Send us a Message



Submit Data |  Help |  Video Tutorials |  News |  Publications |  Download |  REST API |  Citing RGD |  Contact   

CHEBI ONTOLOGY - ANNOTATIONS

The Chemical Entities of Biological Interest (ChEBI) ontology is downloaded weekly from EMBL-EBI at http://www.ebi.ac.uk/chebi/. The data is made available under the Creative Commons License (CC BY 3.0, http://creativecommons.org/licenses/by/3.0/). For more information see: Degtyarenko et al. (2008) ChEBI: a database and ontology for chemical entities of biological interest. Nucleic Acids Res. 36, D344–D350.

Term:polypeptide
go back to main search page
Accession:CHEBI:15841 term browser browse the term
Definition:A peptide containing ten or more amino acid residues.
Synonyms:exact_synonym: polypeptides
 related_synonym: Formula=C4H6N2O3R2(C2H2NOR)n;   Polypeptid;   polipeptido
 alt_id: CHEBI:14860;   CHEBI:8314
 xref: KEGG:C00403



show annotations for term's descendants           Sort by:
afamelanotide term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Mc4r melanocortin 4 receptor increases activity ISO MSH, 4-Nle-7-Phe-alpha- results in increased activity of MC4R protein CTD PMID:17713970 NCBI chr18:66,990,776...66,993,558
Ensembl chr18:66,990,775...66,993,577
JBrowse link
astressin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Agt angiotensinogen (serpin peptidase inhibitor, clade A, member 8) multiple interactions ISO [astressin co-treated with AGT protein] results in increased phosphorylation of FOS protein; [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK1 protein; [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK3 protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of CRH protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of FOS protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK1 protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK3 protein]; astressin promotes the reaction [AGT protein results in increased expression of CRH protein] CTD PMID:33872574 NCBI chr 8:125,283,326...125,296,445
Ensembl chr 8:125,283,273...125,296,445
JBrowse link
G Crh corticotropin releasing hormone multiple interactions ISO [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of CRH protein]; astressin promotes the reaction [AGT protein results in increased expression of CRH protein] CTD PMID:33872574 NCBI chr 3:19,747,565...19,749,560
Ensembl chr 3:19,747,565...19,749,560
JBrowse link
G Crhr1 corticotropin releasing hormone receptor 1 multiple interactions ISO astressin binds to and results in decreased activity of CRHR1 protein CTD PMID:16014403 NCBI chr11:104,021,289...104,066,349
Ensembl chr11:104,023,681...104,066,349
JBrowse link
G Crhr2 corticotropin releasing hormone receptor 2 multiple interactions ISO astressin binds to and results in decreased activity of CRHR2 protein CTD PMID:16014403 NCBI chr 6:55,067,033...55,110,001
Ensembl chr 6:55,067,034...55,110,001
JBrowse link
G Cyp11a1 cytochrome P450, family 11, subfamily a, polypeptide 1 decreases expression ISO astressin results in decreased expression of CYP11A1 mRNA CTD PMID:16014403 NCBI chr 9:57,905,307...57,934,314
Ensembl chr 9:57,913,694...57,934,306
JBrowse link
G Cyp17a1 cytochrome P450, family 17, subfamily a, polypeptide 1 decreases expression ISO astressin results in decreased expression of CYP17A1 mRNA CTD PMID:16014403 NCBI chr19:46,655,604...46,661,439
Ensembl chr19:46,655,604...46,661,611
JBrowse link
G Fos FBJ osteosarcoma oncogene multiple interactions ISO [astressin co-treated with AGT protein] results in increased phosphorylation of FOS protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of FOS protein] CTD PMID:33872574 NCBI chr12:85,520,664...85,524,048
Ensembl chr12:85,520,664...85,524,047
JBrowse link
G Il1rn interleukin 1 receptor antagonist multiple interactions ISO [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of CRH protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of FOS protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK1 protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK3 protein] CTD PMID:33872574 NCBI chr 2:24,226,872...24,241,503
Ensembl chr 2:24,226,865...24,241,506
JBrowse link
G Mapk1 mitogen-activated protein kinase 1 multiple interactions ISO [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK1 protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK1 protein] CTD PMID:33872574 NCBI chr16:16,801,246...16,865,317
Ensembl chr16:16,801,246...16,865,317
JBrowse link
G Mapk3 mitogen-activated protein kinase 3 multiple interactions ISO [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK3 protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK3 protein] CTD PMID:33872574 NCBI chr 7:126,358,798...126,364,988
Ensembl chr 7:126,358,773...126,364,991
JBrowse link
G Star steroidogenic acute regulatory protein decreases expression ISO astressin results in decreased expression of STAR mRNA CTD PMID:16014403 NCBI chr 8:26,298,502...26,306,010
Ensembl chr 8:26,296,583...26,306,010
JBrowse link
G Sult2a1 sulfotransferase family 2A, dehydroepiandrosterone (DHEA)-preferring, member 1 decreases expression ISO astressin results in decreased expression of SULT2A1 mRNA CTD PMID:16014403 NCBI chr 7:13,530,171...13,571,335
Ensembl chr 7:13,530,171...13,571,334
JBrowse link
G Ucn urocortin multiple interactions
decreases response to substance
ISO astressin inhibits the reaction [UCN protein inhibits the reaction [Thapsigargin results in increased uptake of Calcium]]; astressin inhibits the reaction [UCN protein inhibits the reaction [Thapsigargin results in increased uptake of Manganese]]
astressin results in decreased susceptibility to UCN protein
CTD PMID:17885217 PMID:20237592 NCBI chr 5:31,295,333...31,296,239
Ensembl chr 5:31,295,407...31,296,173
JBrowse link
astressin 2B term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Ccl2 chemokine (C-C motif) ligand 2 multiple interactions EXP astressin-2B inhibits the reaction [tcdA protein, Clostridium difficile results in increased expression of CCL2 mRNA] CTD PMID:16920976 NCBI chr11:81,926,403...81,928,278
Ensembl chr11:81,926,397...81,928,279
JBrowse link
G Cxcl3 chemokine (C-X-C motif) ligand 3 multiple interactions EXP astressin-2B inhibits the reaction [tcdA protein, Clostridium difficile results in increased expression of CXCL1 mRNA] CTD PMID:16920976 NCBI chr 5:90,933,960...90,935,952
Ensembl chr 5:90,933,962...90,937,459
JBrowse link
G Il6 interleukin 6 multiple interactions ISO astressin-2B promotes the reaction [Lipopolysaccharides results in increased secretion of IL6 protein] CTD PMID:12746300 NCBI chr 5:30,218,112...30,224,973
Ensembl chr 5:30,218,112...30,224,979
JBrowse link
G Pomc pro-opiomelanocortin-alpha increases secretion ISO astressin-2B results in increased secretion of POMC protein alternative form CTD PMID:12746300 NCBI chr12:4,004,945...4,010,643
Ensembl chr12:4,004,951...4,010,642
JBrowse link
G Tnf tumor necrosis factor multiple interactions ISO astressin-2B promotes the reaction [Lipopolysaccharides results in increased secretion of TNF protein] CTD PMID:12746300 NCBI chr17:35,418,343...35,420,983
Ensembl chr17:35,418,357...35,420,983
JBrowse link
G Ucn urocortin decreases activity ISO astressin-2B results in decreased activity of UCN protein CTD PMID:12010772 NCBI chr 5:31,295,333...31,296,239
Ensembl chr 5:31,295,407...31,296,173
JBrowse link
bacitracin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G A2m alpha-2-macroglobulin increases expression ISO Bacitracin results in increased expression of A2M mRNA CTD PMID:18289764 NCBI chr 6:121,612,920...121,656,197
Ensembl chr 6:121,612,335...121,656,186
JBrowse link
G Ache acetylcholinesterase multiple interactions EXP Bacitracin binds to and results in decreased metabolism of and results in decreased secretion of ACHE protein CTD PMID:23047022 NCBI chr 5:137,286,516...137,292,728
Ensembl chr 5:137,285,781...137,292,728
JBrowse link
G Aldh1a1 aldehyde dehydrogenase family 1, subfamily A1 increases expression ISO Bacitracin results in increased expression of ALDH1A1 mRNA CTD PMID:18289764 NCBI chr19:20,469,947...20,620,827
Ensembl chr19:20,470,079...20,620,829
JBrowse link
G Anxa5 annexin A5 increases expression ISO Bacitracin results in increased expression of ANXA5 mRNA CTD PMID:18289764 NCBI chr 3:36,503,072...36,530,036
Ensembl chr 3:36,503,072...36,530,043
JBrowse link
G Bmp1 bone morphogenetic protein 1 increases expression ISO Bacitracin results in increased expression of BMP1 mRNA CTD PMID:18289764 NCBI chr14:70,711,995...70,758,280
Ensembl chr14:70,711,998...70,757,674
JBrowse link
G Bmp4 bone morphogenetic protein 4 decreases expression ISO Bacitracin results in decreased expression of BMP4 mRNA CTD PMID:18289764 NCBI chr14:46,620,982...46,628,126
Ensembl chr14:46,620,977...46,628,126
JBrowse link
G Calb1 calbindin 1 decreases expression ISO Bacitracin results in decreased expression of CALB1 mRNA CTD PMID:18289764 NCBI chr 4:15,881,264...15,906,709
Ensembl chr 4:15,881,264...15,908,064
JBrowse link
G Cat catalase decreases expression ISO Bacitracin results in decreased expression of CAT mRNA CTD PMID:18289764 NCBI chr 2:103,284,249...103,315,498
Ensembl chr 2:103,284,194...103,315,505
JBrowse link
G Ccn1 cellular communication network factor 1 affects expression ISO Bacitracin affects the expression of CCN1 mRNA CTD PMID:18289764 NCBI chr 3:145,352,726...145,355,740
Ensembl chr 3:145,352,731...145,355,736
JBrowse link
G Ccnd1 cyclin D1 increases expression ISO Bacitracin results in increased expression of CCND1 mRNA CTD PMID:18289764 NCBI chr 7:144,483,668...144,493,568
Ensembl chr 7:144,483,668...144,493,662
JBrowse link
G Ccng1 cyclin G1 increases expression ISO Bacitracin results in increased expression of CCNG1 mRNA CTD PMID:18289764 NCBI chr11:40,639,379...40,646,155
Ensembl chr11:40,639,379...40,646,138
JBrowse link
G Cd24a CD24a antigen increases expression ISO Bacitracin results in increased expression of CD24 mRNA CTD PMID:18289764 NCBI chr10:43,454,433...43,460,261
Ensembl chr10:43,454,280...43,460,261
JBrowse link
G Cd44 CD44 antigen increases expression ISO Bacitracin results in increased expression of CD44 mRNA CTD PMID:18289764 NCBI chr 2:102,641,486...102,732,014
Ensembl chr 2:102,641,486...102,732,010
JBrowse link
G Clu clusterin increases expression ISO Bacitracin results in increased expression of CLU mRNA CTD PMID:18289764 NCBI chr14:66,205,932...66,218,997
Ensembl chr14:66,205,932...66,218,996
JBrowse link
G Cp ceruloplasmin increases expression ISO Bacitracin results in increased expression of CP mRNA CTD PMID:18289764 NCBI chr 3:20,011,097...20,063,914
Ensembl chr 3:20,011,218...20,063,309
JBrowse link
G Ctss cathepsin S increases expression ISO Bacitracin results in increased expression of CTSS mRNA CTD PMID:18289764 NCBI chr 3:95,434,097...95,463,716
Ensembl chr 3:95,434,097...95,463,714
JBrowse link
G Cyp2d22 cytochrome P450, family 2, subfamily d, polypeptide 22 decreases expression ISO Bacitracin results in decreased expression of CYP2D22 mRNA CTD PMID:18289764 NCBI chr15:82,254,728...82,264,461
Ensembl chr15:82,254,728...82,264,461
JBrowse link
G Egf epidermal growth factor decreases expression ISO Bacitracin results in decreased expression of EGF mRNA CTD PMID:18289764 NCBI chr 3:129,471,223...129,548,971
Ensembl chr 3:129,471,214...129,548,965
JBrowse link
G Fn1 fibronectin 1 increases expression ISO Bacitracin results in increased expression of FN1 mRNA CTD PMID:18289764 NCBI chr 1:71,624,632...71,692,439
Ensembl chr 1:71,624,679...71,692,359
JBrowse link
G G6pc glucose-6-phosphatase, catalytic decreases expression ISO Bacitracin results in decreased expression of G6PC1 mRNA CTD PMID:18289764 NCBI chr11:101,258,542...101,268,729
Ensembl chr11:101,258,387...101,268,729
JBrowse link
G Gadd45a growth arrest and DNA-damage-inducible 45 alpha increases expression ISO Bacitracin results in increased expression of GADD45A mRNA CTD PMID:18289764 NCBI chr 6:67,012,080...67,014,391
Ensembl chr 6:67,012,080...67,014,441
JBrowse link
G Ghr growth hormone receptor affects expression ISO Bacitracin affects the expression of GHR mRNA CTD PMID:18289764 NCBI chr15:3,347,237...3,612,834
Ensembl chr15:3,347,242...3,612,974
JBrowse link
G Glul glutamate-ammonia ligase (glutamine synthetase) increases expression ISO Bacitracin results in increased expression of GLUL mRNA CTD PMID:18289764 NCBI chr 1:153,775,675...153,785,469
Ensembl chr 1:153,775,690...153,785,469
JBrowse link
G Gstm2 glutathione S-transferase, mu 2 increases expression ISO Bacitracin results in increased expression of GSTM2 mRNA CTD PMID:18289764 NCBI chr 3:107,889,018...107,893,736
Ensembl chr 3:107,889,018...107,893,769
JBrowse link
G Havcr1 hepatitis A virus cellular receptor 1 increases expression ISO Bacitracin results in increased expression of HAVCR1 mRNA CTD PMID:18289764 NCBI chr11:46,630,644...46,670,405
Ensembl chr11:46,625,907...46,670,405
JBrowse link
G Hmox1 heme oxygenase 1 increases expression ISO Bacitracin results in increased expression of HMOX1 mRNA CTD PMID:18289764 NCBI chr 8:75,820,246...75,827,221
Ensembl chr 8:75,820,249...75,827,217
JBrowse link
G Hmox2 heme oxygenase 2 increases expression ISO Bacitracin results in increased expression of HMOX2 mRNA CTD PMID:18289764 NCBI chr16:4,544,225...4,584,606
Ensembl chr16:4,544,225...4,584,606
JBrowse link
G Igfbp1 insulin-like growth factor binding protein 1 increases expression ISO Bacitracin results in increased expression of IGFBP1 mRNA CTD PMID:18289764 NCBI chr11:7,147,787...7,152,546
Ensembl chr11:7,147,782...7,152,546
JBrowse link
G Igkc immunoglobulin kappa constant decreases expression
increases expression
ISO Bacitracin results in decreased expression of IGKC mRNA
Bacitracin results in increased expression of IGKC mRNA
CTD PMID:18289764 NCBI chr 6:70,703,419...70,703,738
Ensembl chr 6:70,703,419...70,703,950
JBrowse link
G Jun jun proto-oncogene increases expression ISO Bacitracin results in increased expression of JUN mRNA CTD PMID:18289764 NCBI chr 4:94,937,273...94,940,459
Ensembl chr 4:94,937,271...94,940,459
JBrowse link
G Klk1b3 kallikrein 1-related peptidase b3 decreases expression ISO Bacitracin results in decreased expression of NGFG mRNA CTD PMID:18289764 NCBI chr 7:43,847,615...43,851,775
Ensembl chr 7:43,847,615...43,851,776
JBrowse link
G Lcn2 lipocalin 2 increases expression ISO Bacitracin results in increased expression of LCN2 mRNA CTD PMID:18289764 NCBI chr 2:32,274,649...32,277,751
Ensembl chr 2:32,274,645...32,278,264
JBrowse link
G Mgp matrix Gla protein increases expression ISO Bacitracin results in increased expression of MGP mRNA CTD PMID:18289764 NCBI chr 6:136,849,433...136,852,821
Ensembl chr 6:136,849,433...136,852,821
JBrowse link
G Nphs2 nephrosis 2, podocin decreases expression ISO Bacitracin results in decreased expression of NPHS2 mRNA CTD PMID:18289764 NCBI chr 1:156,138,105...156,155,605
Ensembl chr 1:156,138,297...156,155,605
JBrowse link
G Oat ornithine aminotransferase increases expression ISO Bacitracin results in increased expression of OAT mRNA CTD PMID:18289764 NCBI chr 7:132,159,204...132,178,127
Ensembl chr 7:132,159,207...132,178,127
JBrowse link
G Rgn regucalcin decreases expression ISO Bacitracin results in decreased expression of RGN mRNA CTD PMID:18289764 NCBI chr  X:20,416,005...20,428,328
Ensembl chr  X:20,416,026...20,428,328
JBrowse link
G Slc22a1 solute carrier family 22 (organic cation transporter), member 1 decreases expression ISO Bacitracin results in decreased expression of SLC22A1 mRNA CTD PMID:18289764 NCBI chr17:12,867,761...12,894,725
Ensembl chr17:12,867,756...12,894,716
JBrowse link
G Slc22a6 solute carrier family 22 (organic anion transporter), member 6 decreases expression ISO Bacitracin results in decreased expression of SLC22A6 mRNA CTD PMID:18289764 NCBI chr19:8,595,360...8,605,663
Ensembl chr19:8,595,403...8,605,663
JBrowse link
G Spp1 secreted phosphoprotein 1 increases expression ISO Bacitracin results in increased expression of SPP1 mRNA CTD PMID:18289764 NCBI chr 5:104,582,977...104,588,919
Ensembl chr 5:104,582,984...104,588,916
JBrowse link
G Timp1 tissue inhibitor of metalloproteinase 1 increases expression ISO Bacitracin results in increased expression of TIMP1 mRNA CTD PMID:18289764 NCBI chr  X:20,736,405...20,740,976
Ensembl chr  X:20,736,405...20,740,974
JBrowse link
G Tmsb10 thymosin beta 10 increases expression ISO Bacitracin results in increased expression of TMSB10 mRNA CTD PMID:18289764 NCBI chr 6:72,934,330...72,935,731
Ensembl chr 6:72,934,330...72,935,731
JBrowse link
G Vcam1 vascular cell adhesion molecule 1 increases expression ISO Bacitracin results in increased expression of VCAM1 mRNA CTD PMID:18289764 NCBI chr 3:115,903,669...115,923,337
Ensembl chr 3:115,903,598...115,923,337
JBrowse link
G Vegfa vascular endothelial growth factor A decreases expression ISO Bacitracin results in decreased expression of VEGFA mRNA CTD PMID:18289764 NCBI chr17:46,327,919...46,343,303
Ensembl chr17:46,327,919...46,343,295
JBrowse link
G Vim vimentin increases expression ISO Bacitracin results in increased expression of VIM mRNA CTD PMID:18289764 NCBI chr 2:13,579,122...13,587,637
Ensembl chr 2:13,578,738...13,587,637
JBrowse link
beta-endorphin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Agt angiotensinogen (serpin peptidase inhibitor, clade A, member 8) multiple interactions
increases abundance
ISO IL1RN protein inhibits the reaction [AGT protein results in increased abundance of beta-Endorphin] CTD PMID:33872574 NCBI chr 8:125,283,326...125,296,445
Ensembl chr 8:125,283,273...125,296,445
JBrowse link
G Crh corticotropin releasing hormone decreases secretion
increases secretion
multiple interactions
ISO beta-Endorphin results in decreased secretion of CRH protein
CRF protein results in increased secretion of beta-Endorphin
adinazolam inhibits the reaction [CRF protein results in increased secretion of beta-Endorphin]; beta-Endorphin inhibits the reaction [Nitroprusside results in increased secretion of CRH protein]; Naltrexone inhibits the reaction [beta-Endorphin results in decreased secretion of CRH protein]
CTD PMID:1480515 PMID:3031743 NCBI chr 3:19,747,565...19,749,560
Ensembl chr 3:19,747,565...19,749,560
JBrowse link
G Il1rn interleukin 1 receptor antagonist multiple interactions ISO IL1RN protein inhibits the reaction [AGT protein results in increased abundance of beta-Endorphin] CTD PMID:33872574 NCBI chr 2:24,226,872...24,241,503
Ensembl chr 2:24,226,865...24,241,506
JBrowse link
G Il2 interleukin 2 decreases expression ISO beta-Endorphin results in decreased expression of IL2 mRNA CTD PMID:23965172 NCBI chr 3:37,174,862...37,180,103
Ensembl chr 3:37,174,672...37,180,108
JBrowse link
G Il4 interleukin 4 increases expression ISO beta-Endorphin results in increased expression of IL4 mRNA CTD PMID:23965172 NCBI chr11:53,503,287...53,509,492
Ensembl chr11:53,493,809...53,509,496
JBrowse link
G Mapk1 mitogen-activated protein kinase 1 increases phosphorylation ISO beta-Endorphin results in increased phosphorylation of MAPK1 protein CTD PMID:23965172 NCBI chr16:16,801,246...16,865,317
Ensembl chr16:16,801,246...16,865,317
JBrowse link
G Mapk3 mitogen-activated protein kinase 3 increases phosphorylation ISO beta-Endorphin results in increased phosphorylation of MAPK3 protein CTD PMID:23965172 NCBI chr 7:126,358,798...126,364,988
Ensembl chr 7:126,358,773...126,364,991
JBrowse link
G Nfkbia nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, alpha increases expression ISO beta-Endorphin results in increased expression of NFKBIA protein CTD PMID:22258905 NCBI chr12:55,536,194...55,539,432
Ensembl chr12:55,536,195...55,539,432
JBrowse link
G Pld2 phospholipase D2 increases activity ISO beta-Endorphin results in increased activity of PLD2 protein CTD PMID:23965172 NCBI chr11:70,430,318...70,448,936
Ensembl chr11:70,430,890...70,448,936
JBrowse link
G Usp15 ubiquitin specific peptidase 15 increases expression ISO beta-Endorphin results in increased expression of USP15 mRNA CTD PMID:24068670 NCBI chr10:122,940,911...123,032,924
Ensembl chr10:122,940,911...123,032,900
JBrowse link
bivalirudin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Crp C-reactive protein, pentraxin-related decreases expression ISO bivalirudin results in decreased expression of CRP protein CTD PMID:16118546 NCBI chr 1:172,525,623...172,527,533
Ensembl chr 1:172,525,622...172,660,598
JBrowse link
G F2 coagulation factor II multiple interactions
decreases activity
increases cleavage
ISO bivalirudin binds to and results in decreased activity of F2 protein; bivalirudin inhibits the reaction [F2 protein results in increased expression of SELP protein]
bivalirudin results in decreased activity of F2 protein
F2 protein results in increased cleavage of bivalirudin
CTD PMID:1290488 PMID:8456428 PMID:15080313 PMID:15155122 PMID:16084352 More... NCBI chr 2:91,442,742...91,466,802
Ensembl chr 2:91,455,665...91,466,759
JBrowse link
G F2r coagulation factor II (thrombin) receptor decreases activity ISO bivalirudin results in decreased activity of F2R protein CTD PMID:19124943 NCBI chr13:95,738,288...95,754,974
Ensembl chr13:95,738,311...95,754,995
JBrowse link
G F2rl3 coagulation factor II (thrombin) receptor-like 3 decreases activity ISO bivalirudin results in decreased activity of F2RL3 protein CTD PMID:19124943 NCBI chr 8:73,488,287...73,490,526
Ensembl chr 8:73,488,508...73,490,502
JBrowse link
G Mpo myeloperoxidase decreases expression ISO bivalirudin results in decreased expression of MPO protein CTD PMID:18701766 NCBI chr11:87,684,610...87,695,238
Ensembl chr11:87,684,407...87,695,239
JBrowse link
G P2ry12 purinergic receptor P2Y, G-protein coupled 12 affects response to substance EXP P2RY12 affects the susceptibility to bivalirudin CTD PMID:14597584 NCBI chr 3:59,123,692...59,170,408
Ensembl chr 3:59,123,693...59,170,292
JBrowse link
G Pdgfb platelet derived growth factor, B polypeptide affects expression ISO bivalirudin affects the expression of PDGFB protein CTD PMID:10754393 PMID:11316950 NCBI chr15:79,880,066...79,899,178
Ensembl chr15:79,880,075...79,899,178
JBrowse link
G Selp selectin, platelet multiple interactions ISO bivalirudin inhibits the reaction [F2 protein results in increased expression of SELP protein] CTD PMID:16845256 NCBI chr 1:163,942,833...163,977,595
Ensembl chr 1:163,942,833...163,977,595
JBrowse link
calcitonin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Hcrt hypocretin decreases expression ISO salmon calcitonin results in decreased expression of HCRT mRNA CTD PMID:12686383 NCBI chr11:100,652,519...100,653,757
Ensembl chr11:100,651,895...100,653,757
JBrowse link
G Pmch pro-melanin-concentrating hormone decreases expression ISO salmon calcitonin results in decreased expression of PMCH mRNA CTD PMID:12686383 NCBI chr10:87,926,934...87,928,236
Ensembl chr10:87,926,934...87,928,237
JBrowse link
corticotropin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Ada adenosine deaminase increases activity ISO Adrenocorticotropic Hormone results in increased activity of ADA protein CTD PMID:8868375 NCBI chr 2:163,568,491...163,592,161
Ensembl chr 2:163,568,504...163,592,159
JBrowse link
G Calca calcitonin/calcitonin-related polypeptide, alpha increases abundance ISO CALCA protein results in increased abundance of Adrenocorticotropic Hormone CTD PMID:12639925 NCBI chr 7:114,225,223...114,236,145
Ensembl chr 7:114,230,713...114,235,592
JBrowse link
G Cnp 2',3'-cyclic nucleotide 3' phosphodiesterase decreases activity ISO Adrenocorticotropic Hormone results in decreased activity of CNP protein CTD PMID:3030154 NCBI chr11:100,465,765...100,472,565
Ensembl chr11:100,465,730...100,482,555
JBrowse link
G Crh corticotropin releasing hormone multiple interactions
increases secretion
ISO Astemizole inhibits the reaction [Corticosterone inhibits the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone]]; Corticosterone inhibits the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone]; E 4031 inhibits the reaction [Corticosterone inhibits the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone]]; Tetraethylammonium promotes the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone] CTD PMID:18835572 NCBI chr 3:19,747,565...19,749,560
Ensembl chr 3:19,747,565...19,749,560
JBrowse link
G Cyp17a1 cytochrome P450, family 17, subfamily a, polypeptide 1 affects abundance ISO CYP17A1 protein affects the abundance of Adrenocorticotropic Hormone CTD PMID:18645707 NCBI chr19:46,655,604...46,661,439
Ensembl chr19:46,655,604...46,661,611
JBrowse link
G Gh growth hormone multiple interactions ISO Adrenocorticotropic Hormone inhibits the reaction [INS protein results in increased secretion of GH1 protein] CTD PMID:3008584 NCBI chr11:106,191,087...106,194,529
Ensembl chr11:106,191,097...106,192,691
JBrowse link
G Htr2a 5-hydroxytryptamine (serotonin) receptor 2A multiple interactions
affects expression
ISO Bupropion inhibits the reaction [Adrenocorticotropic Hormone affects the expression of HTR2A mRNA] CTD PMID:18239281 NCBI chr14:74,878,314...74,944,299
Ensembl chr14:74,878,280...74,946,934
JBrowse link
G Ins2 insulin II multiple interactions ISO Adrenocorticotropic Hormone inhibits the reaction [INS protein results in increased secretion of GH1 protein] CTD PMID:3008584 NCBI chr 7:142,232,393...142,233,463
Ensembl chr 7:142,232,393...142,297,118
JBrowse link
G Nr3c1 nuclear receptor subfamily 3, group C, member 1 affects abundance ISO NR3C1 gene polymorphism affects the abundance of Adrenocorticotropic Hormone CTD PMID:17716631 NCBI chr18:39,543,598...39,652,485
Ensembl chr18:39,543,598...39,652,474
JBrowse link
G Ppp1r1b protein phosphatase 1, regulatory inhibitor subunit 1B multiple interactions EXP Cocaine promotes the reaction [PPP1R1B protein results in increased abundance of Adrenocorticotropic Hormone] CTD PMID:10516482 NCBI chr11:98,239,232...98,248,622
Ensembl chr11:98,239,230...98,248,622
JBrowse link
G Ucn2 urocortin 2 increases abundance EXP UCN2 protein results in increased abundance of Adrenocorticotropic Hormone CTD PMID:16330704 NCBI chr 9:108,815,231...108,816,232
Ensembl chr 9:108,815,078...108,816,232
JBrowse link
corticotropin-releasing hormone term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Crhr1 corticotropin releasing hormone receptor 1 increases expression
decreases activity
multiple interactions
ISO Corticotropin-Releasing Hormone results in increased expression of CRHR1 mRNA
Corticotropin-Releasing Hormone results in decreased activity of CRHR1 protein
Pentobarbital inhibits the reaction [Corticotropin-Releasing Hormone results in decreased activity of CRHR1 protein]; Pentobarbital inhibits the reaction [Corticotropin-Releasing Hormone results in increased expression of CRHR1 mRNA]
CTD PMID:12093084 NCBI chr11:104,021,289...104,066,349
Ensembl chr11:104,023,681...104,066,349
JBrowse link
cosyntropin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Hsd11b2 hydroxysteroid 11-beta dehydrogenase 2 decreases expression ISO Cosyntropin results in decreased expression of HSD11B2 protein CTD PMID:11082157 NCBI chr 8:106,245,378...106,250,620
Ensembl chr 8:106,245,387...106,250,620
JBrowse link
enfuvirtide term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Cyp1a2 cytochrome P450, family 1, subfamily a, polypeptide 2 affects activity ISO enfuvirtide affects the activity of CYP1A2 protein CTD PMID:15656696 NCBI chr 9:57,584,220...57,590,938
Ensembl chr 9:57,584,220...57,590,986
JBrowse link
G Cyp2c38 cytochrome P450, family 2, subfamily c, polypeptide 38 affects activity ISO enfuvirtide affects the activity of CYP2C19 protein CTD PMID:15656696 NCBI chr19:39,378,000...39,451,547
Ensembl chr19:39,378,000...39,451,519
JBrowse link
G Cyp2e1 cytochrome P450, family 2, subfamily e, polypeptide 1 affects activity ISO enfuvirtide affects the activity of CYP2E1 protein CTD PMID:15656696 NCBI chr 7:140,343,732...140,354,903
Ensembl chr 7:140,343,652...140,354,900
JBrowse link
ganirelix term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Lhb luteinizing hormone beta decreases secretion
decreases expression
ISO ganirelix results in decreased secretion of LHB protein
ganirelix results in decreased expression of LHB protein
CTD PMID:17579202 PMID:21273126 NCBI chr 7:45,066,912...45,071,279
Ensembl chr 7:45,070,244...45,071,321
JBrowse link
gastrin-17 term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Birc2 baculoviral IAP repeat-containing 2 multiple interactions ISO [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC2 CTD PMID:17704804 NCBI chr 9:7,818,227...7,837,123
Ensembl chr 9:7,818,228...7,837,065
JBrowse link
G Birc3 baculoviral IAP repeat-containing 3 multiple interactions ISO [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC3 CTD PMID:17704804 NCBI chr 9:7,848,698...7,873,199
Ensembl chr 9:7,848,700...7,873,187
JBrowse link
G Cckbr cholecystokinin B receptor multiple interactions ISO [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC2; [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC3; [gastrin 17 co-treated with CCKBR protein] results in increased expression of IER3 mRNA CTD PMID:17704804 NCBI chr 7:105,074,882...105,085,546
Ensembl chr 7:105,074,938...105,120,105
JBrowse link
G Cxcl15 chemokine (C-X-C motif) ligand 15 increases secretion ISO gastrin 17 results in increased secretion of CXCL8 protein CTD PMID:15623601 NCBI chr 5:90,942,393...90,950,926
Ensembl chr 5:90,942,393...90,950,926
JBrowse link
G Ier3 immediate early response 3 multiple interactions ISO [gastrin 17 co-treated with CCKBR protein] results in increased expression of IER3 mRNA CTD PMID:17704804 NCBI chr17:36,132,605...36,133,803
Ensembl chr17:36,132,576...36,133,815
JBrowse link
G Nfkb1 nuclear factor of kappa light polypeptide gene enhancer in B cells 1, p105 decreases activity ISO gastrin 17 results in decreased activity of NFKB1 protein CTD PMID:15623601 NCBI chr 3:135,290,416...135,397,728
Ensembl chr 3:135,290,416...135,397,308
JBrowse link
G Rela v-rel reticuloendotheliosis viral oncogene homolog A (avian) decreases activity ISO gastrin 17 results in decreased activity of RELA protein CTD PMID:15623601 NCBI chr19:5,687,569...5,698,162
Ensembl chr19:5,687,511...5,698,158
JBrowse link
G Sele selectin, endothelial cell decreases expression ISO gastrin 17 results in decreased expression of SELE protein CTD PMID:15623601 NCBI chr 1:163,867,200...163,886,056
Ensembl chr 1:163,875,773...163,885,246
JBrowse link
ghrelin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Cnr1 cannabinoid receptor 1 (brain) multiple interactions ISO Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in decreased expression of CNR1 mRNA] CTD PMID:31468622 NCBI chr 4:33,923,171...33,948,831
Ensembl chr 4:33,924,593...33,948,831
JBrowse link
G Glp1r glucagon-like peptide 1 receptor multiple interactions ISO Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in decreased expression of GLP1R mRNA] CTD PMID:31468622 NCBI chr17:31,120,841...31,155,484
Ensembl chr17:31,120,791...31,159,765
JBrowse link
G Mir33 microRNA 33 multiple interactions ISO Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in increased expression of MIR33A mRNA] CTD PMID:31468622 NCBI chr15:82,082,323...82,082,391
Ensembl chr15:82,082,323...82,082,391
JBrowse link
insulin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Insr insulin receptor decreases expression ISO insulin decreases expression of hepatic mRNA in streptozocin treated rats RGD PMID:1280238 RGD:15036814 NCBI chr 8:3,200,922...3,329,649
Ensembl chr 8:3,172,061...3,329,617
JBrowse link
G Mir210 microRNA 210 increases expression
multiple interactions
ISO Insulin increases expression of Mir210 miRNA in myocardial cell
LY294002 inhibits the reaction [Insulin increases expression of Mir210 miRNA in myocardial cell]
RGD PMID:25968948 PMID:25968948 RGD:11086706, RGD:11086706 NCBI chr 7:140,801,297...140,801,406
Ensembl chr 7:140,801,297...140,801,406
JBrowse link
insulin (human) term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Tnf tumor necrosis factor increases secretion ISO Novorapid inhibits the reaction [Lipopolysaccharide increases secretion of Tnf protein in serum] RGD PMID:18078960 RGD:15023464 NCBI chr17:35,418,343...35,420,983
Ensembl chr17:35,418,357...35,420,983
JBrowse link
lepirudin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G F2 coagulation factor II multiple interactions ISO lepirudin binds to and results in decreased activity of F2 protein CTD PMID:15080313 PMID:18449412 NCBI chr 2:91,442,742...91,466,802
Ensembl chr 2:91,455,665...91,466,759
JBrowse link
liraglutide term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Acaca acetyl-Coenzyme A carboxylase alpha multiple interactions EXP Liraglutide inhibits the reaction [IL1B protein results in increased phosphorylation of ACACA protein] CTD PMID:32898504 NCBI chr11:84,020,461...84,292,477
Ensembl chr11:84,020,498...84,292,477
JBrowse link
G Adam33 a disintegrin and metallopeptidase domain 33 decreases methylation
increases expression
EXP
ISO
Liraglutide results in decreased methylation of ADAM33 promoter
Liraglutide results in increased expression of ADAM33 mRNA; Liraglutide results in increased expression of ADAM33 protein
CTD PMID:34534549 NCBI chr 2:130,892,739...130,905,734
Ensembl chr 2:130,892,511...130,905,734
JBrowse link
G Adipoq adiponectin, C1Q and collagen domain containing multiple interactions EXP Liraglutide inhibits the reaction [IL1B protein results in decreased secretion of ADIPOQ protein] CTD PMID:32898504 NCBI chr16:22,965,286...22,976,718
Ensembl chr16:22,965,286...22,976,778
JBrowse link
G Akt1 thymoma viral proto-oncogene 1 multiple interactions ISO Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of AKT1 protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of AKT1 protein]] CTD PMID:31173752 NCBI chr12:112,620,255...112,641,318
Ensembl chr12:112,620,255...112,641,318
JBrowse link
G Bax BCL2-associated X protein multiple interactions ISO Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased expression of BAX protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased expression of BAX protein]]
Liraglutide inhibits the reaction [Methotrexate results in increased expression of BAX protein]
CTD PMID:31173752 PMID:31362085 NCBI chr 7:45,111,119...45,116,344
Ensembl chr 7:45,111,121...45,116,322
JBrowse link
G Bcl2 B cell leukemia/lymphoma 2 multiple interactions ISO Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased expression of BCL2 protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased expression of BCL2 protein]]
Liraglutide inhibits the reaction [Methotrexate results in decreased expression of BCL2 protein]
CTD PMID:31173752 PMID:31362085 NCBI chr 1:106,465,906...106,642,020
Ensembl chr 1:106,465,908...106,642,004
JBrowse link
G Casp3 caspase 3 multiple interactions ISO Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased cleavage of CASP3 protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased cleavage of CASP3 protein]]
Liraglutide inhibits the reaction [Methotrexate results in increased expression of and results in increased activity of CASP3 protein]
CTD PMID:31173752 PMID:31362085 NCBI chr 8:47,070,326...47,092,733
Ensembl chr 8:47,070,326...47,092,724
JBrowse link
G Cdh1 cadherin 1 decreases methylation
increases expression
EXP
ISO
Liraglutide results in decreased methylation of CDH1 promoter
Liraglutide results in increased expression of CDH1 mRNA; Liraglutide results in increased expression of CDH1 protein
CTD PMID:34534549 NCBI chr 8:107,329,982...107,396,879
Ensembl chr 8:107,329,983...107,396,878
JBrowse link
G Cpt1a carnitine palmitoyltransferase 1a, liver multiple interactions EXP Liraglutide inhibits the reaction [IL1B protein results in decreased expression of CPT1A protein] CTD PMID:32898504 NCBI chr19:3,372,328...3,435,735
Ensembl chr19:3,372,334...3,435,733
JBrowse link
G Creb1 cAMP responsive element binding protein 1 multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in decreased phosphorylation of CREB1 protein] CTD PMID:31362085 NCBI chr 1:64,571,963...64,643,707
Ensembl chr 1:64,571,804...64,643,707
JBrowse link
G Dgat1 diacylglycerol O-acyltransferase 1 multiple interactions EXP Liraglutide inhibits the reaction [IL1B protein results in decreased expression of DGAT1 protein] CTD PMID:32898504 NCBI chr15:76,386,212...76,396,225
Ensembl chr15:76,386,215...76,396,153
JBrowse link
G Esr1 estrogen receptor 1 (alpha) increases expression ISO Liraglutide results in increased expression of ESR1 mRNA; Liraglutide results in increased expression of ESR1 protein CTD PMID:34534549 NCBI chr10:4,561,989...4,955,633
Ensembl chr10:4,561,593...4,955,614
JBrowse link
G Glp1r glucagon-like peptide 1 receptor multiple interactions
increases expression
ISO Liraglutide inhibits the reaction [nitrofen results in decreased expression of GLP1R mRNA]
Liraglutide binds to and results in increased activity of GLP1R protein
Liraglutide results in increased expression of GLP1R mRNA
CTD PMID:23354098 PMID:23471186 NCBI chr17:31,120,841...31,155,484
Ensembl chr17:31,120,791...31,159,765
JBrowse link
G Gpt glutamic pyruvic transaminase, soluble multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in increased expression of GPT protein] CTD PMID:31362085 NCBI chr15:76,580,926...76,583,875
Ensembl chr15:76,579,916...76,583,886
JBrowse link
G Gsk3b glycogen synthase kinase 3 beta multiple interactions ISO Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of GSK3B protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of GSK3B protein]] CTD PMID:31173752 NCBI chr16:37,909,363...38,066,446
Ensembl chr16:37,909,363...38,066,446
JBrowse link
G Hmox1 heme oxygenase 1 multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in increased expression of HMOX1 protein] CTD PMID:31362085 NCBI chr 8:75,820,246...75,827,221
Ensembl chr 8:75,820,249...75,827,217
JBrowse link
G Il1b interleukin 1 beta multiple interactions EXP Liraglutide inhibits the reaction [IL1B protein results in decreased expression of CPT1A protein]; Liraglutide inhibits the reaction [IL1B protein results in decreased expression of DGAT1 protein]; Liraglutide inhibits the reaction [IL1B protein results in decreased expression of PPARGC1A protein]; Liraglutide inhibits the reaction [IL1B protein results in decreased secretion of ADIPOQ protein]; Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 mRNA]; Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 protein]; Liraglutide inhibits the reaction [IL1B protein results in increased phosphorylation of ACACA protein] CTD PMID:32898504 NCBI chr 2:129,206,490...129,213,059
Ensembl chr 2:129,206,490...129,213,059
JBrowse link
G Il6 interleukin 6 multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in increased expression of IL6 protein] CTD PMID:31362085 NCBI chr 5:30,218,112...30,224,973
Ensembl chr 5:30,218,112...30,224,979
JBrowse link
G Mapt microtubule-associated protein tau multiple interactions ISO Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of MAPT protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of MAPT protein]] CTD PMID:31173752 NCBI chr11:104,120,235...104,222,916
Ensembl chr11:104,122,216...104,222,916
JBrowse link
G Nfe2l2 nuclear factor, erythroid derived 2, like 2 multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in decreased expression of NFE2L2 protein] CTD PMID:31362085 NCBI chr 2:75,505,857...75,535,007
Ensembl chr 2:75,505,857...75,534,985
JBrowse link
G Nox4 NADPH oxidase 4 multiple interactions EXP Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 mRNA]; Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 protein] CTD PMID:32898504 NCBI chr 7:86,893,638...87,047,918
Ensembl chr 7:86,895,304...87,047,918
JBrowse link
G Ppargc1a peroxisome proliferative activated receptor, gamma, coactivator 1 alpha multiple interactions EXP Liraglutide inhibits the reaction [IL1B protein results in decreased expression of PPARGC1A protein] CTD PMID:32898504 NCBI chr 5:51,611,591...52,273,337
Ensembl chr 5:51,611,592...51,725,068
JBrowse link
G Ptgs2 prostaglandin-endoperoxide synthase 2 multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in increased expression of PTGS2 protein] CTD PMID:31362085 NCBI chr 1:149,975,782...149,983,985
Ensembl chr 1:149,975,782...149,983,978
JBrowse link
G Rela v-rel reticuloendotheliosis viral oncogene homolog A (avian) multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in increased expression of RELA protein] CTD PMID:31362085 NCBI chr19:5,687,569...5,698,162
Ensembl chr19:5,687,511...5,698,158
JBrowse link
G Sftpa1 surfactant associated protein A1 increases expression
multiple interactions
ISO Liraglutide results in increased expression of SFTPA1 mRNA
Liraglutide inhibits the reaction [nitrofen results in decreased expression of SFTPA1 mRNA]; Liraglutide inhibits the reaction [nitrofen results in decreased expression of SFTPA1 protein]
CTD PMID:23354098 NCBI chr14:40,853,745...40,858,330
Ensembl chr14:40,853,739...40,858,409
JBrowse link
G Sftpb surfactant associated protein B increases expression ISO Liraglutide results in increased expression of SFTPB mRNA CTD PMID:23354098 NCBI chr 6:72,281,594...72,291,356
Ensembl chr 6:72,281,594...72,291,354
JBrowse link
G Tnf tumor necrosis factor multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in increased expression of TNF protein] CTD PMID:31362085 NCBI chr17:35,418,343...35,420,983
Ensembl chr17:35,418,357...35,420,983
JBrowse link
G Tsc1 TSC complex subunit 1 multiple interactions ISO Liraglutide reverses the reaction [palmitate fatty acid decreases expression of tsc1 protein in hepatocytes] RGD PMID:31787541 RGD:25823196 NCBI chr 2:28,531,005...28,581,184
Ensembl chr 2:28,531,240...28,581,179
JBrowse link
mastoparan term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Abca1 ATP-binding cassette, sub-family A (ABC1), member 1 multiple interactions
increases phosphorylation
ISO mastoparan inhibits the reaction [APOA1 protein affects the reaction [ABCA1 protein results in increased export of Cholesterol]]
mastoparan results in increased phosphorylation of ABCA1 protein
CTD PMID:16118212 NCBI chr 4:53,030,789...53,159,988
Ensembl chr 4:53,030,787...53,159,895
JBrowse link
G Apoa1 apolipoprotein A-I multiple interactions ISO mastoparan inhibits the reaction [APOA1 protein affects the reaction [ABCA1 protein results in increased export of Cholesterol]] CTD PMID:16118212 NCBI chr 9:46,139,928...46,141,767
Ensembl chr 9:46,139,878...46,141,764
JBrowse link
G Calm1 calmodulin 1 affects binding ISO mastoparan binds to CALM1 protein CTD PMID:17098364 NCBI chr12:100,165,694...100,176,083
Ensembl chr12:100,165,694...100,176,073
JBrowse link
G Il6 interleukin 6 multiple interactions EXP mastoparan inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 protein] CTD PMID:21255617 NCBI chr 5:30,218,112...30,224,973
Ensembl chr 5:30,218,112...30,224,979
JBrowse link
G Nos1 nitric oxide synthase 1, neuronal decreases activity ISO mastoparan results in decreased activity of NOS1 protein CTD PMID:17098364 NCBI chr 5:118,004,904...118,096,905
Ensembl chr 5:117,919,097...118,096,905
JBrowse link
melittin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Actb actin, beta increases expression ISO Melitten results in increased expression of ACTB protein CTD PMID:34375656 NCBI chr 5:142,888,870...142,892,509
Ensembl chr 5:142,888,870...142,892,509
JBrowse link
G Adam10 a disintegrin and metallopeptidase domain 10 multiple interactions ISO Melitten results in increased cleavage of and results in increased activity of ADAM10 protein CTD PMID:22613720 NCBI chr 9:70,586,133...70,687,511
Ensembl chr 9:70,586,279...70,687,511
JBrowse link
G Adam17 a disintegrin and metallopeptidase domain 17 multiple interactions ISO Melitten results in increased cleavage of and results in increased activity of ADAM17 protein CTD PMID:22613720 NCBI chr12:21,373,510...21,423,633
Ensembl chr12:21,373,510...21,423,633
JBrowse link
G Aim2 absent in melanoma 2 multiple interactions ISO AIM2 protein promotes the reaction [Melitten results in increased expression of IL18 protein]; AIM2 protein promotes the reaction [Melitten results in increased expression of IL1B protein] CTD PMID:22973906 NCBI chr 1:173,177,105...173,293,606
Ensembl chr 1:173,178,445...173,293,606
JBrowse link
G Akt1 thymoma viral proto-oncogene 1 multiple interactions ISO Melitten inhibits the reaction [TNF protein results in increased phosphorylation of AKT1 protein] CTD PMID:22926441 NCBI chr12:112,620,255...112,641,318
Ensembl chr12:112,620,255...112,641,318
JBrowse link
G Alox5 arachidonate 5-lipoxygenase increases activity ISO Melitten results in increased activity of ALOX5 protein CTD PMID:18475477 NCBI chr 6:116,387,030...116,438,139
Ensembl chr 6:116,387,038...116,438,139
JBrowse link
G Apaf1 apoptotic peptidase activating factor 1 multiple interactions ISO
EXP
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]
Melitten affects the reaction [TGFB1 protein affects the localization of APAF1 protein]
CTD PMID:21354845 PMID:21871910 NCBI chr10:90,825,173...90,918,688
Ensembl chr10:90,825,173...90,918,632
JBrowse link
G Bak1 BCL2-antagonist/killer 1 increases expression ISO Melitten results in increased expression of BAK1 protein CTD PMID:34375656 NCBI chr17:27,238,786...27,247,601
Ensembl chr17:27,238,784...27,247,983
JBrowse link
G Bax BCL2-associated X protein multiple interactions
increases expression
EXP
ISO
Melitten affects the reaction [TGFB1 protein affects the localization of BAX protein]
Melitten analog results in increased expression of BAX mRNA; Melitten analog results in increased expression of BAX protein; Melitten results in increased expression of BAX protein
CTD PMID:21871910 PMID:22027265 PMID:29387245 PMID:34375656 NCBI chr 7:45,111,119...45,116,344
Ensembl chr 7:45,111,121...45,116,322
JBrowse link
G Bcl2 B cell leukemia/lymphoma 2 decreases expression
multiple interactions
ISO
EXP
Melitten analog results in decreased expression of BCL2 mRNA; Melitten analog results in decreased expression of BCL2 protein; Melitten results in decreased expression of BCL2 protein
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]
Melitten affects the reaction [TGFB1 protein affects the localization of BCL2 protein]
CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:22027265 PMID:29387245 NCBI chr 1:106,465,906...106,642,020
Ensembl chr 1:106,465,908...106,642,004
JBrowse link
G Birc3 baculoviral IAP repeat-containing 3 decreases expression ISO Melitten results in decreased expression of BIRC3 protein CTD PMID:21456063 NCBI chr 9:7,848,698...7,873,199
Ensembl chr 9:7,848,700...7,873,187
JBrowse link
G Calm1 calmodulin 1 affects binding ISO Melitten binds to CALM1 protein CTD PMID:17098364 NCBI chr12:100,165,694...100,176,083
Ensembl chr12:100,165,694...100,176,073
JBrowse link
G Casp3 caspase 3 increases expression
decreases expression
multiple interactions
ISO
EXP
Melitten analog results in increased expression of CASP3 mRNA; Melitten analog results in increased expression of CASP3 protein; Melitten results in increased expression of CASP3 protein modified form
Melitten results in decreased expression of CASP3 protein
Melitten results in increased cleavage of and results in increased activity of CASP3 protein
Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]
Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP3 protein]
CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:22027265 PMID:29387245 More... NCBI chr 8:47,070,326...47,092,733
Ensembl chr 8:47,070,326...47,092,724
JBrowse link
G Casp8 caspase 8 increases expression ISO Melitten results in increased expression of CASP8 protein modified form CTD PMID:22027265 NCBI chr 1:58,834,398...58,886,662
Ensembl chr 1:58,834,533...58,886,662
JBrowse link
G Casp9 caspase 9 multiple interactions
increases expression
ISO
EXP
Melitten results in increased cleavage of and results in increased activity of CASP9 protein
Melitten analog results in increased expression of CASP9 mRNA; Melitten analog results in increased expression of CASP9 protein
Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein]
Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP9 protein]
CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:29387245 NCBI chr 4:141,520,923...141,543,289
Ensembl chr 4:141,520,923...141,543,287
JBrowse link
G Ccnd1 cyclin D1 decreases expression ISO Melitten results in decreased expression of CCND1 protein CTD PMID:26189965 NCBI chr 7:144,483,668...144,493,568
Ensembl chr 7:144,483,668...144,493,662
JBrowse link
G Cdh1 cadherin 1 increases secretion ISO Melitten results in increased secretion of CDH1 protein CTD PMID:22613720 NCBI chr 8:107,329,982...107,396,879
Ensembl chr 8:107,329,983...107,396,878
JBrowse link
G Cdk4 cyclin-dependent kinase 4 decreases expression ISO Melitten results in decreased expression of CDK4 protein CTD PMID:26189965 NCBI chr10:126,899,404...126,903,157
Ensembl chr10:126,899,403...126,903,789
JBrowse link
G Chrna7 cholinergic receptor, nicotinic, alpha polypeptide 7 multiple interactions
increases activity
ISO Bungarotoxins inhibits the reaction [Melitten results in increased activity of CHRNA7 protein]; methyllycaconitine inhibits the reaction [Melitten results in increased activity of CHRNA7 protein] CTD PMID:19910175 NCBI chr 7:62,748,440...62,862,274
Ensembl chr 7:62,748,440...62,862,317
JBrowse link
G Chuk conserved helix-loop-helix ubiquitous kinase multiple interactions
affects binding
ISO
EXP
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of and results in increased activity of CHUK protein]
Melitten binds to CHUK protein
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; Dithiothreitol inhibits the reaction [Melitten binds to and results in decreased activity of CHUK protein]; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Glutathione inhibits the reaction [Melitten binds to and results in decreased activity of CHUK protein]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Hydrogen Peroxide inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [Thioacetamide results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased activity of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of CHUK protein]
CTD PMID:17067557 PMID:21969711 NCBI chr19:44,061,773...44,095,940
Ensembl chr19:44,061,774...44,095,919
JBrowse link
G Cryab crystallin, alpha B multiple interactions ISO Melitten promotes the reaction [sodium arsenite results in increased expression of CRYAB mRNA]; Melitten promotes the reaction [sodium arsenite results in increased expression of CRYAB protein] CTD PMID:8591993 NCBI chr 9:50,657,251...50,667,936
Ensembl chr 9:50,662,625...50,667,936
JBrowse link
G Cxcl15 chemokine (C-X-C motif) ligand 15 increases expression ISO Melitten results in increased expression of CXCL8 mRNA CTD PMID:17579088 NCBI chr 5:90,942,393...90,950,926
Ensembl chr 5:90,942,393...90,950,926
JBrowse link
G Drd2 dopamine receptor D2 multiple interactions ISO Melitten inhibits the reaction [Spiperone binds to DRD2 protein] CTD PMID:20969853 NCBI chr 9:49,251,633...49,319,477
Ensembl chr 9:49,251,927...49,319,477
JBrowse link
G Egfr epidermal growth factor receptor increases activity ISO Melitten results in increased activity of EGFR protein CTD PMID:22613720 NCBI chr11:16,700,153...16,868,158
Ensembl chr11:16,702,203...16,868,158
JBrowse link
G Fas Fas (TNF receptor superfamily member 6) increases expression ISO Melitten results in increased expression of FAS mRNA; Melitten results in increased expression of FAS protein CTD PMID:16974113 PMID:17854560 NCBI chr19:34,267,926...34,305,175
Ensembl chr19:34,268,066...34,305,172
JBrowse link
G Fgf2 fibroblast growth factor 2 decreases expression ISO Melitten results in decreased expression of FGF2 mRNA CTD PMID:18076793 NCBI chr 3:37,402,616...37,464,255
Ensembl chr 3:37,402,495...37,464,257
JBrowse link
G Fn1 fibronectin 1 multiple interactions EXP Melitten inhibits the reaction [Thioacetamide results in increased expression of FN1 protein] CTD PMID:21969711 NCBI chr 1:71,624,632...71,692,439
Ensembl chr 1:71,624,679...71,692,359
JBrowse link
G Gap43 growth associated protein 43 increases phosphorylation EXP Melitten results in increased phosphorylation of GAP43 protein CTD PMID:9852580 NCBI chr16:42,068,915...42,161,014
Ensembl chr16:42,068,805...42,161,014
JBrowse link
G Gli1 GLI-Kruppel family member GLI1 decreases expression ISO Melitten results in decreased expression of GLI1 protein CTD PMID:26189965 NCBI chr10:127,165,751...127,177,448
Ensembl chr10:127,165,751...127,177,843
JBrowse link
G Gnrh1 gonadotropin releasing hormone 1 multiple interactions ISO GNRH1 protein results in increased susceptibility to [Melitten binds to CGB3 protein] CTD PMID:19261682 NCBI chr14:67,982,630...67,986,885
Ensembl chr14:67,982,630...67,986,888
JBrowse link
G H19 H19, imprinted maternally expressed transcript decreases expression ISO Melitten results in decreased expression of H19 mRNA CTD PMID:34375656 NCBI chr 7:142,129,267...142,131,883
Ensembl chr 7:142,129,262...142,131,886
JBrowse link
G Hrh2 histamine receptor H2 increases response to substance
increases activity
multiple interactions
ISO HRH2 protein results in increased susceptibility to Melitten
Melitten results in increased activity of HRH2 protein
Ranitidine inhibits the reaction [Melitten results in increased activity of HRH2 protein]
CTD PMID:22995146 NCBI chr13:54,345,990...54,390,201
Ensembl chr13:54,346,148...54,390,199
JBrowse link
G Htr1a 5-hydroxytryptamine (serotonin) receptor 1A multiple interactions ISO Melitten inhibits the reaction [HTR1A protein inhibits the reaction [Colforsin results in increased abundance of Cyclic AMP]] CTD PMID:11356925 NCBI chr13:105,580,201...105,584,641
Ensembl chr13:105,580,147...105,584,630
JBrowse link
G Icam1 intercellular adhesion molecule 1 decreases expression ISO Melitten results in decreased expression of ICAM1 protein CTD PMID:12697458 NCBI chr 9:20,927,236...20,940,110
Ensembl chr 9:20,927,281...20,940,113
JBrowse link
G Ikbkb inhibitor of kappaB kinase beta multiple interactions
affects binding
ISO
EXP
Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]
Melitten binds to IKBKB protein
Dithiothreitol inhibits the reaction [Melitten binds to and results in decreased activity of IKBKB protein]; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Glutathione inhibits the reaction [Melitten binds to and results in decreased activity of IKBKB protein]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Hydrogen Peroxide inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased activity of IKBKB protein]; Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]; Melitten inhibits the reaction [TNF protein results in increased activity of IKBKB protein]
CTD PMID:17067557 NCBI chr 8:23,149,221...23,196,605
Ensembl chr 8:23,149,228...23,196,605
JBrowse link
G Il18 interleukin 18 increases expression
multiple interactions
ISO Melitten results in increased expression of IL18 protein
AIM2 protein promotes the reaction [Melitten results in increased expression of IL18 protein]
CTD PMID:22973906 NCBI chr 9:50,466,000...50,493,141
Ensembl chr 9:50,466,127...50,493,140
JBrowse link
G Il1b interleukin 1 beta multiple interactions
increases expression
ISO
EXP
AIM2 protein promotes the reaction [Melitten results in increased expression of IL1B protein]
Melitten inhibits the reaction [TNF protein results in increased expression of IL1B protein]
Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of IL1B mRNA]
CTD PMID:17570326 PMID:21969711 PMID:22973906 NCBI chr 2:129,206,490...129,213,059
Ensembl chr 2:129,206,490...129,213,059
JBrowse link
G Il6 interleukin 6 multiple interactions ISO
EXP
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of IL6STP1 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]; Melitten inhibits the reaction [TNF protein results in increased expression of IL6 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein]
Melitten inhibits the reaction [Acetic Acid results in increased expression of IL6 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 mRNA]; Melitten inhibits the reaction [Thioacetamide results in increased expression of IL6 protein]
CTD PMID:17570326 PMID:21354845 PMID:21969711 PMID:33002459 NCBI chr 5:30,218,112...30,224,973
Ensembl chr 5:30,218,112...30,224,979
JBrowse link
G Il6ra interleukin 6 receptor, alpha multiple interactions ISO Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of IL6STP1 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein] CTD PMID:21354845 NCBI chr 3:89,776,631...89,820,503
Ensembl chr 3:89,771,366...89,820,503
JBrowse link
G Jak2 Janus kinase 2 decreases phosphorylation ISO Melitten results in decreased phosphorylation of JAK2 protein CTD PMID:22027265 NCBI chr19:29,229,006...29,290,495
Ensembl chr19:29,229,228...29,290,480
JBrowse link
G Jun jun proto-oncogene multiple interactions ISO Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased localization of JUN protein] CTD PMID:20082219 NCBI chr 4:94,937,273...94,940,459
Ensembl chr 4:94,937,271...94,940,459
JBrowse link
G Kdr kinase insert domain protein receptor decreases expression ISO Melitten results in decreased expression of KDR protein CTD PMID:23110475 NCBI chr 5:76,093,487...76,139,885
Ensembl chr 5:76,093,487...76,139,118
JBrowse link
G Lhcgr luteinizing hormone/choriogonadotropin receptor multiple interactions ISO LHCGR protein results in increased susceptibility to [Melitten binds to CGB3 protein] CTD PMID:19261682 NCBI chr17:89,023,812...89,099,487
Ensembl chr17:89,023,909...89,099,418
JBrowse link
G Malat1 metastasis associated lung adenocarcinoma transcript 1 (non-coding RNA) affects expression ISO Melitten affects the expression of MALAT1 mRNA CTD PMID:34375656 NCBI chr19:5,845,718...5,852,700
Ensembl chr19:5,845,717...5,852,704
JBrowse link
G Mapk1 mitogen-activated protein kinase 1 decreases phosphorylation
increases phosphorylation
multiple interactions
ISO
EXP
Melitten results in decreased phosphorylation of MAPK1 protein
Melitten results in increased phosphorylation of MAPK1 protein
Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of MAPK1 protein]
Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of and results in increased activity of MAPK1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK1 protein]; Melitten results in increased phosphorylation of and results in increased activity of MAPK1 protein
CTD PMID:17570326 PMID:17579088 PMID:17654254 PMID:20082219 PMID:22613720 More... NCBI chr16:16,801,246...16,865,317
Ensembl chr16:16,801,246...16,865,317
JBrowse link
G Mapk3 mitogen-activated protein kinase 3 multiple interactions
decreases phosphorylation
increases phosphorylation
ISO
EXP
Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of and results in increased activity of MAPK3 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK3 protein]; Melitten results in increased phosphorylation of and results in increased activity of MAPK3 protein
Melitten results in decreased phosphorylation of MAPK3 protein
Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of MAPK3 protein]
Melitten results in increased phosphorylation of MAPK3 protein
CTD PMID:17570326 PMID:17579088 PMID:17654254 PMID:20082219 PMID:22613720 More... NCBI chr 7:126,358,798...126,364,988
Ensembl chr 7:126,358,773...126,364,991
JBrowse link
G Mecp2 methyl CpG binding protein 2 decreases expression ISO Melitten results in decreased expression of MECP2 mRNA; Melitten results in decreased expression of MECP2 protein CTD PMID:26189965 NCBI chr  X:73,070,198...73,129,296
Ensembl chr  X:73,070,198...73,178,969
JBrowse link
G Mmp2 matrix metallopeptidase 2 multiple interactions ISO Melitten inhibits the reaction [TNF protein results in increased secretion of MMP2 protein] CTD PMID:22926441 NCBI chr 8:93,553,920...93,580,049
Ensembl chr 8:93,553,919...93,580,048
JBrowse link
G Mmp3 matrix metallopeptidase 3 multiple interactions ISO Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of MMP3 protein] CTD PMID:17303203 NCBI chr 9:7,445,822...7,455,975
Ensembl chr 9:7,445,822...7,455,975
JBrowse link
G Mmp9 matrix metallopeptidase 9 multiple interactions ISO Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of and results in increased activity of MMP9 protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of and results in increased secretion of MMP9 protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP9 protein] CTD PMID:19969058 PMID:20082219 PMID:22926441 NCBI chr 2:164,782,246...164,797,770
Ensembl chr 2:164,782,700...164,797,770
JBrowse link
G Nfkb1 nuclear factor of kappa light polypeptide gene enhancer in B cells 1, p105 multiple interactions
decreases localization
ISO
EXP
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of and results in increased activity of NFKB1 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of NFKB1 protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of NFKB1 protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of NFKB1 protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of NFKB1 protein]]
Melitten results in decreased localization of NFKB1 protein
CTD PMID:15529353 PMID:17067557 PMID:18507870 PMID:21456063 NCBI chr 3:135,290,416...135,397,728
Ensembl chr 3:135,290,416...135,397,308
JBrowse link
G Nfkbia nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, alpha multiple interactions ISO
EXP
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]
CTD PMID:15529353 PMID:17067557 PMID:17570326 PMID:18507870 PMID:22926441 NCBI chr12:55,536,194...55,539,432
Ensembl chr12:55,536,195...55,539,432
JBrowse link
G Nos1 nitric oxide synthase 1, neuronal decreases activity ISO Melitten results in decreased activity of NOS1 protein CTD PMID:17098364 NCBI chr 5:118,004,904...118,096,905
Ensembl chr 5:117,919,097...118,096,905
JBrowse link
G Nos2 nitric oxide synthase 2, inducible multiple interactions
decreases expression
EXP
ISO
Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[TNF protein results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of NOS2 mRNA]
Melitten results in decreased expression of NOS2 protein
CTD PMID:15529353 PMID:17067557 PMID:17570326 PMID:21456063 NCBI chr11:78,811,613...78,851,052
Ensembl chr11:78,811,613...78,851,080
JBrowse link
G P2rx7 purinergic receptor P2X, ligand-gated ion channel, 7 increases activity
increases response to substance
ISO Melitten results in increased activity of P2RX7 protein
P2RX7 protein results in increased susceptibility to Melitten
CTD PMID:22613720 NCBI chr 5:122,781,990...122,830,399
Ensembl chr 5:122,781,974...122,829,495
JBrowse link
G Parp1 poly (ADP-ribose) polymerase family, member 1 multiple interactions EXP Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of PARP1 protein] CTD PMID:21871910 NCBI chr 1:180,396,456...180,428,564
Ensembl chr 1:180,396,489...180,428,819
JBrowse link
G Pdgfrb platelet derived growth factor receptor, beta polypeptide multiple interactions ISO Melitten results in decreased phosphorylation of and results in decreased activity of PDGFRB protein CTD PMID:17654254 NCBI chr18:61,178,194...61,218,139
Ensembl chr18:61,178,222...61,218,133
JBrowse link
G Pla2g2a phospholipase A2, group IIA (platelets, synovial fluid) multiple interactions EXP Melitten inhibits the reaction [Acetic Acid results in increased expression of PLA2G2A protein] CTD PMID:33002459 NCBI chr 4:138,559,168...138,562,500
Ensembl chr 4:138,559,171...138,562,497
JBrowse link
G Pla2g4a phospholipase A2, group IVA (cytosolic, calcium-dependent) decreases expression ISO Melitten results in decreased expression of PLA2G4A protein CTD PMID:21456063 NCBI chr 1:149,705,369...149,837,041
Ensembl chr 1:149,705,369...149,837,041
JBrowse link
G Plcg1 phospholipase C, gamma 1 decreases phosphorylation ISO Melitten results in decreased phosphorylation of PLCG1 protein CTD PMID:17654254 NCBI chr 2:160,573,230...160,617,680
Ensembl chr 2:160,573,220...160,617,680
JBrowse link
G Ptch1 patched 1 increases expression ISO Melitten results in increased expression of PTCH1 protein CTD PMID:26189965 NCBI chr13:63,656,142...63,721,274
Ensembl chr13:63,656,142...63,721,412
JBrowse link
G Ptgs2 prostaglandin-endoperoxide synthase 2 multiple interactions
increases expression
decreases expression
ISO
EXP
[Melitten results in decreased expression of PTGS2 protein] which results in decreased chemical synthesis of Dinoprostone; Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; SB 203580 inhibits the reaction [Melitten results in decreased expression of PTGS2 protein]
Melitten results in increased expression of PTGS2 mRNA; Melitten results in increased expression of PTGS2 protein
[Melitten results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone; Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[TNF protein results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [Acetic Acid results in increased expression of PTGS2 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of PTGS2 mRNA]
CTD PMID:11094054 PMID:11821123 PMID:15529353 PMID:17067557 PMID:17570326 More... NCBI chr 1:149,975,782...149,983,985
Ensembl chr 1:149,975,782...149,983,978
JBrowse link
G Rab11a RAB11A, member RAS oncogene family multiple interactions ISO Melitten results in decreased localization of [RAB11A protein co-treated with RAB5A protein] CTD PMID:22683840 NCBI chr 9:64,622,582...64,645,038
Ensembl chr 9:64,622,581...64,645,040
JBrowse link
G Rab5a RAB5A, member RAS oncogene family multiple interactions ISO Melitten results in decreased localization of [RAB11A protein co-treated with RAB5A protein]; Melitten results in increased localization of [SLC6A3 protein co-treated with RAB5A protein] CTD PMID:22683840 NCBI chr17:53,786,262...53,814,706
Ensembl chr17:53,786,262...53,814,708
JBrowse link
G Rac1 Rac family small GTPase 1 decreases activity ISO Melitten results in decreased activity of RAC1 protein CTD PMID:18506888 NCBI chr 5:143,491,236...143,513,786
Ensembl chr 5:143,489,389...143,513,791
JBrowse link
G Rela v-rel reticuloendotheliosis viral oncogene homolog A (avian) multiple interactions
decreases localization
ISO
EXP
Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased localization of RELA protein]; Melitten inhibits the reaction [TNF protein affects the localization of RELA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]]
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]
Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]]
Melitten results in decreased localization of RELA protein
CTD PMID:17570326 PMID:18507870 PMID:20082219 PMID:21354845 PMID:21456063 More... NCBI chr19:5,687,569...5,698,162
Ensembl chr19:5,687,511...5,698,158
JBrowse link
G Scn10a sodium channel, voltage-gated, type X, alpha increases expression
multiple interactions
ISO Melitten results in increased expression of SCN10A mRNA; Melitten results in increased expression of SCN10A protein
[Melitten results in increased expression of SCN10A protein] which results in increased transport of Sodium
CTD PMID:23264124 NCBI chr 9:119,437,522...119,548,388
Ensembl chr 9:119,437,522...119,548,388
JBrowse link
G Scn11a sodium channel, voltage-gated, type XI, alpha increases expression
multiple interactions
increases response to substance
ISO Melitten results in increased expression of SCN11A mRNA; Melitten results in increased expression of SCN11A protein
[Melitten results in increased expression of SCN11A protein] which results in increased transport of Sodium
SCN11A protein results in increased susceptibility to Melitten
CTD PMID:23264124 NCBI chr 9:119,582,829...119,654,522
Ensembl chr 9:119,582,825...119,654,522
JBrowse link
G Shh sonic hedgehog decreases expression ISO Melitten results in decreased expression of SHH protein CTD PMID:26189965 NCBI chr 5:28,661,838...28,672,099
Ensembl chr 5:28,661,813...28,672,254
JBrowse link
G Slc6a3 solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 increases localization
multiple interactions
ISO Melitten results in increased localization of SLC6A3 protein
Cocaine inhibits the reaction [Melitten results in increased localization of SLC6A3 protein]; Melitten inhibits the reaction [2beta-carbomethoxy-3beta-(4-iodophenyl)tropane binds to SLC6A3 protein]; Melitten inhibits the reaction [SLC6A3 protein results in increased uptake of Dopamine]; Melitten results in increased localization of [SLC6A3 protein co-treated with RAB5A protein]
CTD PMID:20969853 PMID:22683840 NCBI chr13:73,684,270...73,726,791
Ensembl chr13:73,684,866...73,726,791
JBrowse link
G Stat3 signal transducer and activator of transcription 3 decreases phosphorylation
multiple interactions
ISO Melitten results in decreased phosphorylation of STAT3 protein
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]
TNFRSF10A protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]; TNFRSF21 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]; TNFRSF25 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
CTD PMID:21354845 PMID:22027265 NCBI chr11:100,777,632...100,830,447
Ensembl chr11:100,775,924...100,830,366
JBrowse link
G Tbxa2r thromboxane A2 receptor increases response to substance ISO TBXA2R protein results in increased susceptibility to Melitten CTD PMID:16524625 NCBI chr10:81,164,102...81,171,008
Ensembl chr10:81,164,565...81,171,006
JBrowse link
G Tgfa transforming growth factor alpha increases secretion ISO Melitten results in increased secretion of TGFA protein CTD PMID:22613720 NCBI chr 6:86,172,020...86,252,726
Ensembl chr 6:86,172,205...86,252,701
JBrowse link
G Tgfb1 transforming growth factor, beta 1 multiple interactions
decreases activity
EXP Melitten affects the reaction [TGFB1 protein affects the localization of APAF1 protein]; Melitten affects the reaction [TGFB1 protein affects the localization of BAX protein]; Melitten affects the reaction [TGFB1 protein affects the localization of BCL2 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP3 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP9 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of PARP1 protein]; Melitten inhibits the reaction [Thioacetamide results in increased expression of TGFB1 protein]
Melitten results in decreased activity of TGFB1 protein
CTD PMID:21871910 PMID:21969711 NCBI chr 7:25,386,406...25,404,503
Ensembl chr 7:25,386,427...25,404,502
JBrowse link
G Tlr4 toll-like receptor 4 multiple interactions EXP Melitten inhibits the reaction [Acetic Acid results in increased expression of TLR4 protein] CTD PMID:33002459 NCBI chr 4:66,745,788...66,765,338
Ensembl chr 4:66,745,821...66,848,521
JBrowse link
G Tnf tumor necrosis factor multiple interactions
decreases secretion
increases expression
ISO
EXP
Melitten inhibits the reaction [TNF protein affects the localization of RELA protein]; Melitten inhibits the reaction [TNF protein results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of AKT1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK3 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP2 protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP9 protein]
Melitten results in decreased secretion of TNF protein
Melitten inhibits the reaction [TNF protein results in increased expression of IL1B protein]; Melitten inhibits the reaction [TNF protein results in increased expression of IL6 protein]
Melitten results in increased expression of TNF mRNA
Melitten inhibits the reaction [[TNF protein results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[TNF protein results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [Acetic Acid results in increased expression of TNF protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of TNF mRNA]; Melitten inhibits the reaction [Thioacetamide results in increased expression of TNF protein]; Melitten inhibits the reaction [TNF protein results in increased activity of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased activity of IKBKB protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]
CTD PMID:11094054 PMID:11821123 PMID:17067557 PMID:17570326 PMID:21969711 More... NCBI chr17:35,418,343...35,420,983
Ensembl chr17:35,418,357...35,420,983
JBrowse link
G Tnfrsf10b tumor necrosis factor receptor superfamily, member 10b multiple interactions
increases expression
affects response to substance
ISO TNFRSF10A protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
Melitten results in increased expression of TNFRSF10A mRNA
TNFRSF10A protein affects the susceptibility to Melitten
CTD PMID:22027265 NCBI chr14:70,004,921...70,021,860
Ensembl chr14:70,004,921...70,021,860
JBrowse link
G Tnfrsf21 tumor necrosis factor receptor superfamily, member 21 increases expression
affects response to substance
multiple interactions
ISO Melitten results in increased expression of TNFRSF21 mRNA
TNFRSF21 protein affects the susceptibility to Melitten
TNFRSF21 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
CTD PMID:22027265 NCBI chr17:43,327,446...43,400,079
Ensembl chr17:43,327,446...43,400,080
JBrowse link
G Tnfrsf25 tumor necrosis factor receptor superfamily, member 25 increases expression
multiple interactions
affects response to substance
ISO Melitten results in increased expression of TNFRSF25 mRNA
TNFRSF25 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
TNFRSF25 protein affects the susceptibility to Melitten
CTD PMID:22027265 NCBI chr 4:152,199,985...152,204,576
Ensembl chr 4:152,200,391...152,204,576
JBrowse link
G Traf6 TNF receptor-associated factor 6 multiple interactions EXP Melitten inhibits the reaction [Acetic Acid results in increased expression of TRAF6 protein] CTD PMID:33002459 NCBI chr 2:101,508,765...101,532,013
Ensembl chr 2:101,508,774...101,532,014
JBrowse link
G Trpv1 transient receptor potential cation channel, subfamily V, member 1 multiple interactions
increases response to substance
increases activity
ISO [Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium; capsazepine inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; capsazepine inhibits the reaction [TRPV1 protein results in increased susceptibility to Melitten]; Indomethacin inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; Masoprocol inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium] CTD PMID:16446039 PMID:21453681 NCBI chr11:73,124,975...73,152,148
Ensembl chr11:73,125,118...73,152,068
JBrowse link
G Vcam1 vascular cell adhesion molecule 1 multiple interactions EXP Melitten inhibits the reaction [Thioacetamide results in increased expression of VCAM1 protein] CTD PMID:21969711 NCBI chr 3:115,903,669...115,923,337
Ensembl chr 3:115,903,598...115,923,337
JBrowse link
G Vdac1 voltage-dependent anion channel 1 increases expression ISO Melitten results in increased expression of VDAC1 protein CTD PMID:34375656 NCBI chr11:52,251,678...52,280,224
Ensembl chr11:52,251,687...52,280,224
JBrowse link
G Vegfa vascular endothelial growth factor A multiple interactions
decreases expression
ISO SB 203580 inhibits the reaction [Melitten results in decreased expression of VEGFA protein]
Melitten results in decreased expression of VEGFA mRNA; Melitten results in decreased expression of VEGFA protein
CTD PMID:18076793 PMID:23110475 NCBI chr17:46,327,919...46,343,303
Ensembl chr17:46,327,919...46,343,295
JBrowse link
G Xiap X-linked inhibitor of apoptosis decreases expression ISO Melitten results in decreased expression of XIAP protein CTD PMID:21456063 NCBI chr  X:41,148,483...41,198,541
Ensembl chr  X:41,148,556...41,198,533
JBrowse link
G Xist inactive X specific transcripts increases expression ISO Melitten results in increased expression of XIST mRNA CTD PMID:34375656 NCBI chr  X:102,503,979...102,526,839
Ensembl chr  X:102,503,972...102,526,860
JBrowse link
Neurokinin A term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Tacr2 tachykinin receptor 2 affects binding ISO Neurokinin A binds to TACR2 protein CTD PMID:15925360 NCBI chr10:62,088,217...62,101,769
Ensembl chr10:62,088,217...62,101,769
JBrowse link
nociceptin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Oprl1 opioid receptor-like 1 affects binding
multiple interactions
EXP
ISO
nociceptin binds to OPRL1 protein
Endocannabinoids inhibits the reaction [nociceptin binds to and results in increased activity of OPRL1 protein]; nociceptin binds to and results in increased activity of OPRL1 protein
CTD PMID:20359694 PMID:21866885 PMID:30102254 NCBI chr 2:181,356,585...181,362,778
Ensembl chr 2:181,356,809...181,362,778
JBrowse link
omega-conotoxin GVIA term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Clu clusterin multiple interactions ISO omega-Conotoxin GVIA inhibits the reaction [methoxyacetic acid results in increased expression of and results in increased secretion of CLU protein] CTD PMID:14656996 NCBI chr14:66,205,932...66,218,997
Ensembl chr14:66,205,932...66,218,996
JBrowse link
G Fos FBJ osteosarcoma oncogene multiple interactions ISO [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] inhibits the reaction [Potassium Chloride affects the expression of FOS mRNA] CTD PMID:20211981 NCBI chr12:85,520,664...85,524,048
Ensembl chr12:85,520,664...85,524,047
JBrowse link
G Kcna1 potassium voltage-gated channel, shaker-related subfamily, member 1 multiple interactions ISO [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] promotes the reaction [Potassium Chloride results in increased expression of KCNA1 mRNA] CTD PMID:20211981 NCBI chr 6:126,613,426...126,622,764
Ensembl chr 6:126,617,360...126,623,347
JBrowse link
G Kcnc3 potassium voltage gated channel, Shaw-related subfamily, member 3 multiple interactions ISO [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] inhibits the reaction [Potassium Chloride results in increased expression of KCNC3 mRNA] CTD PMID:20211981 NCBI chr 7:44,236,405...44,254,175
Ensembl chr 7:44,240,088...44,254,178
JBrowse link
G Sct secretin multiple interactions ISO omega-Conotoxin GVIA inhibits the reaction [Potassium Chloride results in increased secretion of SCT protein] CTD PMID:16888165 NCBI chr 7:140,858,242...140,859,082
Ensembl chr 7:140,858,243...140,859,046
JBrowse link
G Snca synuclein, alpha multiple interactions ISO omega-Conotoxin GVIA inhibits the reaction [SNCA protein results in increased uptake of Calcium] CTD PMID:17179863 NCBI chr 6:60,708,557...60,806,839
Ensembl chr 6:60,708,559...60,806,839
JBrowse link
G Tac1 tachykinin 1 multiple interactions ISO omega-Conotoxin GVIA inhibits the reaction [Potassium results in increased secretion of TAC1 protein modified form] CTD PMID:2325850 NCBI chr 6:7,555,061...7,562,978
Ensembl chr 6:7,554,879...7,565,834
JBrowse link
oxidised LDL term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Map3k7 mitogen-activated protein kinase kinase kinase 7 multiple interactions
increases phosphorylation
ISO Albiflorin inhibits the reaction [oxidized LDL increases phosphorylation of MAP3K7 protein in umbilical vein endothelial cells]
Oxidized LDL increases phosphorylation of MAP3K7 protein in umbilical vein endothelial cells
RGD PMID:35601145 PMID:35601145 RGD:155804296, RGD:155804296 NCBI chr 4:31,963,659...32,023,470
Ensembl chr 4:31,964,097...32,023,467
JBrowse link
PR-39 term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Icam1 intercellular adhesion molecule 1 multiple interactions EXP PR 39 inhibits the reaction [TNF protein results in increased expression of ICAM1 protein] CTD PMID:12388057 NCBI chr 9:20,927,236...20,940,110
Ensembl chr 9:20,927,281...20,940,113
JBrowse link
G Sele selectin, endothelial cell multiple interactions EXP PR 39 inhibits the reaction [TNF protein results in increased expression of SELE protein] CTD PMID:12388057 NCBI chr 1:163,867,200...163,886,056
Ensembl chr 1:163,875,773...163,885,246
JBrowse link
G Tnf tumor necrosis factor multiple interactions EXP PR 39 inhibits the reaction [TNF protein results in increased expression of ICAM1 protein]; PR 39 inhibits the reaction [TNF protein results in increased expression of SELE protein]; PR 39 inhibits the reaction [TNF protein results in increased expression of VCAM1 protein] CTD PMID:12388057 NCBI chr17:35,418,343...35,420,983
Ensembl chr17:35,418,357...35,420,983
JBrowse link
G Vcam1 vascular cell adhesion molecule 1 multiple interactions EXP PR 39 inhibits the reaction [TNF protein results in increased expression of VCAM1 protein] CTD PMID:12388057 NCBI chr 3:115,903,669...115,923,337
Ensembl chr 3:115,903,598...115,923,337
JBrowse link
royal jelly term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Bcl2 B cell leukemia/lymphoma 2 multiple interactions EXP royal jelly inhibits the reaction [Nicotine results in decreased expression of BCL2 mRNA] CTD PMID:30896085 NCBI chr 1:106,465,906...106,642,020
Ensembl chr 1:106,465,908...106,642,004
JBrowse link
G Casp3 caspase 3 multiple interactions EXP royal jelly inhibits the reaction [Nicotine results in increased expression of CASP3 mRNA] CTD PMID:30896085 NCBI chr 8:47,070,326...47,092,733
Ensembl chr 8:47,070,326...47,092,724
JBrowse link
G Cat catalase multiple interactions ISO
EXP
royal jelly inhibits the reaction [Cisplatin results in decreased activity of CAT protein]
royal jelly inhibits the reaction [Nicotine results in decreased activity of CAT protein]
CTD PMID:20369241 PMID:30896085 NCBI chr 2:103,284,249...103,315,498
Ensembl chr 2:103,284,194...103,315,505
JBrowse link
G Ccnd1 cyclin D1 multiple interactions EXP royal jelly inhibits the reaction [phenylhydrazine affects the expression of CCND1 mRNA] CTD PMID:35099105 NCBI chr 7:144,483,668...144,493,568
Ensembl chr 7:144,483,668...144,493,662
JBrowse link
G Cyp4a14 cytochrome P450, family 4, subfamily a, polypeptide 14 affects expression EXP royal jelly affects the expression of CYP4A14 mRNA CTD PMID:16161764 NCBI chr 4:115,343,397...115,353,355
Ensembl chr 4:115,343,397...115,353,339
JBrowse link
G Esr1 estrogen receptor 1 (alpha) multiple interactions
affects binding
increases activity
ISO Estradiol inhibits the reaction [royal jelly binds to ESR1 protein]; royal jelly binds to and results in increased activity of ESR1 protein; royal jelly inhibits the reaction [Estradiol binds to ESR1 protein]
royal jelly results in increased activity of ESR1 protein
CTD PMID:15946813 PMID:17287592 NCBI chr10:4,561,989...4,955,633
Ensembl chr10:4,561,593...4,955,614
JBrowse link
G Esr2 estrogen receptor 2 (beta) multiple interactions
affects binding
ISO Estradiol inhibits the reaction [royal jelly binds to ESR2 protein]; royal jelly binds to and results in increased activity of ESR2 protein; royal jelly inhibits the reaction [Estradiol binds to ESR2 protein] CTD PMID:15946813 PMID:17287592 NCBI chr12:76,167,193...76,224,033
Ensembl chr12:76,167,193...76,224,033
JBrowse link
G Myc myelocytomatosis oncogene multiple interactions EXP royal jelly inhibits the reaction [phenylhydrazine results in decreased expression of MYC mRNA] CTD PMID:35099105 NCBI chr15:61,857,190...61,862,210
Ensembl chr15:61,857,240...61,862,223
JBrowse link
G Pcna proliferating cell nuclear antigen multiple interactions EXP royal jelly inhibits the reaction [Nicotine results in decreased expression of PCNA protein] CTD PMID:30896085 NCBI chr 2:132,091,206...132,095,100
Ensembl chr 2:132,091,082...132,095,234
JBrowse link
G Tff1 trefoil factor 1 increases expression ISO royal jelly results in increased expression of TFF1 mRNA CTD PMID:15946813 NCBI chr17:31,380,369...31,384,034
Ensembl chr17:31,380,369...31,384,251
JBrowse link
G Trp53 transformation related protein 53 multiple interactions EXP royal jelly inhibits the reaction [Nicotine results in increased expression of TRP53 mRNA] CTD PMID:30896085 NCBI chr11:69,471,174...69,482,699
Ensembl chr11:69,471,185...69,482,699
JBrowse link
G Vegfa vascular endothelial growth factor A increases expression ISO royal jelly results in increased expression of VEGFA mRNA CTD PMID:15946813 PMID:17287592 NCBI chr17:46,327,919...46,343,303
Ensembl chr17:46,327,919...46,343,295
JBrowse link

Term paths to the root
Path 1
Term Annotations click to browse term
  CHEBI ontology 22012
    chemical entity 22009
      molecular entity 22001
        polyatomic entity 21913
          macromolecule 5621
            polypeptide 209
              (12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
              (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
              (4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 0
              Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
              Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 0
              Arthrofactin 0
              CIGB-300 0
              DASKALRSSGMP 0
              DKATIGFEVQEE 0
              DSGEGDFLAEGGGVR 0
              ENPAVHFFKNIVTPRTP 0
              ENPVVAFFKNIVTPRTP 0
              ENPVVHFFFNIVTPRTP 0
              ENPVVHFFKNIVTPRTP 0
              ENPVVHFFYNIVTPRTP 0
              FPAWFTKLYPRT 0
              Gonadorelin hydrochloride 0
              GsMTx4 0
              IPQVWRDWFKLP 0
              JNK inhibitor I 0
              KGKGKGKGKGENPAVHFFKNIVTPRTP 0
              KGKGKGKGKGENPVVAFFKNIVTPRTP 0
              KGKGKGKGKGENPVVHFFFNIVTPRTP 0
              KGKGKGKGKGENPVVHFFKNIVTPRTP 0
              KGKGKGKGKGENPVVHFFYNIVTPRTP 0
              LSM-37009 0
              LSM-37015 0
              LSM-37045 0
              LSM-37094 0
              LSM-37129 0
              LSM-37138 0
              LSM-37175 0
              LSM-37192 0
              LSM-37213 0
              Mirabamide C 0
              Mirabamide G 0
              Mirabamide H 0
              N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 0
              N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
              Neurokinin A 1
              Neurokinin B 0
              P-factor 0
              QINTAKWWKTHF 0
              QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
              Rac1 Inhibitor W56 0
              STAT3 inhibitor peptide 0
              Streptomyces coelicolor calcium-dependent antibiotic CDA4b 0
              VSWKTWFPNLAV 0
              Vaby A 0
              Vaby B 0
              Vaby C 0
              Vaby D 0
              Vaby E 0
              Varv E 0
              WHWLQLKPGQPMY 0
              YIIKGLFWDPAC + 0
              YIIKGVFWDPAC + 0
              YSPFHKWFPSMH 0
              abarelix 0
              afamelanotide 1
              albiglutide 0
              amoxicilloyl polylysine 0
              amyloid-beta + 0
              astressin 13
              astressin 2B 6
              bacitracin A + 44
              benzylpenicilloyl polylysine 0
              beta-endorphin 10
              bivalirudin 8
              calcitonin 2
              calcitonin (human synthetic) 0
              calcitonin (pork natural) 0
              calpastatin peptide Ac 184-210 0
              carperitide 0
              cathelicidin + 4
              corticorelin 0
              corticotropin 11
              corticotropin-releasing hormone + 1
              cosyntropin 1
              cyanophycin macromolecule + 0
              defensin + 0
              degarelix 0
              dermaseptin s3(1-16)-NH2 0
              desirudin 0
              elcatonin 0
              elf18 0
              enfuvirtide 3
              exendin-3 0
              exendin-4 0
              ganirelix 1
              gastrin + 8
              ghrelin 3
              insulin + 3
              kisspeptin-54 0
              koshikamide A2 0
              lantibiotic + 0
              lepirudin 1
              liraglutide 28
              lixisenatide 0
              mastoparans + 5
              melittin 86
              nesiritide 0
              nociceptin 1
              omega-conotoxin GVIA 7
              p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 0
              penicilloyl polylysine 0
              peptide YY 0
              poly(glycyl-L-arginine) 0
              pramlintide 0
              protein polypeptide chain + 13
              secretin human 0
              semaglutide 0
              sermorelin 0
              teduglutide 0
              teriparatide 0
              terlipressin 0
              tesamorelin 0
              thymalfasin 0
              tirzepatide 0
Path 2
Term Annotations click to browse term
  CHEBI ontology 22012
    subatomic particle 22002
      composite particle 22002
        hadron 22002
          baryon 22002
            nucleon 22002
              atomic nucleus 22002
                atom 22002
                  main group element atom 21932
                    p-block element atom 21932
                      carbon group element atom 21746
                        carbon atom 21662
                          organic molecular entity 21662
                            organic group 20066
                              organic divalent group 20052
                                organodiyl group 20052
                                  carbonyl group 20045
                                    carbonyl compound 20045
                                      carboxylic acid 19415
                                        carboacyl group 18230
                                          univalent carboacyl group 18230
                                            carbamoyl group 18040
                                              carboxamide 18040
                                                peptide 9644
                                                  polypeptide 209
                                                    (12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
                                                    (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
                                                    (4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 0
                                                    Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
                                                    Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 0
                                                    Arthrofactin 0
                                                    CIGB-300 0
                                                    DASKALRSSGMP 0
                                                    DKATIGFEVQEE 0
                                                    DSGEGDFLAEGGGVR 0
                                                    ENPAVHFFKNIVTPRTP 0
                                                    ENPVVAFFKNIVTPRTP 0
                                                    ENPVVHFFFNIVTPRTP 0
                                                    ENPVVHFFKNIVTPRTP 0
                                                    ENPVVHFFYNIVTPRTP 0
                                                    FPAWFTKLYPRT 0
                                                    Gonadorelin hydrochloride 0
                                                    GsMTx4 0
                                                    IPQVWRDWFKLP 0
                                                    JNK inhibitor I 0
                                                    KGKGKGKGKGENPAVHFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVAFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFFNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFYNIVTPRTP 0
                                                    LSM-37009 0
                                                    LSM-37015 0
                                                    LSM-37045 0
                                                    LSM-37094 0
                                                    LSM-37129 0
                                                    LSM-37138 0
                                                    LSM-37175 0
                                                    LSM-37192 0
                                                    LSM-37213 0
                                                    Mirabamide C 0
                                                    Mirabamide G 0
                                                    Mirabamide H 0
                                                    N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 0
                                                    N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
                                                    Neurokinin A 1
                                                    Neurokinin B 0
                                                    P-factor 0
                                                    QINTAKWWKTHF 0
                                                    QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
                                                    Rac1 Inhibitor W56 0
                                                    STAT3 inhibitor peptide 0
                                                    Streptomyces coelicolor calcium-dependent antibiotic CDA4b 0
                                                    VSWKTWFPNLAV 0
                                                    Vaby A 0
                                                    Vaby B 0
                                                    Vaby C 0
                                                    Vaby D 0
                                                    Vaby E 0
                                                    Varv E 0
                                                    WHWLQLKPGQPMY 0
                                                    YIIKGLFWDPAC + 0
                                                    YIIKGVFWDPAC + 0
                                                    YSPFHKWFPSMH 0
                                                    abarelix 0
                                                    afamelanotide 1
                                                    albiglutide 0
                                                    amoxicilloyl polylysine 0
                                                    amyloid-beta + 0
                                                    astressin 13
                                                    astressin 2B 6
                                                    bacitracin A + 44
                                                    benzylpenicilloyl polylysine 0
                                                    beta-endorphin 10
                                                    bivalirudin 8
                                                    calcitonin 2
                                                    calcitonin (human synthetic) 0
                                                    calcitonin (pork natural) 0
                                                    calpastatin peptide Ac 184-210 0
                                                    carperitide 0
                                                    cathelicidin + 4
                                                    corticorelin 0
                                                    corticotropin 11
                                                    corticotropin-releasing hormone + 1
                                                    cosyntropin 1
                                                    cyanophycin macromolecule + 0
                                                    defensin + 0
                                                    degarelix 0
                                                    dermaseptin s3(1-16)-NH2 0
                                                    desirudin 0
                                                    elcatonin 0
                                                    elf18 0
                                                    enfuvirtide 3
                                                    exendin-3 0
                                                    exendin-4 0
                                                    ganirelix 1
                                                    gastrin + 8
                                                    ghrelin 3
                                                    insulin + 3
                                                    kisspeptin-54 0
                                                    koshikamide A2 0
                                                    lantibiotic + 0
                                                    lepirudin 1
                                                    liraglutide 28
                                                    lixisenatide 0
                                                    mastoparans + 5
                                                    melittin 86
                                                    nesiritide 0
                                                    nociceptin 1
                                                    omega-conotoxin GVIA 7
                                                    p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 0
                                                    penicilloyl polylysine 0
                                                    peptide YY 0
                                                    poly(glycyl-L-arginine) 0
                                                    pramlintide 0
                                                    protein polypeptide chain + 13
                                                    secretin human 0
                                                    semaglutide 0
                                                    sermorelin 0
                                                    teduglutide 0
                                                    teriparatide 0
                                                    terlipressin 0
                                                    tesamorelin 0
                                                    thymalfasin 0
                                                    tirzepatide 0
paths to the root