Send us a Message



Submit Data |  Help |  Video Tutorials |  News |  Publications |  Download |  REST API |  Citing RGD |  Contact   

EXPERIMENTAL CONDITION - ANNOTATIONS

The Clinical Measurement Ontology (CMO), Measurement Methods Ontology (MMO), and Experimental Condition Ontology (XCO) are currently being developed at the Rat Genome Database. For more information about these vocabularies please see Shimoyama et al. Three ontologies to define phenotype measurement data. Front Genet. 2012;3:87. Epub 2012 May 28 or contact us (http://rgd.mcw.edu/contact/index.shtml).

Term:lixisenatide
go back to main search page
Accession:XCO:0001209 term browser browse the term
Definition:This is any condition in which the main influencing factor is lixisenatide, a 44 amino acid polypeptide and glucagon-like peptide 1 receptor agonist used as an adjunct to diet and exercise for the treatment of adults with type II diabetes.
Synonyms:exact_synonym: H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2
 xref: CID:90472060;   PMID:37423944



show annotations for term's descendants           Sort by:

Term paths to the root
Path 1
Term Annotations click to browse term
  experimental condition 2376
    therapeutic agent 101
      hypoglycemic agent 0
        lixisenatide 0
Path 2
Term Annotations click to browse term
  experimental condition 2376
    chemical 712
      chemical with specified function 517
        activator 1
          receptor agonist 1
            lixisenatide 0
paths to the root