600720 ;   PMID:29426286 ;   PMID:8211886 ;   Pubchem:118856773 ;   Wikipedia:Lepirudin

paths to the root

NHLBI Logo

RGD is funded by grant HL64541 from the National Heart, Lung, and Blood Institute on behalf of the NIH.