Send us a Message



 Submit Data |  Help |  Video Tutorials |  News |  Publications |  Download |  REST API |  Citing RGD |  Contact   
Search RGD Grant Resources Citing RGD About Us Contact Us
Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data
OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap)  (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer
Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease
Find Models   new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive
Pathways
Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources

CHEBI ONTOLOGY - ANNOTATIONS

The Chemical Entities of Biological Interest (ChEBI) ontology is downloaded weekly from EMBL-EBI at http://www.ebi.ac.uk/chebi/. The data is made available under the Creative Commons License (CC BY 3.0, http://creativecommons.org/licenses/by/3.0/). For more information see: Degtyarenko et al. (2008) ChEBI: a database and ontology for chemical entities of biological interest. Nucleic Acids Res. 36, D344–D350.
Term:polypeptide
go back to main search page
Accession:CHEBI:15841 term browser browse the term
Definition:A peptide containing ten or more amino acid residues.
Synonyms:exact_synonym: polypeptides
 related_synonym: Formula=C4H6N2O3R2(C2H2NOR)n;   Polypeptid;   polipeptido
 alt_id: CHEBI:14860;   CHEBI:8314
 xref: KEGG:C00403


show annotations for term's descendants           Sort by:
afamelanotide term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G MC4R melanocortin 4 receptor increases activity EXP MSH, 4-Nle-7-Phe-alpha- results in increased activity of MC4R protein CTD PMID:17713970 NCBI chr18:60,371,062...60,372,775
Ensembl chr18:60,371,062...60,372,775 		JBrowse link
astressin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G AGT angiotensinogen multiple interactions ISO [astressin co-treated with AGT protein] results in increased phosphorylation of FOS protein; [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK1 protein; [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK3 protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of CRH protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of FOS protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK1 protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK3 protein]; astressin promotes the reaction [AGT protein results in increased expression of CRH protein] CTD PMID:33872574 NCBI chr 1:230,702,523...230,745,583
Ensembl chr 1:230,690,776...230,745,576 		JBrowse link
G CRH corticotropin releasing hormone multiple interactions ISO [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of CRH protein]; astressin promotes the reaction [AGT protein results in increased expression of CRH protein] CTD PMID:33872574 NCBI chr 8:66,176,376...66,178,464
Ensembl chr 8:66,176,376...66,178,464 		JBrowse link
G CRHR1 corticotropin releasing hormone receptor 1 multiple interactions EXP astressin binds to and results in decreased activity of CRHR1 protein CTD PMID:16014403 NCBI chr17:45,784,320...45,835,828
Ensembl chr17:45,784,277...45,835,828 		JBrowse link
G CRHR2 corticotropin releasing hormone receptor 2 multiple interactions EXP astressin binds to and results in decreased activity of CRHR2 protein CTD PMID:16014403 NCBI chr 7:30,651,942...30,700,103
Ensembl chr 7:30,651,942...30,700,129 		JBrowse link
G CYP11A1 cytochrome P450 family 11 subfamily A member 1 decreases expression EXP astressin results in decreased expression of CYP11A1 mRNA CTD PMID:16014403 NCBI chr15:74,337,762...74,367,646
Ensembl chr15:74,337,759...74,367,646 		JBrowse link
G CYP17A1 cytochrome P450 family 17 subfamily A member 1 decreases expression EXP astressin results in decreased expression of CYP17A1 mRNA CTD PMID:16014403 NCBI chr10:102,830,531...102,837,413
Ensembl chr10:102,830,531...102,837,472 		JBrowse link
G FOS Fos proto-oncogene, AP-1 transcription factor subunit multiple interactions ISO [astressin co-treated with AGT protein] results in increased phosphorylation of FOS protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of FOS protein] CTD PMID:33872574 NCBI chr14:75,278,828...75,282,230
Ensembl chr14:75,278,826...75,282,230 		JBrowse link
G IL1RN interleukin 1 receptor antagonist multiple interactions ISO [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of CRH protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of FOS protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK1 protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK3 protein] CTD PMID:33872574 NCBI chr 2:113,099,360...113,134,014
Ensembl chr 2:113,099,315...113,134,016 		JBrowse link
G MAPK1 mitogen-activated protein kinase 1 multiple interactions ISO [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK1 protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK1 protein] CTD PMID:33872574 NCBI chr22:21,759,657...21,867,680
Ensembl chr22:21,759,657...21,867,680 		JBrowse link
G MAPK3 mitogen-activated protein kinase 3 multiple interactions ISO [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK3 protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK3 protein] CTD PMID:33872574 NCBI chr16:30,114,105...30,123,220
Ensembl chr16:30,114,105...30,123,506 		JBrowse link
G STAR steroidogenic acute regulatory protein decreases expression EXP astressin results in decreased expression of STAR mRNA CTD PMID:16014403 NCBI chr 8:38,142,700...38,150,952
Ensembl chr 8:38,142,700...38,150,992 		JBrowse link
G SULT2A1 sulfotransferase family 2A member 1 decreases expression EXP astressin results in decreased expression of SULT2A1 mRNA CTD PMID:16014403 NCBI chr19:47,870,467...47,886,315
Ensembl chr19:47,870,467...47,886,315 		JBrowse link
G UCN urocortin multiple interactions
decreases response to substance		 ISO astressin inhibits the reaction [UCN protein inhibits the reaction [Thapsigargin results in increased uptake of Calcium]]; astressin inhibits the reaction [UCN protein inhibits the reaction [Thapsigargin results in increased uptake of Manganese]]
astressin results in decreased susceptibility to UCN protein		 CTD PMID:17885217 PMID:20237592 NCBI chr 2:27,307,400...27,308,445
Ensembl chr 2:27,307,400...27,308,445 		JBrowse link
astressin 2B term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G CCL2 C-C motif chemokine ligand 2 multiple interactions ISO astressin-2B inhibits the reaction [tcdA protein, Clostridium difficile results in increased expression of CCL2 mRNA] CTD PMID:16920976 NCBI chr17:34,255,285...34,257,203
Ensembl chr17:34,255,274...34,257,208 		JBrowse link
G CXCL1 C-X-C motif chemokine ligand 1 multiple interactions ISO astressin-2B inhibits the reaction [tcdA protein, Clostridium difficile results in increased expression of CXCL1 mRNA] CTD PMID:16920976 NCBI chr 4:73,869,393...73,871,308
Ensembl chr 4:73,869,393...73,871,308 		JBrowse link
G IL6 interleukin 6 multiple interactions ISO astressin-2B promotes the reaction [Lipopolysaccharides results in increased secretion of IL6 protein] CTD PMID:12746300 NCBI chr 7:22,727,200...22,731,998
Ensembl chr 7:22,725,884...22,732,002 		JBrowse link
G POMC proopiomelanocortin increases secretion ISO astressin-2B results in increased secretion of POMC protein alternative form CTD PMID:12746300 NCBI chr 2:25,160,860...25,168,580
Ensembl chr 2:25,160,853...25,168,903 		JBrowse link
G TNF tumor necrosis factor multiple interactions ISO astressin-2B promotes the reaction [Lipopolysaccharides results in increased secretion of TNF protein] CTD PMID:12746300 NCBI chr 6:31,575,565...31,578,336
Ensembl chr 6:31,575,565...31,578,336 		JBrowse link
G UCN urocortin decreases activity ISO astressin-2B results in decreased activity of UCN protein CTD PMID:12010772 NCBI chr 2:27,307,400...27,308,445
Ensembl chr 2:27,307,400...27,308,445 		JBrowse link
bacitracin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G A2M alpha-2-macroglobulin increases expression ISO Bacitracin results in increased expression of A2M mRNA CTD PMID:18289764 NCBI chr12:9,067,708...9,116,229
Ensembl chr12:9,067,664...9,116,229 		JBrowse link
G ACHE acetylcholinesterase (Cartwright blood group) multiple interactions ISO Bacitracin binds to and results in decreased metabolism of and results in decreased secretion of ACHE protein CTD PMID:23047022 NCBI chr 7:100,889,994...100,896,994
Ensembl chr 7:100,889,994...100,896,974 		JBrowse link
G ALDH1A1 aldehyde dehydrogenase 1 family member A1 increases expression ISO Bacitracin results in increased expression of ALDH1A1 mRNA CTD PMID:18289764 NCBI chr 9:72,900,671...72,953,053
Ensembl chr 9:72,900,671...73,080,442 		JBrowse link
G ANXA5 annexin A5 increases expression ISO Bacitracin results in increased expression of ANXA5 mRNA CTD PMID:18289764 NCBI chr 4:121,667,946...121,696,980
Ensembl chr 4:121,667,946...121,696,995 		JBrowse link
G BMP1 bone morphogenetic protein 1 increases expression ISO Bacitracin results in increased expression of BMP1 mRNA CTD PMID:18289764 NCBI chr 8:22,165,372...22,212,326
Ensembl chr 8:22,165,140...22,212,326 		JBrowse link
G BMP4 bone morphogenetic protein 4 decreases expression ISO Bacitracin results in decreased expression of BMP4 mRNA CTD PMID:18289764 NCBI chr14:53,949,736...53,956,891
Ensembl chr14:53,949,736...53,958,761 		JBrowse link
G CALB1 calbindin 1 decreases expression ISO Bacitracin results in decreased expression of CALB1 mRNA CTD PMID:18289764 NCBI chr 8:90,058,608...90,082,879
Ensembl chr 8:90,058,608...90,095,475 		JBrowse link
G CAT catalase decreases expression ISO Bacitracin results in decreased expression of CAT mRNA CTD PMID:18289764 NCBI chr11:34,438,934...34,472,060
Ensembl chr11:34,438,934...34,472,060 		JBrowse link
G CCN1 cellular communication network factor 1 affects expression ISO Bacitracin affects the expression of CCN1 mRNA CTD PMID:18289764 NCBI chr 1:85,580,761...85,583,950
Ensembl chr 1:85,580,761...85,584,589 		JBrowse link
G CCND1 cyclin D1 increases expression ISO Bacitracin results in increased expression of CCND1 mRNA CTD PMID:18289764 NCBI chr11:69,641,156...69,654,474
Ensembl chr11:69,641,156...69,654,474 		JBrowse link
G CCNG1 cyclin G1 increases expression ISO Bacitracin results in increased expression of CCNG1 mRNA CTD PMID:18289764 NCBI chr 5:163,437,571...163,457,640
Ensembl chr 5:163,437,569...163,446,151 		JBrowse link
G CD24 CD24 molecule increases expression ISO Bacitracin results in increased expression of CD24 mRNA CTD PMID:18289764 NCBI chr 6:106,969,831...106,976,855
Ensembl chr 6:106,969,831...106,975,627 		JBrowse link
G CD44 CD44 molecule (Indian blood group) increases expression ISO Bacitracin results in increased expression of CD44 mRNA CTD PMID:18289764 NCBI chr11:35,139,171...35,232,402
Ensembl chr11:35,138,882...35,232,402 		JBrowse link
G CLU clusterin increases expression ISO Bacitracin results in increased expression of CLU mRNA CTD PMID:18289764 NCBI chr 8:27,596,917...27,614,700
Ensembl chr 8:27,596,917...27,614,700 		JBrowse link
G CP ceruloplasmin increases expression ISO Bacitracin results in increased expression of CP mRNA CTD PMID:18289764 NCBI chr 3:149,162,414...149,221,829
Ensembl chr 3:149,162,410...149,221,829 		JBrowse link
G CTSS cathepsin S increases expression ISO Bacitracin results in increased expression of CTSS mRNA CTD PMID:18289764 NCBI chr 1:150,730,188...150,765,778
Ensembl chr 1:150,730,079...150,765,957 		JBrowse link
G CYP2D6 cytochrome P450 family 2 subfamily D member 6 decreases expression ISO Bacitracin results in decreased expression of CYP2D22 mRNA CTD PMID:18289764 NCBI chr22:42,126,499...42,130,810
Ensembl chr22:42,126,499...42,130,865 		JBrowse link
G EGF epidermal growth factor decreases expression ISO Bacitracin results in decreased expression of EGF mRNA CTD PMID:18289764 NCBI chr 4:109,912,883...110,013,766
Ensembl chr 4:109,912,883...110,013,766 		JBrowse link
G FN1 fibronectin 1 increases expression ISO Bacitracin results in increased expression of FN1 mRNA CTD PMID:18289764 NCBI chr 2:215,360,865...215,436,068
Ensembl chr 2:215,360,440...215,436,073 		JBrowse link
G G6PC1 glucose-6-phosphatase catalytic subunit 1 decreases expression ISO Bacitracin results in decreased expression of G6PC1 mRNA CTD PMID:18289764 NCBI chr17:42,900,799...42,914,438
Ensembl chr17:42,900,797...42,914,438 		JBrowse link
G GADD45A growth arrest and DNA damage inducible alpha increases expression ISO Bacitracin results in increased expression of GADD45A mRNA CTD PMID:18289764 NCBI chr 1:67,685,201...67,688,334
Ensembl chr 1:67,685,201...67,688,334 		JBrowse link
G GHR growth hormone receptor affects expression ISO Bacitracin affects the expression of GHR mRNA CTD PMID:18289764 NCBI chr 5:42,423,439...42,721,878
Ensembl chr 5:42,423,439...42,721,878 		JBrowse link
G GLUL glutamate-ammonia ligase increases expression ISO Bacitracin results in increased expression of GLUL mRNA CTD PMID:18289764 NCBI chr 1:182,378,098...182,391,790
Ensembl chr 1:182,378,098...182,392,206 		JBrowse link
G GSTM2 glutathione S-transferase mu 2 increases expression ISO Bacitracin results in increased expression of GSTM2 mRNA CTD PMID:18289764 NCBI chr 1:109,668,057...109,683,997
Ensembl chr 1:109,668,022...109,709,551 		JBrowse link
G HAVCR1 hepatitis A virus cellular receptor 1 increases expression ISO Bacitracin results in increased expression of HAVCR1 mRNA CTD PMID:18289764 NCBI chr 5:157,029,413...157,069,407
Ensembl chr 5:157,026,742...157,069,396 		JBrowse link
G HMOX1 heme oxygenase 1 increases expression ISO Bacitracin results in increased expression of HMOX1 mRNA CTD PMID:18289764 NCBI chr22:35,381,096...35,394,207
Ensembl chr22:35,380,361...35,394,214 		JBrowse link
G HMOX2 heme oxygenase 2 increases expression ISO Bacitracin results in increased expression of HMOX2 mRNA CTD PMID:18289764 NCBI chr16:4,474,736...4,510,347
Ensembl chr16:4,474,690...4,510,347 		JBrowse link
G IGFBP1 insulin like growth factor binding protein 1 increases expression ISO Bacitracin results in increased expression of IGFBP1 mRNA CTD PMID:18289764 NCBI chr 7:45,888,488...45,893,660
Ensembl chr 7:45,888,360...45,893,660 		JBrowse link
G IGKC immunoglobulin kappa constant decreases expression
increases expression		 ISO Bacitracin results in decreased expression of IGKC mRNA
Bacitracin results in increased expression of IGKC mRNA		 CTD PMID:18289764 NCBI chr 2:88,857,361...88,857,683
Ensembl chr 2:88,857,161...88,857,683 		JBrowse link
G JUN Jun proto-oncogene, AP-1 transcription factor subunit increases expression ISO Bacitracin results in increased expression of JUN mRNA CTD PMID:18289764 NCBI chr 1:58,780,791...58,784,047
Ensembl chr 1:58,776,845...58,784,048 		JBrowse link
G LCN2 lipocalin 2 increases expression ISO Bacitracin results in increased expression of LCN2 mRNA CTD PMID:18289764 NCBI chr 9:128,149,453...128,153,453
Ensembl chr 9:128,149,071...128,153,453 		JBrowse link
G MGP matrix Gla protein increases expression ISO Bacitracin results in increased expression of MGP mRNA CTD PMID:18289764 NCBI chr12:14,880,864...14,885,854
Ensembl chr12:14,880,864...14,885,857 		JBrowse link
G MT1A metallothionein 1A increases expression ISO Bacitracin results in increased expression of MT1A mRNA CTD PMID:18289764 NCBI chr16:56,638,666...56,640,087
Ensembl chr16:56,638,666...56,640,087 		JBrowse link
G NPHS2 NPHS2 stomatin family member, podocin decreases expression ISO Bacitracin results in decreased expression of NPHS2 mRNA CTD PMID:18289764 NCBI chr 1:179,550,539...179,575,948
Ensembl chr 1:179,550,539...179,575,952 		JBrowse link
G OAT ornithine aminotransferase increases expression ISO Bacitracin results in increased expression of OAT mRNA CTD PMID:18289764 NCBI chr10:124,397,303...124,418,923
Ensembl chr10:124,397,303...124,418,976 		JBrowse link
G RGN regucalcin decreases expression ISO Bacitracin results in decreased expression of RGN mRNA CTD PMID:18289764 NCBI chr  X:47,078,443...47,093,313
Ensembl chr  X:47,078,355...47,093,314 		JBrowse link
G SLC22A1 solute carrier family 22 member 1 decreases expression ISO Bacitracin results in decreased expression of SLC22A1 mRNA CTD PMID:18289764 NCBI chr 6:160,121,815...160,158,718
Ensembl chr 6:160,121,815...160,158,718 		JBrowse link
G SLC22A6 solute carrier family 22 member 6 decreases expression ISO Bacitracin results in decreased expression of SLC22A6 mRNA CTD PMID:18289764 NCBI chr11:62,976,597...62,984,967
Ensembl chr11:62,936,385...62,984,967 		JBrowse link
G SPP1 secreted phosphoprotein 1 increases expression ISO Bacitracin results in increased expression of SPP1 mRNA CTD PMID:18289764 NCBI chr 4:87,975,714...87,983,411
Ensembl chr 4:87,975,667...87,983,532 		JBrowse link
G TIMP1 TIMP metallopeptidase inhibitor 1 increases expression ISO Bacitracin results in increased expression of TIMP1 mRNA CTD PMID:18289764 NCBI chr  X:47,582,436...47,586,789
Ensembl chr  X:47,582,408...47,586,789 		JBrowse link
G TMSB10 thymosin beta 10 increases expression ISO Bacitracin results in increased expression of TMSB10 mRNA CTD PMID:18289764 NCBI chr 2:84,905,656...84,906,671
Ensembl chr 2:84,905,656...84,906,671 		JBrowse link
G VCAM1 vascular cell adhesion molecule 1 increases expression ISO Bacitracin results in increased expression of VCAM1 mRNA CTD PMID:18289764 NCBI chr 1:100,719,742...100,739,045
Ensembl chr 1:100,719,742...100,739,045 		JBrowse link
G VEGFA vascular endothelial growth factor A decreases expression ISO Bacitracin results in decreased expression of VEGFA mRNA CTD PMID:18289764 NCBI chr 6:43,770,211...43,786,487
Ensembl chr 6:43,770,184...43,786,487 		JBrowse link
G VIM vimentin increases expression ISO Bacitracin results in increased expression of VIM mRNA CTD PMID:18289764 NCBI chr10:17,228,241...17,237,593
Ensembl chr10:17,228,241...17,237,593 		JBrowse link
beta-endorphin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G AGT angiotensinogen increases abundance
multiple interactions		 ISO AGT protein results in increased abundance of beta-Endorphin
IL1RN protein inhibits the reaction [AGT protein results in increased abundance of beta-Endorphin]		 CTD PMID:33872574 NCBI chr 1:230,702,523...230,745,583
Ensembl chr 1:230,690,776...230,745,576 		JBrowse link
G CRH corticotropin releasing hormone decreases secretion
increases secretion
multiple interactions		 ISO beta-Endorphin results in decreased secretion of CRH protein
CRF protein results in increased secretion of beta-Endorphin
adinazolam inhibits the reaction [CRF protein results in increased secretion of beta-Endorphin]; beta-Endorphin inhibits the reaction [Nitroprusside results in increased secretion of CRH protein]; Naltrexone inhibits the reaction [beta-Endorphin results in decreased secretion of CRH protein]		 CTD PMID:1480515 PMID:3031743 NCBI chr 8:66,176,376...66,178,464
Ensembl chr 8:66,176,376...66,178,464 		JBrowse link
G IL1RN interleukin 1 receptor antagonist multiple interactions ISO IL1RN protein inhibits the reaction [AGT protein results in increased abundance of beta-Endorphin] CTD PMID:33872574 NCBI chr 2:113,099,360...113,134,014
Ensembl chr 2:113,099,315...113,134,016 		JBrowse link
G IL2 interleukin 2 decreases expression EXP beta-Endorphin results in decreased expression of IL2 mRNA CTD PMID:23965172 NCBI chr 4:122,451,470...122,456,725
Ensembl chr 4:122,451,470...122,456,725 		JBrowse link
G IL4 interleukin 4 increases expression EXP beta-Endorphin results in increased expression of IL4 mRNA CTD PMID:23965172 NCBI chr 5:132,673,989...132,682,678
Ensembl chr 5:132,673,986...132,682,678 		JBrowse link
G MAPK1 mitogen-activated protein kinase 1 increases phosphorylation EXP beta-Endorphin results in increased phosphorylation of MAPK1 protein CTD PMID:23965172 NCBI chr22:21,759,657...21,867,680
Ensembl chr22:21,759,657...21,867,680 		JBrowse link
G MAPK3 mitogen-activated protein kinase 3 increases phosphorylation EXP beta-Endorphin results in increased phosphorylation of MAPK3 protein CTD PMID:23965172 NCBI chr16:30,114,105...30,123,220
Ensembl chr16:30,114,105...30,123,506 		JBrowse link
G NFKBIA NFKB inhibitor alpha increases expression EXP beta-Endorphin results in increased expression of NFKBIA protein CTD PMID:22258905 NCBI chr14:35,401,513...35,404,749
Ensembl chr14:35,401,079...35,404,749 		JBrowse link
G PLD2 phospholipase D2 increases activity EXP beta-Endorphin results in increased activity of PLD2 protein CTD PMID:23965172 NCBI chr17:4,807,152...4,823,430
Ensembl chr17:4,807,152...4,823,434 		JBrowse link
G USP15 ubiquitin specific peptidase 15 increases expression EXP beta-Endorphin results in increased expression of USP15 mRNA CTD PMID:24068670 NCBI chr12:62,260,404...62,416,389
Ensembl chr12:62,260,338...62,417,431 		JBrowse link
bivalirudin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G CRP C-reactive protein decreases expression EXP bivalirudin results in decreased expression of CRP protein CTD PMID:16118546 NCBI chr 1:159,712,289...159,714,589
Ensembl chr 1:159,712,289...159,714,589 		JBrowse link
G F2 coagulation factor II, thrombin multiple interactions
decreases activity
increases cleavage		 EXP bivalirudin binds to and results in decreased activity of F2 protein; bivalirudin inhibits the reaction [F2 protein results in increased expression of SELP protein]
bivalirudin results in decreased activity of F2 protein
F2 protein results in increased cleavage of bivalirudin		 CTD PMID:1290488 PMID:8456428 PMID:15080313 PMID:15155122 PMID:16084352 More... NCBI chr11:46,719,213...46,739,506
Ensembl chr11:46,719,196...46,739,506 		JBrowse link
G F2R coagulation factor II thrombin receptor decreases activity EXP bivalirudin results in decreased activity of F2R protein CTD PMID:19124943 NCBI chr 5:76,716,126...76,735,770
Ensembl chr 5:76,716,126...76,735,770 		JBrowse link
G F2RL3 F2R like thrombin or trypsin receptor 3 decreases activity EXP bivalirudin results in decreased activity of F2RL3 protein CTD PMID:19124943 NCBI chr19:16,888,999...16,892,606
Ensembl chr19:16,888,999...16,892,606 		JBrowse link
G MPO myeloperoxidase decreases expression EXP bivalirudin results in decreased expression of MPO protein CTD PMID:18701766 NCBI chr17:58,269,855...58,280,935
Ensembl chr17:58,269,855...58,280,935 		JBrowse link
G P2RY12 purinergic receptor P2Y12 affects response to substance ISO P2RY12 affects the susceptibility to bivalirudin CTD PMID:14597584 NCBI chr 3:151,336,843...151,384,753
Ensembl chr 3:151,336,843...151,384,753 		JBrowse link
G PDGFB platelet derived growth factor subunit B affects expression ISO bivalirudin affects the expression of PDGFB protein CTD PMID:10754393 PMID:11316950 NCBI chr22:39,223,359...39,244,982
Ensembl chr22:39,223,359...39,244,982 		JBrowse link
G SELP selectin P multiple interactions EXP bivalirudin inhibits the reaction [F2 protein results in increased expression of SELP protein] CTD PMID:16845256 NCBI chr 1:169,588,849...169,630,124
Ensembl chr 1:169,588,849...169,630,193 		JBrowse link
calcitonin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G HCRT hypocretin neuropeptide precursor decreases expression ISO salmon calcitonin results in decreased expression of HCRT mRNA CTD PMID:12686383 NCBI chr17:42,184,060...42,185,452
Ensembl chr17:42,184,060...42,185,452 		JBrowse link
G PMCH pro-melanin concentrating hormone decreases expression ISO salmon calcitonin results in decreased expression of PMCH mRNA CTD PMID:12686383 NCBI chr12:102,196,459...102,197,833
Ensembl chr12:102,196,459...102,197,833 		JBrowse link
corticotropin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G ADA adenosine deaminase increases activity EXP Adrenocorticotropic Hormone results in increased activity of ADA protein CTD PMID:8868375 NCBI chr20:44,619,522...44,651,699
Ensembl chr20:44,584,896...44,652,252 		JBrowse link
G CALCA calcitonin related polypeptide alpha increases abundance ISO CALCA protein results in increased abundance of Adrenocorticotropic Hormone CTD PMID:12639925 NCBI chr11:14,966,668...14,972,351
Ensembl chr11:14,966,622...14,972,354 		JBrowse link
G CNP 2',3'-cyclic nucleotide 3' phosphodiesterase decreases activity ISO Adrenocorticotropic Hormone results in decreased activity of CNP protein CTD PMID:3030154 NCBI chr17:41,966,795...41,977,740
Ensembl chr17:41,966,763...41,977,740 		JBrowse link
G CRH corticotropin releasing hormone multiple interactions
increases secretion		 ISO Astemizole inhibits the reaction [Corticosterone inhibits the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone]]; Corticosterone inhibits the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone]; E 4031 inhibits the reaction [Corticosterone inhibits the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone]]; Tetraethylammonium promotes the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone] CTD PMID:18835572 NCBI chr 8:66,176,376...66,178,464
Ensembl chr 8:66,176,376...66,178,464 		JBrowse link
G CYP17A1 cytochrome P450 family 17 subfamily A member 1 affects abundance EXP CYP17A1 protein affects the abundance of Adrenocorticotropic Hormone CTD PMID:18645707 NCBI chr10:102,830,531...102,837,413
Ensembl chr10:102,830,531...102,837,472 		JBrowse link
G GH1 growth hormone 1 multiple interactions EXP Adrenocorticotropic Hormone inhibits the reaction [INS protein results in increased secretion of GH1 protein] CTD PMID:3008584 NCBI chr17:63,917,203...63,918,839
Ensembl chr17:63,917,200...63,918,839 		JBrowse link
G HTR2A 5-hydroxytryptamine receptor 2A multiple interactions
affects expression		 ISO Bupropion inhibits the reaction [Adrenocorticotropic Hormone affects the expression of HTR2A mRNA] CTD PMID:18239281 NCBI chr13:46,831,546...46,898,082
Ensembl chr13:46,831,546...46,897,076 		JBrowse link
G INS insulin multiple interactions EXP Adrenocorticotropic Hormone inhibits the reaction [INS protein results in increased secretion of GH1 protein] CTD PMID:3008584 NCBI chr11:2,159,779...2,161,209
Ensembl chr11:2,159,779...2,161,221 		JBrowse link
G NR3C1 nuclear receptor subfamily 3 group C member 1 affects abundance EXP NR3C1 gene polymorphism affects the abundance of Adrenocorticotropic Hormone CTD PMID:17716631 NCBI chr 5:143,277,931...143,435,512
Ensembl chr 5:143,277,931...143,435,512 		JBrowse link
G PPP1R1B protein phosphatase 1 regulatory inhibitor subunit 1B multiple interactions ISO Cocaine promotes the reaction [PPP1R1B protein results in increased abundance of Adrenocorticotropic Hormone] CTD PMID:10516482 NCBI chr17:39,626,707...39,636,624
Ensembl chr17:39,626,740...39,636,626 		JBrowse link
G UCN2 urocortin 2 increases abundance ISO UCN2 protein results in increased abundance of Adrenocorticotropic Hormone CTD PMID:16330704 NCBI chr 3:48,561,718...48,563,781
Ensembl chr 3:48,561,718...48,563,781 		JBrowse link
corticotropin-releasing hormone term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G CRHR1 corticotropin releasing hormone receptor 1 increases expression
decreases activity
multiple interactions		 ISO Corticotropin-Releasing Hormone results in increased expression of CRHR1 mRNA
Corticotropin-Releasing Hormone results in decreased activity of CRHR1 protein
Pentobarbital inhibits the reaction [Corticotropin-Releasing Hormone results in decreased activity of CRHR1 protein]; Pentobarbital inhibits the reaction [Corticotropin-Releasing Hormone results in increased expression of CRHR1 mRNA]		 CTD PMID:12093084 NCBI chr17:45,784,320...45,835,828
Ensembl chr17:45,784,277...45,835,828 		JBrowse link
cosyntropin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G HSD11B2 hydroxysteroid 11-beta dehydrogenase 2 decreases expression EXP Cosyntropin results in decreased expression of HSD11B2 protein CTD PMID:11082157 NCBI chr16:67,429,801...67,437,553
Ensembl chr16:67,430,652...67,437,553 		JBrowse link
enfuvirtide term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G CYP1A2 cytochrome P450 family 1 subfamily A member 2 affects activity EXP enfuvirtide affects the activity of CYP1A2 protein CTD PMID:15656696 NCBI chr15:74,748,845...74,756,607
Ensembl chr15:74,748,845...74,756,607 		JBrowse link
G CYP2C19 cytochrome P450 family 2 subfamily C member 19 affects activity EXP enfuvirtide affects the activity of CYP2C19 protein CTD PMID:15656696 NCBI chr10:94,762,681...94,855,547
Ensembl chr10:94,762,681...94,855,547 		JBrowse link
G CYP2E1 cytochrome P450 family 2 subfamily E member 1 affects activity EXP enfuvirtide affects the activity of CYP2E1 protein CTD PMID:15656696 NCBI chr10:133,527,363...133,539,123
Ensembl chr10:133,520,406...133,561,220 		JBrowse link
ganirelix term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G LHB luteinizing hormone subunit beta decreases secretion
decreases expression		 EXP ganirelix results in decreased secretion of LHB protein
ganirelix results in decreased expression of LHB protein		 CTD PMID:17579202 PMID:21273126 NCBI chr19:49,015,980...49,019,498
Ensembl chr19:49,015,980...49,017,091 		JBrowse link
gastrin-17 term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G BIRC2 baculoviral IAP repeat containing 2 multiple interactions EXP [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC2 CTD PMID:17704804 NCBI chr11:102,347,214...102,378,670
Ensembl chr11:102,347,211...102,378,670 		JBrowse link
G BIRC3 baculoviral IAP repeat containing 3 multiple interactions EXP [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC3 CTD PMID:17704804 NCBI chr11:102,317,484...102,339,403
Ensembl chr11:102,317,450...102,339,403 		JBrowse link
G CCKBR cholecystokinin B receptor multiple interactions EXP [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC2; [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC3; [gastrin 17 co-treated with CCKBR protein] results in increased expression of IER3 mRNA CTD PMID:17704804 NCBI chr11:6,259,838...6,272,127
Ensembl chr11:6,259,806...6,272,127 		JBrowse link
G CXCL8 C-X-C motif chemokine ligand 8 increases secretion EXP gastrin 17 results in increased secretion of CXCL8 protein CTD PMID:15623601 NCBI chr 4:73,740,569...73,743,716
Ensembl chr 4:73,740,519...73,743,716 		JBrowse link
G IER3 immediate early response 3 multiple interactions EXP [gastrin 17 co-treated with CCKBR protein] results in increased expression of IER3 mRNA CTD PMID:17704804 NCBI chr 6:30,743,199...30,744,547
Ensembl chr 6:30,743,199...30,744,548 		JBrowse link
G NFKB1 nuclear factor kappa B subunit 1 decreases activity EXP gastrin 17 results in decreased activity of NFKB1 protein CTD PMID:15623601 NCBI chr 4:102,501,359...102,617,302
Ensembl chr 4:102,501,330...102,617,302 		JBrowse link
G RELA RELA proto-oncogene, NF-kB subunit decreases activity EXP gastrin 17 results in decreased activity of RELA protein CTD PMID:15623601 NCBI chr11:65,653,601...65,662,916
Ensembl chr11:65,653,599...65,663,090 		JBrowse link
G SELE selectin E decreases expression EXP gastrin 17 results in decreased expression of SELE protein CTD PMID:15623601 NCBI chr 1:169,722,640...169,734,079
Ensembl chr 1:169,722,640...169,764,705 		JBrowse link
ghrelin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G CNR1 cannabinoid receptor 1 multiple interactions ISO Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in decreased expression of CNR1 mRNA] CTD PMID:31468622 NCBI chr 6:88,139,864...88,167,349
Ensembl chr 6:88,139,864...88,166,347 		JBrowse link
G GLP1R glucagon like peptide 1 receptor multiple interactions ISO Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in decreased expression of GLP1R mRNA] CTD PMID:31468622 NCBI chr 6:39,048,781...39,091,303
Ensembl chr 6:39,048,781...39,091,303 		JBrowse link
G MIR33A microRNA 33a multiple interactions ISO Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in increased expression of MIR33A mRNA] CTD PMID:31468622 NCBI chr22:41,900,944...41,901,012
Ensembl chr22:41,900,944...41,901,012 		JBrowse link
insulin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G INSR insulin receptor decreases expression ISO insulin decreases expression of hepatic mRNA in streptozocin treated rats RGD PMID:1280238 RGD:15036814 NCBI chr19:7,112,265...7,294,414
Ensembl chr19:7,112,255...7,294,414 		JBrowse link
G MIR210 microRNA 210 increases expression
multiple interactions		 ISO Insulin increases expression of Mir210 miRNA in myocardial cell
LY294002 inhibits the reaction [Insulin increases expression of Mir210 miRNA in myocardial cell]		 RGD PMID:25968948 PMID:25968948 RGD:11086706, RGD:11086706 NCBI chr11:568,089...568,198
Ensembl chr11:568,089...568,198 		JBrowse link
insulin (human) term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G TNF tumor necrosis factor increases secretion ISO Novorapid inhibits the reaction [Lipopolysaccharide increases secretion of Tnf protein in serum] RGD PMID:18078960 RGD:15023464 NCBI chr 6:31,575,565...31,578,336
Ensembl chr 6:31,575,565...31,578,336 		JBrowse link
lepirudin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G F2 coagulation factor II, thrombin multiple interactions EXP lepirudin binds to and results in decreased activity of F2 protein CTD PMID:15080313 PMID:18449412 NCBI chr11:46,719,213...46,739,506
Ensembl chr11:46,719,196...46,739,506 		JBrowse link
liraglutide term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G ACACA acetyl-CoA carboxylase alpha multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in increased phosphorylation of ACACA protein] CTD PMID:32898504 NCBI chr17:37,084,992...37,406,836
Ensembl chr17:37,084,992...37,406,836 		JBrowse link
G ADAM33 ADAM metallopeptidase domain 33 increases expression
decreases methylation		 ISO
EXP		 Liraglutide results in increased expression of ADAM33 mRNA; Liraglutide results in increased expression of ADAM33 protein
Liraglutide results in decreased methylation of ADAM33 promoter		 CTD PMID:34534549 NCBI chr20:3,667,975...3,682,010
Ensembl chr20:3,667,965...3,682,246 		JBrowse link
G ADIPOQ adiponectin, C1Q and collagen domain containing multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased secretion of ADIPOQ protein] CTD PMID:32898504 NCBI chr 3:186,842,710...186,858,463
Ensembl chr 3:186,842,704...186,858,463 		JBrowse link
G AKT1 AKT serine/threonine kinase 1 multiple interactions EXP Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of AKT1 protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of AKT1 protein]] CTD PMID:31173752 NCBI chr14:104,769,349...104,795,748
Ensembl chr14:104,769,349...104,795,751 		JBrowse link
G BAX BCL2 associated X, apoptosis regulator multiple interactions EXP
ISO		 Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased expression of BAX protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased expression of BAX protein]]
Liraglutide inhibits the reaction [Methotrexate results in increased expression of BAX protein]		 CTD PMID:31173752 PMID:31362085 NCBI chr19:48,954,875...48,961,798
Ensembl chr19:48,954,815...48,961,798 		JBrowse link
G BCL2 BCL2 apoptosis regulator multiple interactions EXP
ISO		 Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased expression of BCL2 protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased expression of BCL2 protein]]
Liraglutide inhibits the reaction [Methotrexate results in decreased expression of BCL2 protein]		 CTD PMID:31173752 PMID:31362085 NCBI chr18:63,123,346...63,320,090
Ensembl chr18:63,123,346...63,320,128 		JBrowse link
G CASP3 caspase 3 multiple interactions EXP
ISO		 Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased cleavage of CASP3 protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased cleavage of CASP3 protein]]
Liraglutide inhibits the reaction [Methotrexate results in increased expression of and results in increased activity of CASP3 protein]		 CTD PMID:31173752 PMID:31362085 NCBI chr 4:184,627,696...184,649,447
Ensembl chr 4:184,627,696...184,650,062 		JBrowse link
G CDH1 cadherin 1 increases expression
decreases methylation		 ISO
EXP		 Liraglutide results in increased expression of CDH1 mRNA; Liraglutide results in increased expression of CDH1 protein
Liraglutide results in decreased methylation of CDH1 promoter		 CTD PMID:34534549 NCBI chr16:68,737,292...68,835,537
Ensembl chr16:68,737,292...68,835,537 		JBrowse link
G CPT1A carnitine palmitoyltransferase 1A multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased expression of CPT1A protein] CTD PMID:32898504 NCBI chr11:68,754,620...68,844,277
Ensembl chr11:68,754,620...68,844,410 		JBrowse link
G CREB1 cAMP responsive element binding protein 1 multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in decreased phosphorylation of CREB1 protein] CTD PMID:31362085 NCBI chr 2:207,529,962...207,605,988
Ensembl chr 2:207,529,737...207,605,988 		JBrowse link
G DGAT1 diacylglycerol O-acyltransferase 1 multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased expression of DGAT1 protein] CTD PMID:32898504 NCBI chr 8:144,314,584...144,326,852
Ensembl chr 8:144,314,584...144,326,910 		JBrowse link
G ESR1 estrogen receptor 1 increases expression EXP Liraglutide results in increased expression of ESR1 mRNA; Liraglutide results in increased expression of ESR1 protein CTD PMID:34534549 NCBI chr 6:151,656,672...152,129,619
Ensembl chr 6:151,656,691...152,129,619 		JBrowse link
G GLP1R glucagon like peptide 1 receptor multiple interactions
increases expression		 ISO
EXP		 Liraglutide inhibits the reaction [nitrofen results in decreased expression of GLP1R mRNA]
Liraglutide binds to and results in increased activity of GLP1R protein
Liraglutide results in increased expression of GLP1R mRNA		 CTD PMID:23354098 PMID:23471186 NCBI chr 6:39,048,781...39,091,303
Ensembl chr 6:39,048,781...39,091,303 		JBrowse link
G GPT glutamic--pyruvic transaminase multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in increased expression of GPT protein] CTD PMID:31362085 NCBI chr 8:144,503,068...144,507,172
Ensembl chr 8:144,502,973...144,507,174 		JBrowse link
G GSK3B glycogen synthase kinase 3 beta multiple interactions EXP Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of GSK3B protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of GSK3B protein]] CTD PMID:31173752 NCBI chr 3:119,821,321...120,094,447
Ensembl chr 3:119,821,321...120,094,994 		JBrowse link
G HMOX1 heme oxygenase 1 multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in increased expression of HMOX1 protein] CTD PMID:31362085 NCBI chr22:35,381,096...35,394,207
Ensembl chr22:35,380,361...35,394,214 		JBrowse link
G IL1B interleukin 1 beta multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased expression of CPT1A protein]; Liraglutide inhibits the reaction [IL1B protein results in decreased expression of DGAT1 protein]; Liraglutide inhibits the reaction [IL1B protein results in decreased expression of PPARGC1A protein]; Liraglutide inhibits the reaction [IL1B protein results in decreased secretion of ADIPOQ protein]; Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 mRNA]; Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 protein]; Liraglutide inhibits the reaction [IL1B protein results in increased phosphorylation of ACACA protein] CTD PMID:32898504 NCBI chr 2:112,829,751...112,836,779
Ensembl chr 2:112,829,751...112,836,816 		JBrowse link
G IL6 interleukin 6 multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in increased expression of IL6 protein] CTD PMID:31362085 NCBI chr 7:22,727,200...22,731,998
Ensembl chr 7:22,725,884...22,732,002 		JBrowse link
G MAPT microtubule associated protein tau multiple interactions EXP Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of MAPT protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of MAPT protein]] CTD PMID:31173752 NCBI chr17:45,894,554...46,028,334
Ensembl chr17:45,894,527...46,028,334 		JBrowse link
G NFE2L2 NFE2 like bZIP transcription factor 2 multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in decreased expression of NFE2L2 protein] CTD PMID:31362085 NCBI chr 2:177,230,303...177,264,727
Ensembl chr 2:177,218,667...177,392,756 		JBrowse link
G NOX4 NADPH oxidase 4 multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 mRNA]; Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 protein] CTD PMID:32898504 NCBI chr11:89,324,353...89,589,557
Ensembl chr11:89,324,353...89,498,187 		JBrowse link
G PPARGC1A PPARG coactivator 1 alpha multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased expression of PPARGC1A protein] CTD PMID:32898504 NCBI chr 4:23,792,021...24,472,905
Ensembl chr 4:23,755,041...23,904,089 		JBrowse link
G PTGS2 prostaglandin-endoperoxide synthase 2 multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in increased expression of PTGS2 protein] CTD PMID:31362085 NCBI chr 1:186,671,791...186,680,423
Ensembl chr 1:186,671,791...186,680,922 		JBrowse link
G RELA RELA proto-oncogene, NF-kB subunit multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in increased expression of RELA protein] CTD PMID:31362085 NCBI chr11:65,653,601...65,662,916
Ensembl chr11:65,653,599...65,663,090 		JBrowse link
G SFTPA1 surfactant protein A1 increases expression
multiple interactions		 ISO Liraglutide results in increased expression of SFTPA1 mRNA
Liraglutide inhibits the reaction [nitrofen results in decreased expression of SFTPA1 mRNA]; Liraglutide inhibits the reaction [nitrofen results in decreased expression of SFTPA1 protein]		 CTD PMID:23354098 NCBI chr10:79,610,939...79,615,455
Ensembl chr10:79,610,939...79,615,455 		JBrowse link
G SFTPB surfactant protein B increases expression ISO Liraglutide results in increased expression of SFTPB mRNA CTD PMID:23354098 NCBI chr 2:85,657,307...85,668,741
Ensembl chr 2:85,657,314...85,668,741 		JBrowse link
G TNF tumor necrosis factor multiple interactions ISO Liraglutide inhibits the reaction [Methotrexate results in increased expression of TNF protein] CTD PMID:31362085 NCBI chr 6:31,575,565...31,578,336
Ensembl chr 6:31,575,565...31,578,336 		JBrowse link
G TSC1 TSC complex subunit 1 multiple interactions ISO Liraglutide reverses the reaction [palmitate fatty acid decreases expression of tsc1 protein in hepatocytes] RGD PMID:31787541 RGD:25823196 NCBI chr 9:132,891,349...132,945,378
Ensembl chr 9:132,891,348...132,946,874 		JBrowse link
mastoparan term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G ABCA1 ATP binding cassette subfamily A member 1 multiple interactions
increases phosphorylation		 EXP mastoparan inhibits the reaction [APOA1 protein affects the reaction [ABCA1 protein results in increased export of Cholesterol]]
mastoparan results in increased phosphorylation of ABCA1 protein		 CTD PMID:16118212 NCBI chr 9:104,781,006...104,928,155
Ensembl chr 9:104,781,006...104,928,155 		JBrowse link
G APOA1 apolipoprotein A1 multiple interactions EXP mastoparan inhibits the reaction [APOA1 protein affects the reaction [ABCA1 protein results in increased export of Cholesterol]] CTD PMID:16118212 NCBI chr11:116,835,751...116,837,950
Ensembl chr11:116,835,751...116,837,622 		JBrowse link
G CALM1 calmodulin 1 affects binding ISO mastoparan binds to CALM1 protein CTD PMID:17098364 NCBI chr14:90,396,502...90,408,268
Ensembl chr14:90,396,502...90,408,268 		JBrowse link
G IL6 interleukin 6 multiple interactions ISO mastoparan inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 protein] CTD PMID:21255617 NCBI chr 7:22,727,200...22,731,998
Ensembl chr 7:22,725,884...22,732,002 		JBrowse link
G NOS1 nitric oxide synthase 1 decreases activity ISO mastoparan results in decreased activity of NOS1 protein CTD PMID:17098364 NCBI chr12:117,208,142...117,361,626
Ensembl chr12:117,208,142...117,452,170 		JBrowse link
melittin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G ACTB actin beta increases expression EXP Melitten results in increased expression of ACTB protein CTD PMID:34375656 NCBI chr 7:5,527,148...5,530,601
Ensembl chr 7:5,526,409...5,563,902 		JBrowse link
G ADAM10 ADAM metallopeptidase domain 10 multiple interactions EXP Melitten results in increased cleavage of and results in increased activity of ADAM10 protein CTD PMID:22613720 NCBI chr15:58,588,809...58,749,707
Ensembl chr15:58,588,809...58,749,791 		JBrowse link
G ADAM17 ADAM metallopeptidase domain 17 multiple interactions EXP Melitten results in increased cleavage of and results in increased activity of ADAM17 protein CTD PMID:22613720 NCBI chr 2:9,488,486...9,555,830
Ensembl chr 2:9,488,486...9,556,732 		JBrowse link
G AIM2 absent in melanoma 2 multiple interactions EXP AIM2 protein promotes the reaction [Melitten results in increased expression of IL18 protein]; AIM2 protein promotes the reaction [Melitten results in increased expression of IL1B protein] CTD PMID:22973906 NCBI chr 1:159,055,051...159,147,132
Ensembl chr 1:159,061,599...159,187,843 		JBrowse link
G AKT1 AKT serine/threonine kinase 1 multiple interactions EXP Melitten inhibits the reaction [TNF protein results in increased phosphorylation of AKT1 protein] CTD PMID:22926441 NCBI chr14:104,769,349...104,795,748
Ensembl chr14:104,769,349...104,795,751 		JBrowse link
G ALOX5 arachidonate 5-lipoxygenase increases activity EXP Melitten results in increased activity of ALOX5 protein CTD PMID:18475477 NCBI chr10:45,374,216...45,446,117
Ensembl chr10:45,374,176...45,446,119 		JBrowse link
G APAF1 apoptotic peptidase activating factor 1 multiple interactions ISO Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]
Melitten affects the reaction [TGFB1 protein affects the localization of APAF1 protein]		 CTD PMID:21354845 PMID:21871910 NCBI chr12:98,645,290...98,735,433
Ensembl chr12:98,645,290...98,735,433 		JBrowse link
G BAK1 BCL2 antagonist/killer 1 increases expression EXP Melitten results in increased expression of BAK1 protein CTD PMID:34375656 NCBI chr 6:33,572,552...33,580,276
Ensembl chr 6:33,572,547...33,580,293 		JBrowse link
G BAX BCL2 associated X, apoptosis regulator multiple interactions
increases expression		 ISO
EXP		 Melitten affects the reaction [TGFB1 protein affects the localization of BAX protein]
Melitten analog results in increased expression of BAX mRNA; Melitten analog results in increased expression of BAX protein; Melitten results in increased expression of BAX protein		 CTD PMID:21871910 PMID:22027265 PMID:29387245 PMID:34375656 NCBI chr19:48,954,875...48,961,798
Ensembl chr19:48,954,815...48,961,798 		JBrowse link
G BCL2 BCL2 apoptosis regulator decreases expression
multiple interactions		 EXP
ISO		 Melitten analog results in decreased expression of BCL2 mRNA; Melitten analog results in decreased expression of BCL2 protein; Melitten results in decreased expression of BCL2 protein
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]
Melitten affects the reaction [TGFB1 protein affects the localization of BCL2 protein]		 CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:22027265 PMID:29387245 NCBI chr18:63,123,346...63,320,090
Ensembl chr18:63,123,346...63,320,128 		JBrowse link
G BIRC3 baculoviral IAP repeat containing 3 decreases expression EXP Melitten results in decreased expression of BIRC3 protein CTD PMID:21456063 NCBI chr11:102,317,484...102,339,403
Ensembl chr11:102,317,450...102,339,403 		JBrowse link
G CALM1 calmodulin 1 affects binding ISO Melitten binds to CALM1 protein CTD PMID:17098364 NCBI chr14:90,396,502...90,408,268
Ensembl chr14:90,396,502...90,408,268 		JBrowse link
G CASP3 caspase 3 increases expression
decreases expression
multiple interactions		 EXP
ISO		 Melitten analog results in increased expression of CASP3 mRNA; Melitten analog results in increased expression of CASP3 protein; Melitten results in increased expression of CASP3 protein modified form
Melitten results in decreased expression of CASP3 protein
Melitten results in increased cleavage of and results in increased activity of CASP3 protein
Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]
Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP3 protein]		 CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:22027265 PMID:29387245 More... NCBI chr 4:184,627,696...184,649,447
Ensembl chr 4:184,627,696...184,650,062 		JBrowse link
G CASP8 caspase 8 increases expression EXP Melitten results in increased expression of CASP8 protein modified form CTD PMID:22027265 NCBI chr 2:201,233,443...201,287,711
Ensembl chr 2:201,233,443...201,361,836 		JBrowse link
G CASP9 caspase 9 multiple interactions
increases expression		 EXP
ISO		 Melitten results in increased cleavage of and results in increased activity of CASP9 protein
Melitten analog results in increased expression of CASP9 mRNA; Melitten analog results in increased expression of CASP9 protein
Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein]
Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP9 protein]		 CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:29387245 NCBI chr 1:15,491,401...15,524,912
Ensembl chr 1:15,490,832...15,526,534 		JBrowse link
G CCND1 cyclin D1 decreases expression EXP Melitten results in decreased expression of CCND1 protein CTD PMID:26189965 NCBI chr11:69,641,156...69,654,474
Ensembl chr11:69,641,156...69,654,474 		JBrowse link
G CDH1 cadherin 1 increases secretion EXP Melitten results in increased secretion of CDH1 protein CTD PMID:22613720 NCBI chr16:68,737,292...68,835,537
Ensembl chr16:68,737,292...68,835,537 		JBrowse link
G CDK4 cyclin dependent kinase 4 decreases expression EXP Melitten results in decreased expression of CDK4 protein CTD PMID:26189965 NCBI chr12:57,747,727...57,752,310
Ensembl chr12:57,747,727...57,756,013 		JBrowse link
G CGB3 chorionic gonadotropin subunit beta 3 multiple interactions EXP GNRH1 protein results in increased susceptibility to [Melitten binds to CGB3 protein]; LHCGR protein results in increased susceptibility to [Melitten binds to CGB3 protein] CTD PMID:19261682 NCBI chr19:49,022,869...49,024,333
Ensembl chr19:49,022,869...49,024,333 		JBrowse link
G CHRNA7 cholinergic receptor nicotinic alpha 7 subunit multiple interactions
increases activity		 ISO Bungarotoxins inhibits the reaction [Melitten results in increased activity of CHRNA7 protein]; methyllycaconitine inhibits the reaction [Melitten results in increased activity of CHRNA7 protein] CTD PMID:19910175 NCBI chr15:32,030,483...32,173,018
Ensembl chr15:31,923,438...32,173,018 		JBrowse link
G CHUK component of inhibitor of nuclear factor kappa B kinase complex multiple interactions
affects binding		 EXP
ISO		 [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of and results in increased activity of CHUK protein]
Melitten binds to CHUK protein
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; Dithiothreitol inhibits the reaction [Melitten binds to and results in decreased activity of CHUK protein]; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Glutathione inhibits the reaction [Melitten binds to and results in decreased activity of CHUK protein]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Hydrogen Peroxide inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [Thioacetamide results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased activity of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of CHUK protein]		 CTD PMID:17067557 PMID:21969711 NCBI chr10:100,186,319...100,229,596
Ensembl chr10:100,188,300...100,229,596 		JBrowse link
G CRYAB crystallin alpha B multiple interactions ISO Melitten promotes the reaction [sodium arsenite results in increased expression of CRYAB mRNA]; Melitten promotes the reaction [sodium arsenite results in increased expression of CRYAB protein] CTD PMID:8591993 NCBI chr11:111,908,564...111,923,740
Ensembl chr11:111,908,564...111,923,722 		JBrowse link
G CXCL8 C-X-C motif chemokine ligand 8 increases expression EXP Melitten results in increased expression of CXCL8 mRNA CTD PMID:17579088 NCBI chr 4:73,740,569...73,743,716
Ensembl chr 4:73,740,519...73,743,716 		JBrowse link
G DRD2 dopamine receptor D2 multiple interactions EXP Melitten inhibits the reaction [Spiperone binds to DRD2 protein] CTD PMID:20969853 NCBI chr11:113,409,605...113,475,398
Ensembl chr11:113,409,605...113,475,691 		JBrowse link
G EGFR epidermal growth factor receptor increases activity EXP Melitten results in increased activity of EGFR protein CTD PMID:22613720 NCBI chr 7:55,019,017...55,211,628
Ensembl chr 7:55,019,017...55,211,628 		JBrowse link
G FAS Fas cell surface death receptor increases expression EXP Melitten results in increased expression of FAS mRNA; Melitten results in increased expression of FAS protein CTD PMID:16974113 PMID:17854560 NCBI chr10:88,964,050...89,017,059
Ensembl chr10:88,953,813...89,029,605 		JBrowse link
G FGF2 fibroblast growth factor 2 decreases expression EXP Melitten results in decreased expression of FGF2 mRNA CTD PMID:18076793 NCBI chr 4:122,826,682...122,898,236
Ensembl chr 4:122,826,682...122,898,236 		JBrowse link
G FN1 fibronectin 1 multiple interactions ISO Melitten inhibits the reaction [Thioacetamide results in increased expression of FN1 protein] CTD PMID:21969711 NCBI chr 2:215,360,865...215,436,068
Ensembl chr 2:215,360,440...215,436,073 		JBrowse link
G GAP43 growth associated protein 43 increases phosphorylation ISO Melitten results in increased phosphorylation of GAP43 protein CTD PMID:9852580 NCBI chr 3:115,623,510...115,721,483
Ensembl chr 3:115,623,510...115,721,490 		JBrowse link
G GAPLINC gastric adenocarcinoma associated, positive CD44 regulator, long intergenic non-coding RNA increases expression EXP Melitten results in increased expression of GAPLINC mRNA CTD PMID:34375656 NCBI chr18:3,466,250...3,478,978
Ensembl chr18:3,466,250...3,487,045 		JBrowse link
G GLI1 GLI family zinc finger 1 decreases expression EXP Melitten results in decreased expression of GLI1 protein CTD PMID:26189965 NCBI chr12:57,459,785...57,472,268
Ensembl chr12:57,459,785...57,472,268 		JBrowse link
G GNRH1 gonadotropin releasing hormone 1 multiple interactions EXP GNRH1 protein results in increased susceptibility to [Melitten binds to CGB3 protein] CTD PMID:19261682 NCBI chr 8:25,419,258...25,425,040
Ensembl chr 8:25,419,258...25,424,654 		JBrowse link
G H19 H19 imprinted maternally expressed transcript decreases expression EXP Melitten results in decreased expression of H19 mRNA CTD PMID:34375656 NCBI chr11:1,995,176...2,001,466
Ensembl chr11:1,995,166...2,001,470 		JBrowse link
G HRH2 histamine receptor H2 increases response to substance
increases activity
multiple interactions		 ISO HRH2 protein results in increased susceptibility to Melitten
Melitten results in increased activity of HRH2 protein
Ranitidine inhibits the reaction [Melitten results in increased activity of HRH2 protein]		 CTD PMID:22995146 NCBI chr 5:175,658,071...175,710,756
Ensembl chr 5:175,658,030...175,710,756 		JBrowse link
G HTR1A 5-hydroxytryptamine receptor 1A multiple interactions EXP Melitten inhibits the reaction [HTR1A protein inhibits the reaction [Colforsin results in increased abundance of Cyclic AMP]] CTD PMID:11356925 NCBI chr 5:63,957,874...63,962,445
Ensembl chr 5:63,957,874...63,962,507 		JBrowse link
G ICAM1 intercellular adhesion molecule 1 decreases expression EXP Melitten results in decreased expression of ICAM1 protein CTD PMID:12697458 NCBI chr19:10,271,120...10,286,615
Ensembl chr19:10,271,093...10,286,615 		JBrowse link
G IKBKB inhibitor of nuclear factor kappa B kinase subunit beta multiple interactions
affects binding		 EXP
ISO		 Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]
Melitten binds to IKBKB protein
Dithiothreitol inhibits the reaction [Melitten binds to and results in decreased activity of IKBKB protein]; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Glutathione inhibits the reaction [Melitten binds to and results in decreased activity of IKBKB protein]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Hydrogen Peroxide inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased activity of IKBKB protein]; Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]; Melitten inhibits the reaction [TNF protein results in increased activity of IKBKB protein]		 CTD PMID:17067557 NCBI chr 8:42,271,302...42,332,460
Ensembl chr 8:42,271,302...42,332,460 		JBrowse link
G IL18 interleukin 18 increases expression
multiple interactions		 EXP Melitten results in increased expression of IL18 protein
AIM2 protein promotes the reaction [Melitten results in increased expression of IL18 protein]		 CTD PMID:22973906 NCBI chr11:112,143,260...112,164,094
Ensembl chr11:112,143,253...112,164,096 		JBrowse link
G IL1B interleukin 1 beta multiple interactions
increases expression		 EXP
ISO		 AIM2 protein promotes the reaction [Melitten results in increased expression of IL1B protein]
Melitten inhibits the reaction [TNF protein results in increased expression of IL1B protein]
Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of IL1B mRNA]		 CTD PMID:17570326 PMID:21969711 PMID:22973906 NCBI chr 2:112,829,751...112,836,779
Ensembl chr 2:112,829,751...112,836,816 		JBrowse link
G IL6 interleukin 6 multiple interactions ISO Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of IL6STP1 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]; Melitten inhibits the reaction [TNF protein results in increased expression of IL6 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein]
Melitten inhibits the reaction [Acetic Acid results in increased expression of IL6 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 mRNA]; Melitten inhibits the reaction [Thioacetamide results in increased expression of IL6 protein]		 CTD PMID:17570326 PMID:21354845 PMID:21969711 PMID:33002459 NCBI chr 7:22,727,200...22,731,998
Ensembl chr 7:22,725,884...22,732,002 		JBrowse link
G IL6R interleukin 6 receptor multiple interactions ISO Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of IL6STP1 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein] CTD PMID:21354845 NCBI chr 1:154,405,343...154,469,450
Ensembl chr 1:154,405,193...154,469,450 		JBrowse link
G JAK2 Janus kinase 2 decreases phosphorylation EXP Melitten results in decreased phosphorylation of JAK2 protein CTD PMID:22027265 NCBI chr 9:4,984,390...5,129,948
Ensembl chr 9:4,984,390...5,129,948 		JBrowse link
G JUN Jun proto-oncogene, AP-1 transcription factor subunit multiple interactions EXP Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased localization of JUN protein] CTD PMID:20082219 NCBI chr 1:58,780,791...58,784,047
Ensembl chr 1:58,776,845...58,784,048 		JBrowse link
G KDR kinase insert domain receptor decreases expression EXP Melitten results in decreased expression of KDR protein CTD PMID:23110475 NCBI chr 4:55,078,481...55,125,595
Ensembl chr 4:55,078,481...55,125,595 		JBrowse link
G LHCGR luteinizing hormone/choriogonadotropin receptor multiple interactions EXP LHCGR protein results in increased susceptibility to [Melitten binds to CGB3 protein] CTD PMID:19261682 NCBI chr 2:48,686,774...48,755,724
Ensembl chr 2:48,686,774...48,755,730 		JBrowse link
G MALAT1 metastasis associated lung adenocarcinoma transcript 1 affects expression EXP Melitten affects the expression of MALAT1 mRNA CTD PMID:34375656 NCBI chr11:65,497,738...65,506,516
Ensembl chr11:65,497,688...65,506,516 		JBrowse link
G MAPK1 mitogen-activated protein kinase 1 decreases phosphorylation
increases phosphorylation
multiple interactions		 EXP
ISO		 Melitten results in decreased phosphorylation of MAPK1 protein
Melitten results in increased phosphorylation of MAPK1 protein
Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of MAPK1 protein]
Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of and results in increased activity of MAPK1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK1 protein]; Melitten results in increased phosphorylation of and results in increased activity of MAPK1 protein		 CTD PMID:17570326 PMID:17579088 PMID:17654254 PMID:20082219 PMID:22613720 More... NCBI chr22:21,759,657...21,867,680
Ensembl chr22:21,759,657...21,867,680 		JBrowse link
G MAPK3 mitogen-activated protein kinase 3 multiple interactions
decreases phosphorylation
increases phosphorylation		 EXP
ISO		 Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of and results in increased activity of MAPK3 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK3 protein]; Melitten results in increased phosphorylation of and results in increased activity of MAPK3 protein
Melitten results in decreased phosphorylation of MAPK3 protein
Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of MAPK3 protein]
Melitten results in increased phosphorylation of MAPK3 protein		 CTD PMID:17570326 PMID:17579088 PMID:17654254 PMID:20082219 PMID:22613720 More... NCBI chr16:30,114,105...30,123,220
Ensembl chr16:30,114,105...30,123,506 		JBrowse link
G MECP2 methyl-CpG binding protein 2 decreases expression EXP Melitten results in decreased expression of MECP2 mRNA; Melitten results in decreased expression of MECP2 protein CTD PMID:26189965 NCBI chr  X:154,021,573...154,097,717
Ensembl chr  X:154,021,573...154,137,103 		JBrowse link
G MMP2 matrix metallopeptidase 2 multiple interactions EXP Melitten inhibits the reaction [TNF protein results in increased secretion of MMP2 protein] CTD PMID:22926441 NCBI chr16:55,478,830...55,506,691
Ensembl chr16:55,389,700...55,506,691 		JBrowse link
G MMP3 matrix metallopeptidase 3 multiple interactions EXP Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of MMP3 protein] CTD PMID:17303203 NCBI chr11:102,835,801...102,843,609
Ensembl chr11:102,835,801...102,843,609 		JBrowse link
G MMP9 matrix metallopeptidase 9 multiple interactions EXP Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of and results in increased activity of MMP9 protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of and results in increased secretion of MMP9 protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP9 protein] CTD PMID:19969058 PMID:20082219 PMID:22926441 NCBI chr20:46,008,908...46,016,561
Ensembl chr20:46,008,908...46,016,561 		JBrowse link
G NFKB1 nuclear factor kappa B subunit 1 multiple interactions
decreases localization		 EXP
ISO		 [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of and results in increased activity of NFKB1 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of NFKB1 protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of NFKB1 protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of NFKB1 protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of NFKB1 protein]]
Melitten results in decreased localization of NFKB1 protein		 CTD PMID:15529353 PMID:17067557 PMID:18507870 PMID:21456063 NCBI chr 4:102,501,359...102,617,302
Ensembl chr 4:102,501,330...102,617,302 		JBrowse link
G NFKBIA NFKB inhibitor alpha multiple interactions EXP
ISO		 [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]		 CTD PMID:15529353 PMID:17067557 PMID:17570326 PMID:18507870 PMID:22926441 NCBI chr14:35,401,513...35,404,749
Ensembl chr14:35,401,079...35,404,749 		JBrowse link
G NOS1 nitric oxide synthase 1 decreases activity ISO Melitten results in decreased activity of NOS1 protein CTD PMID:17098364 NCBI chr12:117,208,142...117,361,626
Ensembl chr12:117,208,142...117,452,170 		JBrowse link
G NOS2 nitric oxide synthase 2 multiple interactions
decreases expression		 ISO
EXP		 Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[TNF protein results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of NOS2 mRNA]
Melitten results in decreased expression of NOS2 protein		 CTD PMID:15529353 PMID:17067557 PMID:17570326 PMID:21456063 NCBI chr17:27,756,766...27,800,529
Ensembl chr17:27,756,766...27,800,529 		JBrowse link
G P2RX7 purinergic receptor P2X 7 increases activity
increases response to substance		 EXP Melitten results in increased activity of P2RX7 protein
P2RX7 protein results in increased susceptibility to Melitten		 CTD PMID:22613720 NCBI chr12:121,132,876...121,188,032
Ensembl chr12:121,132,819...121,188,032 		JBrowse link
G PARP1 poly(ADP-ribose) polymerase 1 multiple interactions ISO Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of PARP1 protein] CTD PMID:21871910 NCBI chr 1:226,360,691...226,408,093
Ensembl chr 1:226,360,210...226,408,154 		JBrowse link
G PDGFRB platelet derived growth factor receptor beta multiple interactions ISO Melitten results in decreased phosphorylation of and results in decreased activity of PDGFRB protein CTD PMID:17654254 NCBI chr 5:150,113,839...150,155,845
Ensembl chr 5:150,113,839...150,155,872 		JBrowse link
G PLA2G2A phospholipase A2 group IIA multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of PLA2G2A protein] CTD PMID:33002459 NCBI chr 1:19,975,431...19,980,434
Ensembl chr 1:19,975,431...19,980,416 		JBrowse link
G PLA2G4A phospholipase A2 group IVA decreases expression EXP Melitten results in decreased expression of PLA2G4A protein CTD PMID:21456063 NCBI chr 1:186,828,949...186,988,981
Ensembl chr 1:186,828,949...186,988,981 		JBrowse link
G PLCG1 phospholipase C gamma 1 decreases phosphorylation ISO Melitten results in decreased phosphorylation of PLCG1 protein CTD PMID:17654254 NCBI chr20:41,137,543...41,177,626
Ensembl chr20:41,136,960...41,196,801 		JBrowse link
G PTCH1 patched 1 increases expression EXP Melitten results in increased expression of PTCH1 protein CTD PMID:26189965 NCBI chr 9:95,442,980...95,516,971
Ensembl chr 9:95,442,980...95,517,057 		JBrowse link
G PTGS2 prostaglandin-endoperoxide synthase 2 multiple interactions
increases expression
decreases expression		 EXP
ISO		 [Melitten results in decreased expression of PTGS2 protein] which results in decreased chemical synthesis of Dinoprostone; Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; SB 203580 inhibits the reaction [Melitten results in decreased expression of PTGS2 protein]
Melitten results in increased expression of PTGS2 mRNA; Melitten results in increased expression of PTGS2 protein
[Melitten results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone; Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[TNF protein results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [Acetic Acid results in increased expression of PTGS2 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of PTGS2 mRNA]		 CTD PMID:11094054 PMID:11821123 PMID:15529353 PMID:17067557 PMID:17570326 More... NCBI chr 1:186,671,791...186,680,423
Ensembl chr 1:186,671,791...186,680,922 		JBrowse link
G RAB11A RAB11A, member RAS oncogene family multiple interactions EXP Melitten results in decreased localization of [RAB11A protein co-treated with RAB5A protein] CTD PMID:22683840 NCBI chr15:65,869,491...65,891,989
Ensembl chr15:65,726,054...65,891,989 		JBrowse link
G RAB5A RAB5A, member RAS oncogene family multiple interactions EXP Melitten results in decreased localization of [RAB11A protein co-treated with RAB5A protein]; Melitten results in increased localization of [SLC6A3 protein co-treated with RAB5A protein] CTD PMID:22683840 NCBI chr 3:19,947,097...19,985,175
Ensembl chr 3:19,947,097...19,985,175 		JBrowse link
G RAC1 Rac family small GTPase 1 decreases activity EXP Melitten results in decreased activity of RAC1 protein CTD PMID:18506888 NCBI chr 7:6,374,527...6,403,967
Ensembl chr 7:6,374,527...6,403,967 		JBrowse link
G RELA RELA proto-oncogene, NF-kB subunit multiple interactions
decreases localization		 EXP
ISO		 Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased localization of RELA protein]; Melitten inhibits the reaction [TNF protein affects the localization of RELA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]]
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]
Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]]
Melitten results in decreased localization of RELA protein		 CTD PMID:17570326 PMID:18507870 PMID:20082219 PMID:21354845 PMID:21456063 More... NCBI chr11:65,653,601...65,662,916
Ensembl chr11:65,653,599...65,663,090 		JBrowse link
G SCN10A sodium voltage-gated channel alpha subunit 10 increases expression
multiple interactions		 ISO Melitten results in increased expression of SCN10A mRNA; Melitten results in increased expression of SCN10A protein
[Melitten results in increased expression of SCN10A protein] which results in increased transport of Sodium		 CTD PMID:23264124 NCBI chr 3:38,696,807...38,816,217
Ensembl chr 3:38,696,802...38,816,286 		JBrowse link
G SCN11A sodium voltage-gated channel alpha subunit 11 increases expression
multiple interactions
increases response to substance		 ISO Melitten results in increased expression of SCN11A mRNA; Melitten results in increased expression of SCN11A protein
[Melitten results in increased expression of SCN11A protein] which results in increased transport of Sodium
SCN11A protein results in increased susceptibility to Melitten		 CTD PMID:23264124 NCBI chr 3:38,845,764...39,051,944
Ensembl chr 3:38,845,764...39,052,157 		JBrowse link
G SHH sonic hedgehog signaling molecule decreases expression EXP Melitten results in decreased expression of SHH protein CTD PMID:26189965 NCBI chr 7:155,799,980...155,812,463
Ensembl chr 7:155,799,980...155,812,463 		JBrowse link
G SLC6A3 solute carrier family 6 member 3 increases localization
multiple interactions		 EXP Melitten results in increased localization of SLC6A3 protein
Cocaine inhibits the reaction [Melitten results in increased localization of SLC6A3 protein]; Melitten inhibits the reaction [2beta-carbomethoxy-3beta-(4-iodophenyl)tropane binds to SLC6A3 protein]; Melitten inhibits the reaction [SLC6A3 protein results in increased uptake of Dopamine]; Melitten results in increased localization of [SLC6A3 protein co-treated with RAB5A protein]		 CTD PMID:20969853 PMID:22683840 NCBI chr 5:1,392,794...1,445,440
Ensembl chr 5:1,392,794...1,445,440 		JBrowse link
G STAT3 signal transducer and activator of transcription 3 decreases phosphorylation
multiple interactions		 EXP
ISO		 Melitten results in decreased phosphorylation of STAT3 protein
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]
TNFRSF10A protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]; TNFRSF21 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]; TNFRSF25 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]		 CTD PMID:21354845 PMID:22027265 NCBI chr17:42,313,324...42,388,442
Ensembl chr17:42,313,324...42,388,540 		JBrowse link
G TBXA2R thromboxane A2 receptor increases response to substance ISO TBXA2R protein results in increased susceptibility to Melitten CTD PMID:16524625 NCBI chr19:3,594,507...3,606,875
Ensembl chr19:3,594,507...3,606,875 		JBrowse link
G TGFA transforming growth factor alpha increases secretion EXP Melitten results in increased secretion of TGFA protein CTD PMID:22613720 NCBI chr 2:70,447,284...70,553,826
Ensembl chr 2:70,447,284...70,554,193 		JBrowse link
G TGFB1 transforming growth factor beta 1 multiple interactions
decreases activity		 ISO Melitten affects the reaction [TGFB1 protein affects the localization of APAF1 protein]; Melitten affects the reaction [TGFB1 protein affects the localization of BAX protein]; Melitten affects the reaction [TGFB1 protein affects the localization of BCL2 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP3 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP9 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of PARP1 protein]; Melitten inhibits the reaction [Thioacetamide results in increased expression of TGFB1 protein]
Melitten results in decreased activity of TGFB1 protein		 CTD PMID:21871910 PMID:21969711 NCBI chr19:41,330,323...41,353,922
Ensembl chr19:41,301,587...41,353,922 		JBrowse link
G TLR4 toll like receptor 4 multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of TLR4 protein] CTD PMID:33002459 NCBI chr 9:117,704,403...117,724,735
Ensembl chr 9:117,704,175...117,724,735 		JBrowse link
G TNF tumor necrosis factor multiple interactions
decreases secretion
increases expression		 EXP
ISO		 Melitten inhibits the reaction [TNF protein affects the localization of RELA protein]; Melitten inhibits the reaction [TNF protein results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of AKT1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK3 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP2 protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP9 protein]
Melitten results in decreased secretion of TNF protein
Melitten inhibits the reaction [TNF protein results in increased expression of IL1B protein]; Melitten inhibits the reaction [TNF protein results in increased expression of IL6 protein]
Melitten results in increased expression of TNF mRNA
Melitten inhibits the reaction [[TNF protein results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[TNF protein results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [Acetic Acid results in increased expression of TNF protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of TNF mRNA]; Melitten inhibits the reaction [Thioacetamide results in increased expression of TNF protein]; Melitten inhibits the reaction [TNF protein results in increased activity of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased activity of IKBKB protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]		 CTD PMID:11094054 PMID:11821123 PMID:17067557 PMID:17570326 PMID:21969711 More... NCBI chr 6:31,575,565...31,578,336
Ensembl chr 6:31,575,565...31,578,336 		JBrowse link
G TNFRSF10A TNF receptor superfamily member 10a multiple interactions
increases expression
affects response to substance		 EXP TNFRSF10A protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
Melitten results in increased expression of TNFRSF10A mRNA
TNFRSF10A protein affects the susceptibility to Melitten		 CTD PMID:22027265 NCBI chr 8:23,190,452...23,225,102
Ensembl chr 8:23,190,452...23,225,102 		JBrowse link
G TNFRSF21 TNF receptor superfamily member 21 increases expression
affects response to substance
multiple interactions		 EXP Melitten results in increased expression of TNFRSF21 mRNA
TNFRSF21 protein affects the susceptibility to Melitten
TNFRSF21 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]		 CTD PMID:22027265 NCBI chr 6:47,231,532...47,309,905
Ensembl chr 6:47,231,532...47,309,905 		JBrowse link
G TNFRSF25 TNF receptor superfamily member 25 increases expression
multiple interactions
affects response to substance		 EXP Melitten results in increased expression of TNFRSF25 mRNA
TNFRSF25 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
TNFRSF25 protein affects the susceptibility to Melitten		 CTD PMID:22027265 NCBI chr 1:6,460,786...6,466,173
Ensembl chr 1:6,460,786...6,466,175 		JBrowse link
G TRAF6 TNF receptor associated factor 6 multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of TRAF6 protein] CTD PMID:33002459 NCBI chr11:36,483,769...36,510,272
Ensembl chr11:36,483,769...36,510,272 		JBrowse link
G TRPV1 transient receptor potential cation channel subfamily V member 1 multiple interactions
increases response to substance
increases activity		 ISO [Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium; capsazepine inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; capsazepine inhibits the reaction [TRPV1 protein results in increased susceptibility to Melitten]; Indomethacin inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; Masoprocol inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium] CTD PMID:16446039 PMID:21453681 NCBI chr17:3,565,446...3,609,411
Ensembl chr17:3,565,444...3,609,411 		JBrowse link
G VCAM1 vascular cell adhesion molecule 1 multiple interactions ISO Melitten inhibits the reaction [Thioacetamide results in increased expression of VCAM1 protein] CTD PMID:21969711 NCBI chr 1:100,719,742...100,739,045
Ensembl chr 1:100,719,742...100,739,045 		JBrowse link
G VDAC1 voltage dependent anion channel 1 increases expression EXP Melitten results in increased expression of VDAC1 protein CTD PMID:34375656 NCBI chr 5:133,971,871...134,114,540
Ensembl chr 5:133,971,871...134,004,975 		JBrowse link
G VEGFA vascular endothelial growth factor A multiple interactions
decreases expression		 EXP SB 203580 inhibits the reaction [Melitten results in decreased expression of VEGFA protein]
Melitten results in decreased expression of VEGFA mRNA; Melitten results in decreased expression of VEGFA protein		 CTD PMID:18076793 PMID:23110475 NCBI chr 6:43,770,211...43,786,487
Ensembl chr 6:43,770,184...43,786,487 		JBrowse link
G XIAP X-linked inhibitor of apoptosis decreases expression EXP Melitten results in decreased expression of XIAP protein CTD PMID:21456063 NCBI chr  X:123,859,708...123,913,972
Ensembl chr  X:123,859,712...123,913,972 		JBrowse link
G XIST X inactive specific transcript increases expression EXP Melitten results in increased expression of XIST mRNA CTD PMID:34375656 NCBI chr  X:73,820,651...73,852,753
Ensembl chr  X:73,820,649...73,852,723 		JBrowse link
Neurokinin A term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G TACR2 tachykinin receptor 2 affects binding EXP Neurokinin A binds to TACR2 protein CTD PMID:15925360 NCBI chr10:69,403,903...69,416,918
Ensembl chr10:69,403,903...69,416,918 		JBrowse link
nociceptin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G OPRL1 opioid related nociceptin receptor 1 affects binding
multiple interactions		 ISO
EXP		 nociceptin binds to OPRL1 protein
Endocannabinoids inhibits the reaction [nociceptin binds to and results in increased activity of OPRL1 protein]; nociceptin binds to and results in increased activity of OPRL1 protein		 CTD PMID:20359694 PMID:21866885 PMID:30102254 NCBI chr20:64,080,082...64,100,643
Ensembl chr20:64,080,082...64,100,643 		JBrowse link
omega-conotoxin GVIA term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G CLU clusterin multiple interactions ISO omega-Conotoxin GVIA inhibits the reaction [methoxyacetic acid results in increased expression of and results in increased secretion of CLU protein] CTD PMID:14656996 NCBI chr 8:27,596,917...27,614,700
Ensembl chr 8:27,596,917...27,614,700 		JBrowse link
G FOS Fos proto-oncogene, AP-1 transcription factor subunit multiple interactions ISO [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] inhibits the reaction [Potassium Chloride affects the expression of FOS mRNA] CTD PMID:20211981 NCBI chr14:75,278,828...75,282,230
Ensembl chr14:75,278,826...75,282,230 		JBrowse link
G KCNA1 potassium voltage-gated channel subfamily A member 1 multiple interactions ISO [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] promotes the reaction [Potassium Chloride results in increased expression of KCNA1 mRNA] CTD PMID:20211981 NCBI chr12:4,909,905...4,918,256
Ensembl chr12:4,909,905...4,918,256 		JBrowse link
G KCNC3 potassium voltage-gated channel subfamily C member 3 multiple interactions ISO [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] inhibits the reaction [Potassium Chloride results in increased expression of KCNC3 mRNA] CTD PMID:20211981 NCBI chr19:50,311,937...50,333,536
Ensembl chr19:50,311,937...50,333,515 		JBrowse link
G SCT secretin multiple interactions ISO omega-Conotoxin GVIA inhibits the reaction [Potassium Chloride results in increased secretion of SCT protein] CTD PMID:16888165 NCBI chr11:626,309...627,181
Ensembl chr11:626,309...627,181 		JBrowse link
G SNCA synuclein alpha multiple interactions ISO omega-Conotoxin GVIA inhibits the reaction [SNCA protein results in increased uptake of Calcium] CTD PMID:17179863 NCBI chr 4:89,724,099...89,838,304
Ensembl chr 4:89,700,345...89,838,315 		JBrowse link
G TAC1 tachykinin precursor 1 multiple interactions ISO omega-Conotoxin GVIA inhibits the reaction [Potassium results in increased secretion of TAC1 protein modified form] CTD PMID:2325850 NCBI chr 7:97,732,086...97,740,472
Ensembl chr 7:97,732,084...97,740,472 		JBrowse link
oxidised LDL term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G MAP3K7 mitogen-activated protein kinase kinase kinase 7 multiple interactions
increases phosphorylation		 EXP Albiflorin inhibits the reaction [oxidized LDL increases phosphorylation of MAP3K7 protein in umbilical vein endothelial cells]
Oxidized LDL increases phosphorylation of MAP3K7 protein in umbilical vein endothelial cells		 RGD PMID:35601145 PMID:35601145 RGD:155804296, RGD:155804296 NCBI chr 6:90,513,579...90,587,072
Ensembl chr 6:90,513,573...90,587,086 		JBrowse link
PR-39 term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G ICAM1 intercellular adhesion molecule 1 multiple interactions ISO PR 39 inhibits the reaction [TNF protein results in increased expression of ICAM1 protein] CTD PMID:12388057 NCBI chr19:10,271,120...10,286,615
Ensembl chr19:10,271,093...10,286,615 		JBrowse link
G SELE selectin E multiple interactions ISO PR 39 inhibits the reaction [TNF protein results in increased expression of SELE protein] CTD PMID:12388057 NCBI chr 1:169,722,640...169,734,079
Ensembl chr 1:169,722,640...169,764,705 		JBrowse link
G TNF tumor necrosis factor multiple interactions ISO PR 39 inhibits the reaction [TNF protein results in increased expression of ICAM1 protein]; PR 39 inhibits the reaction [TNF protein results in increased expression of SELE protein]; PR 39 inhibits the reaction [TNF protein results in increased expression of VCAM1 protein] CTD PMID:12388057 NCBI chr 6:31,575,565...31,578,336
Ensembl chr 6:31,575,565...31,578,336 		JBrowse link
G VCAM1 vascular cell adhesion molecule 1 multiple interactions ISO PR 39 inhibits the reaction [TNF protein results in increased expression of VCAM1 protein] CTD PMID:12388057 NCBI chr 1:100,719,742...100,739,045
Ensembl chr 1:100,719,742...100,739,045 		JBrowse link
royal jelly term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G BCL2 BCL2 apoptosis regulator multiple interactions ISO royal jelly inhibits the reaction [Nicotine results in decreased expression of BCL2 mRNA] CTD PMID:30896085 NCBI chr18:63,123,346...63,320,090
Ensembl chr18:63,123,346...63,320,128 		JBrowse link
G CASP3 caspase 3 multiple interactions ISO royal jelly inhibits the reaction [Nicotine results in increased expression of CASP3 mRNA] CTD PMID:30896085 NCBI chr 4:184,627,696...184,649,447
Ensembl chr 4:184,627,696...184,650,062 		JBrowse link
G CAT catalase multiple interactions ISO royal jelly inhibits the reaction [Cisplatin results in decreased activity of CAT protein]
royal jelly inhibits the reaction [Nicotine results in decreased activity of CAT protein]		 CTD PMID:20369241 PMID:30896085 NCBI chr11:34,438,934...34,472,060
Ensembl chr11:34,438,934...34,472,060 		JBrowse link
G CCND1 cyclin D1 multiple interactions ISO royal jelly inhibits the reaction [phenylhydrazine affects the expression of CCND1 mRNA] CTD PMID:35099105 NCBI chr11:69,641,156...69,654,474
Ensembl chr11:69,641,156...69,654,474 		JBrowse link
G ESR1 estrogen receptor 1 multiple interactions
increases activity
affects binding		 EXP Estradiol inhibits the reaction [royal jelly binds to ESR1 protein]; royal jelly binds to and results in increased activity of ESR1 protein; royal jelly inhibits the reaction [Estradiol binds to ESR1 protein]
royal jelly results in increased activity of ESR1 protein		 CTD PMID:15946813 PMID:17287592 NCBI chr 6:151,656,672...152,129,619
Ensembl chr 6:151,656,691...152,129,619 		JBrowse link
G ESR2 estrogen receptor 2 multiple interactions
affects binding		 EXP Estradiol inhibits the reaction [royal jelly binds to ESR2 protein]; royal jelly binds to and results in increased activity of ESR2 protein; royal jelly inhibits the reaction [Estradiol binds to ESR2 protein] CTD PMID:15946813 PMID:17287592 NCBI chr14:64,226,707...64,338,613
Ensembl chr14:64,084,232...64,338,112 		JBrowse link
G MYC MYC proto-oncogene, bHLH transcription factor multiple interactions ISO royal jelly inhibits the reaction [phenylhydrazine results in decreased expression of MYC mRNA] CTD PMID:35099105 NCBI chr 8:127,735,434...127,742,951
Ensembl chr 8:127,735,434...127,742,951 		JBrowse link
G PCNA proliferating cell nuclear antigen multiple interactions ISO royal jelly inhibits the reaction [Nicotine results in decreased expression of PCNA protein] CTD PMID:30896085 NCBI chr20:5,114,953...5,126,622
Ensembl chr20:5,114,953...5,126,626 		JBrowse link
G TFF1 trefoil factor 1 increases expression EXP royal jelly results in increased expression of TFF1 mRNA CTD PMID:15946813 NCBI chr21:42,362,282...42,366,535
Ensembl chr21:42,362,282...42,366,535 		JBrowse link
G TP53 tumor protein p53 multiple interactions ISO royal jelly inhibits the reaction [Nicotine results in increased expression of TRP53 mRNA] CTD PMID:30896085 NCBI chr17:7,668,421...7,687,490
Ensembl chr17:7,661,779...7,687,538 		JBrowse link
G VEGFA vascular endothelial growth factor A increases expression EXP
ISO		 royal jelly results in increased expression of VEGFA mRNA CTD PMID:15946813 PMID:17287592 NCBI chr 6:43,770,211...43,786,487
Ensembl chr 6:43,770,184...43,786,487 		JBrowse link
Term paths to the root
Path 1
Term Annotations click to browse term
  CHEBI ontology 25886
    chemical entity 25864
      molecular entity 25842
        polyatomic entity 25732
          macromolecule 6016
            polypeptide 210
              (12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
              (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
              (4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 0
              Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
              Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 0
              Arthrofactin 0
              CIGB-300 0
              DASKALRSSGMP 0
              DKATIGFEVQEE 0
              DSGEGDFLAEGGGVR 0
              ENPAVHFFKNIVTPRTP 0
              ENPVVAFFKNIVTPRTP 0
              ENPVVHFFFNIVTPRTP 0
              ENPVVHFFKNIVTPRTP 0
              ENPVVHFFYNIVTPRTP 0
              FPAWFTKLYPRT 0
              Gonadorelin hydrochloride 0
              GsMTx4 0
              IPQVWRDWFKLP 0
              JNK inhibitor I 0
              KGKGKGKGKGENPAVHFFKNIVTPRTP 0
              KGKGKGKGKGENPVVAFFKNIVTPRTP 0
              KGKGKGKGKGENPVVHFFFNIVTPRTP 0
              KGKGKGKGKGENPVVHFFKNIVTPRTP 0
              KGKGKGKGKGENPVVHFFYNIVTPRTP 0
              LSM-37009 0
              LSM-37015 0
              LSM-37045 0
              LSM-37094 0
              LSM-37129 0
              LSM-37138 0
              LSM-37175 0
              LSM-37192 0
              LSM-37213 0
              Mirabamide C 0
              Mirabamide G 0
              Mirabamide H 0
              N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 0
              N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
              Neurokinin A 1
              Neurokinin B 0
              P-factor 0
              QINTAKWWKTHF 0
              QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
              Rac1 Inhibitor W56 0
              STAT3 inhibitor peptide 0
              Streptomyces coelicolor calcium-dependent antibiotic CDA4b 0
              VSWKTWFPNLAV 0
              Vaby A 0
              Vaby B 0
              Vaby C 0
              Vaby D 0
              Vaby E 0
              Varv E 0
              WHWLQLKPGQPMY 0
              YIIKGLFWDPAC + 0
              YIIKGVFWDPAC + 0
              YSPFHKWFPSMH 0
              abarelix 0
              afamelanotide 1
              albiglutide 0
              amoxicilloyl polylysine 0
              amyloid-beta + 0
              astressin 13
              astressin 2B 6
              bacitracin A + 44
              benzylpenicilloyl polylysine 0
              beta-endorphin 10
              bivalirudin 8
              calcitonin 2
              calcitonin (human synthetic) 0
              calcitonin (pork natural) 0
              calpastatin peptide Ac 184-210 0
              carperitide 0
              cathelicidin + 4
              corticorelin 0
              corticotropin 11
              corticotropin-releasing hormone + 1
              cosyntropin 1
              cyanophycin macromolecule + 0
              defensin + 0
              degarelix 0
              dermaseptin s3(1-16)-NH2 0
              desirudin 0
              elcatonin 0
              elf18 0
              enfuvirtide 3
              exendin-3 0
              exendin-4 0
              ganirelix 1
              gastrin + 8
              ghrelin 3
              insulin + 3
              kisspeptin-54 0
              koshikamide A2 0
              lantibiotic + 0
              lepirudin 1
              liraglutide 28
              lixisenatide 0
              mastoparans + 5
              melittin 88
              nesiritide 0
              nociceptin 1
              omega-conotoxin GVIA 7
              p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 0
              penicilloyl polylysine 0
              peptide YY 0
              poly(glycyl-L-arginine) 0
              pramlintide 0
              protein polypeptide chain + 12
              secretin human 0
              semaglutide 0
              sermorelin 0
              teduglutide 0
              teriparatide 0
              terlipressin 0
              tesamorelin 0
              thymalfasin 0
              tirzepatide 0
Path 2
Term Annotations click to browse term
  CHEBI ontology 25886
    subatomic particle 25860
      composite particle 25860
        hadron 25860
          baryon 25860
            nucleon 25860
              atomic nucleus 25860
                atom 25860
                  main group element atom 25682
                    p-block element atom 25682
                      carbon group element atom 25279
                        carbon atom 25237
                          organic molecular entity 25237
                            organic group 23400
                              organic divalent group 23378
                                organodiyl group 23378
                                  carbonyl group 23371
                                    carbonyl compound 23371
                                      carboxylic acid 22492
                                        carboacyl group 19971
                                          univalent carboacyl group 19971
                                            carbamoyl group 19476
                                              carboxamide 19476
                                                peptide 10006
                                                  polypeptide 210
                                                    (12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
                                                    (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
                                                    (4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 0
                                                    Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
                                                    Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 0
                                                    Arthrofactin 0
                                                    CIGB-300 0
                                                    DASKALRSSGMP 0
                                                    DKATIGFEVQEE 0
                                                    DSGEGDFLAEGGGVR 0
                                                    ENPAVHFFKNIVTPRTP 0
                                                    ENPVVAFFKNIVTPRTP 0
                                                    ENPVVHFFFNIVTPRTP 0
                                                    ENPVVHFFKNIVTPRTP 0
                                                    ENPVVHFFYNIVTPRTP 0
                                                    FPAWFTKLYPRT 0
                                                    Gonadorelin hydrochloride 0
                                                    GsMTx4 0
                                                    IPQVWRDWFKLP 0
                                                    JNK inhibitor I 0
                                                    KGKGKGKGKGENPAVHFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVAFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFFNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFYNIVTPRTP 0
                                                    LSM-37009 0
                                                    LSM-37015 0
                                                    LSM-37045 0
                                                    LSM-37094 0
                                                    LSM-37129 0
                                                    LSM-37138 0
                                                    LSM-37175 0
                                                    LSM-37192 0
                                                    LSM-37213 0
                                                    Mirabamide C 0
                                                    Mirabamide G 0
                                                    Mirabamide H 0
                                                    N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 0
                                                    N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
                                                    Neurokinin A 1
                                                    Neurokinin B 0
                                                    P-factor 0
                                                    QINTAKWWKTHF 0
                                                    QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
                                                    Rac1 Inhibitor W56 0
                                                    STAT3 inhibitor peptide 0
                                                    Streptomyces coelicolor calcium-dependent antibiotic CDA4b 0
                                                    VSWKTWFPNLAV 0
                                                    Vaby A 0
                                                    Vaby B 0
                                                    Vaby C 0
                                                    Vaby D 0
                                                    Vaby E 0
                                                    Varv E 0
                                                    WHWLQLKPGQPMY 0
                                                    YIIKGLFWDPAC + 0
                                                    YIIKGVFWDPAC + 0
                                                    YSPFHKWFPSMH 0
                                                    abarelix 0
                                                    afamelanotide 1
                                                    albiglutide 0
                                                    amoxicilloyl polylysine 0
                                                    amyloid-beta + 0
                                                    astressin 13
                                                    astressin 2B 6
                                                    bacitracin A + 44
                                                    benzylpenicilloyl polylysine 0
                                                    beta-endorphin 10
                                                    bivalirudin 8
                                                    calcitonin 2
                                                    calcitonin (human synthetic) 0
                                                    calcitonin (pork natural) 0
                                                    calpastatin peptide Ac 184-210 0
                                                    carperitide 0
                                                    cathelicidin + 4
                                                    corticorelin 0
                                                    corticotropin 11
                                                    corticotropin-releasing hormone + 1
                                                    cosyntropin 1
                                                    cyanophycin macromolecule + 0
                                                    defensin + 0
                                                    degarelix 0
                                                    dermaseptin s3(1-16)-NH2 0
                                                    desirudin 0
                                                    elcatonin 0
                                                    elf18 0
                                                    enfuvirtide 3
                                                    exendin-3 0
                                                    exendin-4 0
                                                    ganirelix 1
                                                    gastrin + 8
                                                    ghrelin 3
                                                    insulin + 3
                                                    kisspeptin-54 0
                                                    koshikamide A2 0
                                                    lantibiotic + 0
                                                    lepirudin 1
                                                    liraglutide 28
                                                    lixisenatide 0
                                                    mastoparans + 5
                                                    melittin 88
                                                    nesiritide 0
                                                    nociceptin 1
                                                    omega-conotoxin GVIA 7
                                                    p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 0
                                                    penicilloyl polylysine 0
                                                    peptide YY 0
                                                    poly(glycyl-L-arginine) 0
                                                    pramlintide 0
                                                    protein polypeptide chain + 12
                                                    secretin human 0
                                                    semaglutide 0
                                                    sermorelin 0
                                                    teduglutide 0
                                                    teriparatide 0
                                                    terlipressin 0
                                                    tesamorelin 0
                                                    thymalfasin 0
                                                    tirzepatide 0
paths to the root