Send us a Message



Submit Data |  Help |  Video Tutorials |  News |  Publications |  Download |  REST API |  Citing RGD |  Contact   

CHEBI ONTOLOGY - ANNOTATIONS

The Chemical Entities of Biological Interest (ChEBI) ontology is downloaded weekly from EMBL-EBI at http://www.ebi.ac.uk/chebi/. The data is made available under the Creative Commons License (CC BY 3.0, http://creativecommons.org/licenses/by/3.0/). For more information see: Degtyarenko et al. (2008) ChEBI: a database and ontology for chemical entities of biological interest. Nucleic Acids Res. 36, D344–D350.

Term:polypeptide
go back to main search page
Accession:CHEBI:15841 term browser browse the term
Definition:A peptide containing ten or more amino acid residues.
Synonyms:exact_synonym: polypeptides
 related_synonym: Formula=C4H6N2O3R2(C2H2NOR)n;   Polypeptid;   polipeptido
 alt_id: CHEBI:14860;   CHEBI:8314
 xref: KEGG:C00403



show annotations for term's descendants           Sort by:
 
corticotropin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G INS insulin increases abundance EXP INS protein results in increased abundance of Adrenocorticotropic Hormone CTD PMID:1646414 NCBI chr18:46,324,047...46,324,933
Ensembl chr18:46,324,041...46,325,122
JBrowse link
mastoparan term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G GNAQ G protein subunit alpha q multiple interactions EXP G(M1) Ganglioside inhibits the reaction [mastoparan results in increased activity of and affects the localization of GNAQ protein]; ganglioside, GD1a inhibits the reaction [mastoparan results in increased activity of and affects the localization of GNAQ protein]; mastoparan results in increased activity of and affects the localization of GNAQ protein CTD PMID:21671308 NCBI chr 1:80,733,530...80,928,065
Ensembl chr 1:80,715,366...80,928,065
JBrowse link
G HEXB hexosaminidase subunit beta multiple interactions
increases secretion
EXP G(M1) Ganglioside inhibits the reaction [mastoparan results in increased secretion of HEXB protein]; ganglioside, GD1a inhibits the reaction [mastoparan results in increased secretion of HEXB protein]; Indomethacin promotes the reaction [mastoparan results in increased secretion of HEXB protein]; methyl-beta-cyclodextrin promotes the reaction [mastoparan results in increased secretion of HEXB protein]; Pertussis Toxin inhibits the reaction [mastoparan results in increased secretion of HEXB protein]; Quinacrine promotes the reaction [mastoparan results in increased secretion of HEXB protein]; YM-254890 inhibits the reaction [mastoparan results in increased secretion of HEXB protein] CTD PMID:21671308 NCBI chr 2:57,221,809...57,248,432
Ensembl chr 2:57,222,186...57,248,417
JBrowse link
melittin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G HEXB hexosaminidase subunit beta multiple interactions
increases secretion
EXP G(M1) Ganglioside inhibits the reaction [Melitten results in increased secretion of HEXB protein]; sialogangliosides inhibits the reaction [Melitten results in increased secretion of HEXB protein]; trisialoganglioside GT1 inhibits the reaction [Melitten results in increased secretion of HEXB protein] CTD PMID:21334356 NCBI chr 2:57,221,809...57,248,432
Ensembl chr 2:57,222,186...57,248,417
JBrowse link

Term paths to the root
Path 1
Term Annotations click to browse term
  CHEBI ontology 402
    chemical entity 402
      molecular entity 402
        polyatomic entity 395
          macromolecule 4
            polypeptide 3
              (12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
              (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
              (4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 0
              Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
              Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 0
              Arthrofactin 0
              CIGB-300 0
              DASKALRSSGMP 0
              DKATIGFEVQEE 0
              DSGEGDFLAEGGGVR 0
              ENPAVHFFKNIVTPRTP 0
              ENPVVAFFKNIVTPRTP 0
              ENPVVHFFFNIVTPRTP 0
              ENPVVHFFKNIVTPRTP 0
              ENPVVHFFYNIVTPRTP 0
              FPAWFTKLYPRT 0
              Gonadorelin hydrochloride 0
              IPQVWRDWFKLP 0
              JNK inhibitor I 0
              KGKGKGKGKGENPAVHFFKNIVTPRTP 0
              KGKGKGKGKGENPVVAFFKNIVTPRTP 0
              KGKGKGKGKGENPVVHFFFNIVTPRTP 0
              KGKGKGKGKGENPVVHFFKNIVTPRTP 0
              KGKGKGKGKGENPVVHFFYNIVTPRTP 0
              LSM-37009 0
              LSM-37015 0
              LSM-37045 0
              LSM-37094 0
              LSM-37129 0
              LSM-37138 0
              LSM-37175 0
              LSM-37192 0
              LSM-37213 0
              Mirabamide C 0
              Mirabamide G 0
              Mirabamide H 0
              N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 0
              N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
              Neurokinin A 0
              Neurokinin B 0
              P-factor 0
              QINTAKWWKTHF 0
              QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
              Rac1 Inhibitor W56 0
              STAT3 inhibitor peptide 0
              Streptomyces coelicolor calcium-dependent antibiotic CDA4b 0
              VSWKTWFPNLAV 0
              Vaby A 0
              Vaby B 0
              Vaby C 0
              Vaby D 0
              Vaby E 0
              Varv E 0
              WHWLQLKPGQPMY 0
              YIIKGLFWDPAC + 0
              YIIKGVFWDPAC + 0
              YSPFHKWFPSMH 0
              abarelix 0
              afamelanotide 0
              albiglutide 0
              amoxicilloyl polylysine 0
              amyloid-beta + 0
              astressin 0
              astressin 2B 0
              bacitracin A + 0
              benzylpenicilloyl polylysine 0
              beta-endorphin 0
              bivalirudin 0
              calcitonin 0
              calcitonin (human synthetic) 0
              calcitonin (pork natural) 0
              calpastatin peptide Ac 184-210 0
              carperitide 0
              cathelicidin + 0
              corticorelin 0
              corticotropin 1
              corticotropin-releasing hormone + 0
              cosyntropin 0
              cyanophycin macromolecule + 0
              defensin + 0
              degarelix 0
              dermaseptin s3(1-16)-NH2 0
              desirudin 0
              elcatonin 0
              elf18 0
              enfuvirtide 0
              exendin-3 0
              exendin-4 0
              ganirelix 0
              gastrin + 0
              ghrelin 0
              insulin + 0
              kisspeptin-54 0
              koshikamide A2 0
              lantibiotic + 0
              lepirudin 0
              liraglutide 0
              lixisenatide 0
              mastoparans + 2
              melittin 1
              nesiritide 0
              nociceptin 0
              omega-conotoxin GVIA 0
              p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 0
              penicilloyl polylysine 0
              peptide YY 0
              poly(glycyl-L-arginine) 0
              pramlintide 0
              protein polypeptide chain + 0
              secretin human 0
              semaglutide 0
              sermorelin 0
              teduglutide 0
              teriparatide 0
              terlipressin 0
              tesamorelin 0
              thymalfasin 0
Path 2
Term Annotations click to browse term
  CHEBI ontology 402
    subatomic particle 402
      composite particle 402
        hadron 402
          baryon 402
            nucleon 402
              atomic nucleus 402
                atom 402
                  main group element atom 395
                    p-block element atom 395
                      carbon group element atom 383
                        carbon atom 382
                          organic molecular entity 382
                            organic group 315
                              organic divalent group 314
                                organodiyl group 314
                                  carbonyl group 314
                                    carbonyl compound 314
                                      carboxylic acid 278
                                        carboacyl group 216
                                          univalent carboacyl group 216
                                            carbamoyl group 214
                                              carboxamide 214
                                                peptide 21
                                                  polypeptide 3
                                                    (12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
                                                    (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
                                                    (4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 0
                                                    Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
                                                    Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 0
                                                    Arthrofactin 0
                                                    CIGB-300 0
                                                    DASKALRSSGMP 0
                                                    DKATIGFEVQEE 0
                                                    DSGEGDFLAEGGGVR 0
                                                    ENPAVHFFKNIVTPRTP 0
                                                    ENPVVAFFKNIVTPRTP 0
                                                    ENPVVHFFFNIVTPRTP 0
                                                    ENPVVHFFKNIVTPRTP 0
                                                    ENPVVHFFYNIVTPRTP 0
                                                    FPAWFTKLYPRT 0
                                                    Gonadorelin hydrochloride 0
                                                    IPQVWRDWFKLP 0
                                                    JNK inhibitor I 0
                                                    KGKGKGKGKGENPAVHFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVAFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFFNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFYNIVTPRTP 0
                                                    LSM-37009 0
                                                    LSM-37015 0
                                                    LSM-37045 0
                                                    LSM-37094 0
                                                    LSM-37129 0
                                                    LSM-37138 0
                                                    LSM-37175 0
                                                    LSM-37192 0
                                                    LSM-37213 0
                                                    Mirabamide C 0
                                                    Mirabamide G 0
                                                    Mirabamide H 0
                                                    N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 0
                                                    N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
                                                    Neurokinin A 0
                                                    Neurokinin B 0
                                                    P-factor 0
                                                    QINTAKWWKTHF 0
                                                    QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
                                                    Rac1 Inhibitor W56 0
                                                    STAT3 inhibitor peptide 0
                                                    Streptomyces coelicolor calcium-dependent antibiotic CDA4b 0
                                                    VSWKTWFPNLAV 0
                                                    Vaby A 0
                                                    Vaby B 0
                                                    Vaby C 0
                                                    Vaby D 0
                                                    Vaby E 0
                                                    Varv E 0
                                                    WHWLQLKPGQPMY 0
                                                    YIIKGLFWDPAC + 0
                                                    YIIKGVFWDPAC + 0
                                                    YSPFHKWFPSMH 0
                                                    abarelix 0
                                                    afamelanotide 0
                                                    albiglutide 0
                                                    amoxicilloyl polylysine 0
                                                    amyloid-beta + 0
                                                    astressin 0
                                                    astressin 2B 0
                                                    bacitracin A + 0
                                                    benzylpenicilloyl polylysine 0
                                                    beta-endorphin 0
                                                    bivalirudin 0
                                                    calcitonin 0
                                                    calcitonin (human synthetic) 0
                                                    calcitonin (pork natural) 0
                                                    calpastatin peptide Ac 184-210 0
                                                    carperitide 0
                                                    cathelicidin + 0
                                                    corticorelin 0
                                                    corticotropin 1
                                                    corticotropin-releasing hormone + 0
                                                    cosyntropin 0
                                                    cyanophycin macromolecule + 0
                                                    defensin + 0
                                                    degarelix 0
                                                    dermaseptin s3(1-16)-NH2 0
                                                    desirudin 0
                                                    elcatonin 0
                                                    elf18 0
                                                    enfuvirtide 0
                                                    exendin-3 0
                                                    exendin-4 0
                                                    ganirelix 0
                                                    gastrin + 0
                                                    ghrelin 0
                                                    insulin + 0
                                                    kisspeptin-54 0
                                                    koshikamide A2 0
                                                    lantibiotic + 0
                                                    lepirudin 0
                                                    liraglutide 0
                                                    lixisenatide 0
                                                    mastoparans + 2
                                                    melittin 1
                                                    nesiritide 0
                                                    nociceptin 0
                                                    omega-conotoxin GVIA 0
                                                    p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 0
                                                    penicilloyl polylysine 0
                                                    peptide YY 0
                                                    poly(glycyl-L-arginine) 0
                                                    pramlintide 0
                                                    protein polypeptide chain + 0
                                                    secretin human 0
                                                    semaglutide 0
                                                    sermorelin 0
                                                    teduglutide 0
                                                    teriparatide 0
                                                    terlipressin 0
                                                    tesamorelin 0
                                                    thymalfasin 0
paths to the root