Submit Data |  Help |  Video Tutorials |  News |  Publications |  FTP Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
Parent Terms Term With Siblings Child Terms
(+)-alpha-tocopherol +   
(12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 
(3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 
(4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 
abarelix 
Ac-(D)Phe-Pro-boroArg-OH 
Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 
Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 
Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 
Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 
Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 
acenocoumarol +   
acetylsalicylic acid +   
afamelanotide  
albiglutide 
amoxicilloyl polylysine 
amyloid-beta +  
anagrelide +   
anisindione 
apixaban 
Arthrofactin 
astaxanthin  
astressin  
astressin 2B  
atromentin 
bacitracin A +   
benzylpenicilloyl polylysine 
beta-endorphin  
betrixaban 
bivalirudin  
calcitonin  
calcitonin (human synthetic) 
calcitonin (pork natural) 
calpastatin peptide Ac 184-210 
carperitide 
CIGB-300 
cilostazol  
clopidogrel +   
clopidogrel sulfate 
CORM 3 
corticorelin 
corticotropin  
corticotropin-releasing hormone +   
cosyntropin  
cyanophycin macromolecule +  
dabigatran +   
dabigatran etexilate 
dabigatran etexilate methanesulfonate 
DASKALRSSGMP 
defensin +  
degarelix 
dermaseptin s3(1-16)-NH2 
dermatan sulfate  
desirudin 
A polypeptide with an amino acid sequence that is identical to natural hirudin variant 1, but which lacks the sulfate group on Tyr(63). (Hirudin is a salivary anticoagulant found in leeches, an almost irreversible inhibitor of thrombin in the clotting cascade; desirudin is a synthetic recombinant analogue used as an anticoagulant drug). Sequence: VVYTDCTESG QNLCLCEGSN VCGQGNKCIL GSDGEKNQCV TGEGTPKPQS HNDGDFEEIP EEYLQ (disulfide bridge: 6-14; 16-28; 22-39).
dextran  
dextran sulfate  
dicoumarol  
dieckol  
DKATIGFEVQEE 
DSGEGDFLAEGGGVR 
DuP-714 
edoxaban 
edoxaban tosylate +  
edoxaban tosylate hydrate 
EDTA disodium salt dihydrate 
elcatonin 
elf18 
enfuvirtide  
ENPAVHFFKNIVTPRTP 
ENPVVAFFKNIVTPRTP 
ENPVVHFFFNIVTPRTP 
ENPVVHFFKNIVTPRTP 
ENPVVHFFYNIVTPRTP 
eptifibatide  
eribaxaban 
ethylenediaminetetraacetic acid  
exendin-3 
exendin-4 
fondaparinux  
FPAWFTKLYPRT 
ganirelix  
gastrin +   
ghrelin  
ginsenoside Rg2  
glycyrrhizinic acid  
Gonadorelin hydrochloride 
heparin  
insulin +   
IPQVWRDWFKLP 
isorhamnetin +   
JNK inhibitor I 
KGKGKGKGKGENPAVHFFKNIVTPRTP 
KGKGKGKGKGENPVVAFFKNIVTPRTP 
KGKGKGKGKGENPVVHFFFNIVTPRTP 
KGKGKGKGKGENPVVHFFKNIVTPRTP 
KGKGKGKGKGENPVVHFFYNIVTPRTP 
kisspeptin-54 
koshikamide A2 
lantibiotic +  
lepirudin  
liraglutide  
lixisenatide 
LSM-37009 
LSM-37015 
LSM-37045 
LSM-37094 
LSM-37129 
LSM-37138 
LSM-37175 
LSM-37192 
LSM-37213 
mastoparans +   
melagatran +   
melittin  
Mirabamide C 
Mirabamide G 
Mirabamide H 
N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 
N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 
Nafarelin 
Nafarelin acetate hydrate 
nesiritide 
Neurokinin A  
Neurokinin B 
nociceptin  
normethylfondaparinux +   
omega-conotoxin GVIA  
P-factor 
p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 
penicilloyl polylysine 
peptide YY 
phenindione  
phenprocoumon  
plumbagin  
poly(glycyl-L-arginine) 
polyanethol sulfonic acid macromolecule +  
polyanethol sulfonic acid polymer 
PR-39  
pramlintide 
procyanidin B1 +  
prostaglandin E1 +   
protein polypeptide chain +   
QINTAKWWKTHF 
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 
rivaroxaban  
secretin human 
Sermorelin 
sodium citrate +   
sodium citrate dihydrate 
sodium polyanethol sulfonate macromolecule +  
sodium polyanethol sulfonate polymer 
STAT3 inhibitor peptide 
Streptomyces coelicolor calcium-dependent antibiotic CDA4b 
suberosin 
teduglutide 
teriparatide 
terlipressin 
tesamorelin 
thymalfasin 
ticlopidine +   
tirofiban +  
troglitazone  
Vaby A 
Vaby B 
Vaby C 
Vaby D 
Vaby E 
Varv E 
VSWKTWFPNLAV 
warfarin  
warfarin potassium 
warfarin sodium 
WHWLQLKPGQPMY 
ximelagatran  
YIIKGLFWDPAC +  
YIIKGVFWDPAC +  
YSPFHKWFPSMH 

Synonyms
Related Synonyms: 63-desulfohirudin (Hirudo medicinalis isoform HV1) ;   CGP-39393 ;   Iprivask ;   Revasc ;   desirudina ;   desirudine ;   desirudinum ;   desulphatohirudin HV1
Xrefs: CAS:120993-53-5 ;   Drug_Central:2990 ;   KEGG:D03692 ;   PMID:12090145 ;   PMID:21045759 ;   PMID:21646070 ;   PMID:21932952 ;   PMID:22672318 ;   PMID:23344102 ;   PMID:7719527 ;   PMID:7979736 ;   PMID:8596376 ;   PMID:8684139 ;   Pubchem:16129703

paths to the root

NHLBI Logo

RGD is funded by grant HL64541 from the National Heart, Lung, and Blood Institute on behalf of the NIH.