Send us a Message



Submit Data |  Help |  Video Tutorials |  News |  Publications |  Download |  REST API |  Citing RGD |  Contact   

CHEBI ONTOLOGY - ANNOTATIONS

The Chemical Entities of Biological Interest (ChEBI) ontology is downloaded weekly from EMBL-EBI at http://www.ebi.ac.uk/chebi/. The data is made available under the Creative Commons License (CC BY 3.0, http://creativecommons.org/licenses/by/3.0/). For more information see: Degtyarenko et al. (2008) ChEBI: a database and ontology for chemical entities of biological interest. Nucleic Acids Res. 36, D344–D350.

Term:polypeptide
go back to main search page
Accession:CHEBI:15841 term browser browse the term
Definition:A peptide containing ten or more amino acid residues.
Synonyms:exact_synonym: polypeptides
 related_synonym: Formula=C4H6N2O3R2(C2H2NOR)n;   Polypeptid;   polipeptido
 alt_id: CHEBI:14860;   CHEBI:8314
 xref: KEGG:C00403



show annotations for term's descendants           Sort by:
 
afamelanotide term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Mc4r melanocortin 4 receptor increases activity ISO MSH, 4-Nle-7-Phe-alpha- results in increased activity of MC4R protein CTD PMID:17713970 NCBI chr18:60,419,832...60,421,719
Ensembl chr18:60,419,832...60,421,719
JBrowse link
astressin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Agt angiotensinogen multiple interactions EXP [astressin co-treated with AGT protein] results in increased phosphorylation of FOS protein; [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK1 protein; [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK3 protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of CRH protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of FOS protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK1 protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK3 protein]; astressin promotes the reaction [AGT protein results in increased expression of CRH protein] CTD PMID:33872574 NCBI chr19:52,529,139...52,549,618
Ensembl chr19:52,529,185...52,540,977
JBrowse link
G Crh corticotropin releasing hormone multiple interactions EXP [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of CRH protein]; astressin promotes the reaction [AGT protein results in increased expression of CRH protein] CTD PMID:33872574 NCBI chr 2:102,143,055...102,144,919
Ensembl chr 2:102,143,055...102,144,919
JBrowse link
G Crhr1 corticotropin releasing hormone receptor 1 multiple interactions ISO astressin binds to and results in decreased activity of CRHR1 protein CTD PMID:16014403 NCBI chr10:89,040,203...89,083,481
Ensembl chr10:89,040,203...89,083,481
JBrowse link
G Crhr2 corticotropin releasing hormone receptor 2 multiple interactions ISO astressin binds to and results in decreased activity of CRHR2 protein CTD PMID:16014403 NCBI chr 4:84,222,897...84,265,924
Ensembl chr 4:84,224,002...84,265,904
JBrowse link
G Cyp11a1 cytochrome P450, family 11, subfamily a, polypeptide 1 decreases expression ISO astressin results in decreased expression of CYP11A1 mRNA CTD PMID:16014403 NCBI chr 8:58,422,807...58,434,342
Ensembl chr 8:58,404,669...58,434,338
JBrowse link
G Cyp17a1 cytochrome P450, family 17, subfamily a, polypeptide 1 decreases expression ISO astressin results in decreased expression of CYP17A1 mRNA CTD PMID:16014403 NCBI chr 1:245,535,462...245,543,148
Ensembl chr 1:245,535,462...245,541,573
JBrowse link
G Fos Fos proto-oncogene, AP-1 transcription factor subunit multiple interactions EXP [astressin co-treated with AGT protein] results in increased phosphorylation of FOS protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of FOS protein] CTD PMID:33872574 NCBI chr 6:105,121,170...105,124,036
Ensembl chr 6:105,121,170...105,124,036
JBrowse link
G Il1rn interleukin 1 receptor antagonist multiple interactions EXP [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of CRH protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of FOS protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK1 protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK3 protein] CTD PMID:33872574 NCBI chr 3:7,111,567...7,127,451
Ensembl chr 3:7,111,550...7,127,445
JBrowse link
G Mapk1 mitogen activated protein kinase 1 multiple interactions EXP [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK1 protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK1 protein] CTD PMID:33872574 NCBI chr11:83,957,813...84,023,629
Ensembl chr11:83,957,813...84,023,616
JBrowse link
G Mapk3 mitogen activated protein kinase 3 multiple interactions EXP [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK3 protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK3 protein] CTD PMID:33872574 NCBI chr 1:181,366,646...181,372,863
Ensembl chr 1:181,366,637...181,372,863
JBrowse link
G Star steroidogenic acute regulatory protein decreases expression ISO astressin results in decreased expression of STAR mRNA CTD PMID:16014403 NCBI chr16:66,267,094...66,274,368
Ensembl chr16:66,264,807...66,271,672
JBrowse link
G Sult2a1 sulfotransferase family 2A member 1 decreases expression ISO astressin results in decreased expression of SULT2A1 mRNA CTD PMID:16014403 NCBI chr 1:75,451,178...75,508,142 JBrowse link
G Ucn urocortin multiple interactions
decreases response to substance
EXP astressin inhibits the reaction [UCN protein inhibits the reaction [Thapsigargin results in increased uptake of Calcium]]; astressin inhibits the reaction [UCN protein inhibits the reaction [Thapsigargin results in increased uptake of Manganese]]
astressin results in decreased susceptibility to UCN protein
CTD PMID:17885217 PMID:20237592 NCBI chr 6:25,238,120...25,238,950
Ensembl chr 6:25,238,120...25,238,950
JBrowse link
astressin 2B term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Ccl2 C-C motif chemokine ligand 2 multiple interactions ISO astressin-2B inhibits the reaction [tcdA protein, Clostridium difficile results in increased expression of CCL2 mRNA] CTD PMID:16920976 NCBI chr10:67,005,424...67,007,222
Ensembl chr10:67,005,424...67,007,226
JBrowse link
G Cxcl3 C-X-C motif chemokine ligand 3 multiple interactions ISO astressin-2B inhibits the reaction [tcdA protein, Clostridium difficile results in increased expression of CXCL1 mRNA] CTD PMID:16920976 NCBI chr14:17,270,146...17,289,458
Ensembl chr14:17,270,146...17,289,511
JBrowse link
G Il6 interleukin 6 multiple interactions EXP astressin-2B promotes the reaction [Lipopolysaccharides results in increased secretion of IL6 protein] CTD PMID:12746300 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178
JBrowse link
G Pomc proopiomelanocortin increases secretion EXP astressin-2B results in increased secretion of POMC protein alternative form CTD PMID:12746300 NCBI chr 6:26,939,844...26,945,666
Ensembl chr 6:26,939,837...26,945,664
JBrowse link
G Tnf tumor necrosis factor multiple interactions EXP astressin-2B promotes the reaction [Lipopolysaccharides results in increased secretion of TNF protein] CTD PMID:12746300 NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629
JBrowse link
G Ucn urocortin decreases activity EXP astressin-2B results in decreased activity of UCN protein CTD PMID:12010772 NCBI chr 6:25,238,120...25,238,950
Ensembl chr 6:25,238,120...25,238,950
JBrowse link
bacitracin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G A2m alpha-2-macroglobulin increases expression EXP Bacitracin results in increased expression of A2M mRNA CTD PMID:18289764 NCBI chr 4:154,897,770...154,947,787
Ensembl chr 4:154,897,877...154,947,786
JBrowse link
G Ache acetylcholinesterase multiple interactions ISO Bacitracin binds to and results in decreased metabolism of and results in decreased secretion of ACHE protein CTD PMID:23047022 NCBI chr12:19,407,359...19,413,713
Ensembl chr12:19,407,360...19,413,651
JBrowse link
G Aldh1a1 aldehyde dehydrogenase 1 family, member A1 increases expression EXP Bacitracin results in increased expression of ALDH1A1 mRNA CTD PMID:18289764 NCBI chr 1:218,000,470...218,152,962
Ensembl chr 1:218,042,127...218,152,961
JBrowse link
G Anxa5 annexin A5 increases expression EXP Bacitracin results in increased expression of ANXA5 mRNA CTD PMID:18289764 NCBI chr 2:119,314,007...119,344,703
Ensembl chr 2:119,314,007...119,353,369
JBrowse link
G Bmp1 bone morphogenetic protein 1 increases expression EXP Bacitracin results in increased expression of BMP1 mRNA CTD PMID:18289764 NCBI chr15:45,551,603...45,595,862
Ensembl chr15:45,551,603...45,595,776
JBrowse link
G Bmp4 bone morphogenetic protein 4 decreases expression EXP Bacitracin results in decreased expression of BMP4 mRNA CTD PMID:18289764 NCBI chr15:19,618,538...19,633,494
Ensembl chr15:19,618,542...19,623,306
JBrowse link
G Calb1 calbindin 1 decreases expression EXP Bacitracin results in decreased expression of CALB1 mRNA CTD PMID:18289764 NCBI chr 5:29,375,624...29,402,532
Ensembl chr 5:29,375,642...29,402,431
JBrowse link
G Cat catalase decreases expression EXP Bacitracin results in decreased expression of CAT mRNA CTD PMID:18289764 NCBI chr 3:89,842,393...89,874,577
Ensembl chr 3:89,842,399...89,874,478
JBrowse link
G Ccn1 cellular communication network factor 1 affects expression EXP Bacitracin affects the expression of CCN1 mRNA CTD PMID:18289764 NCBI chr 2:234,562,410...234,565,370
Ensembl chr 2:234,562,408...234,565,484
JBrowse link
G Ccnd1 cyclin D1 increases expression EXP Bacitracin results in increased expression of CCND1 mRNA CTD PMID:18289764 NCBI chr 1:200,089,002...200,098,524
Ensembl chr 1:200,089,002...200,098,602
JBrowse link
G Ccng1 cyclin G1 increases expression EXP Bacitracin results in increased expression of CCNG1 mRNA CTD PMID:18289764 NCBI chr10:25,176,231...25,182,604
Ensembl chr10:25,176,234...25,181,641
JBrowse link
G Cd24 CD24 molecule increases expression EXP Bacitracin results in increased expression of CD24 mRNA CTD PMID:18289764 NCBI chr20:47,074,353...47,079,662
Ensembl chr20:47,073,512...47,079,662
JBrowse link
G Cd44 CD44 molecule (Indian blood group) increases expression EXP Bacitracin results in increased expression of CD44 mRNA CTD PMID:18289764 NCBI chr 3:89,155,850...89,244,615
Ensembl chr 3:89,157,058...89,244,620
JBrowse link
G Clu clusterin increases expression EXP Bacitracin results in increased expression of CLU mRNA CTD PMID:18289764 NCBI chr15:40,161,068...40,200,315
Ensembl chr15:40,174,617...40,200,315
JBrowse link
G Cp ceruloplasmin increases expression EXP Bacitracin results in increased expression of CP mRNA CTD PMID:18289764 NCBI chr 2:102,439,433...102,498,075
Ensembl chr 2:102,439,624...102,498,075
JBrowse link
G Ctss cathepsin S increases expression EXP Bacitracin results in increased expression of CTSS mRNA CTD PMID:18289764 NCBI chr 2:183,089,192...183,114,483
Ensembl chr 2:183,086,437...183,114,483
JBrowse link
G Cyp2d4 cytochrome P450, family 2, subfamily d, polypeptide 4 decreases expression EXP Bacitracin results in decreased expression of CYP2D22 mRNA CTD PMID:18289764 NCBI chr 7:113,882,584...113,891,754
Ensembl chr 7:113,881,618...113,891,759
JBrowse link
G Egf epidermal growth factor decreases expression EXP Bacitracin results in decreased expression of EGF mRNA CTD PMID:18289764 NCBI chr 2:218,219,408...218,302,370
Ensembl chr 2:218,219,415...218,302,064
JBrowse link
G Fn1 fibronectin 1 increases expression EXP Bacitracin results in increased expression of FN1 mRNA CTD PMID:18289764 NCBI chr 9:73,196,044...73,264,695
Ensembl chr 9:73,196,044...73,264,678
JBrowse link
G G6pc1 glucose-6-phosphatase catalytic subunit 1 decreases expression EXP Bacitracin results in decreased expression of G6PC1 mRNA CTD PMID:18289764 NCBI chr10:86,307,400...86,318,766 JBrowse link
G Gadd45a growth arrest and DNA-damage-inducible, alpha increases expression EXP Bacitracin results in increased expression of GADD45A mRNA CTD PMID:18289764 NCBI chr 4:96,154,789...96,157,091
Ensembl chr 4:96,154,789...96,157,115
JBrowse link
G Ghr growth hormone receptor affects expression EXP Bacitracin affects the expression of GHR mRNA CTD PMID:18289764 NCBI chr 2:52,541,452...52,804,960
Ensembl chr 2:52,542,594...52,804,735
JBrowse link
G Glul glutamate-ammonia ligase increases expression EXP Bacitracin results in increased expression of GLUL mRNA CTD PMID:18289764 NCBI chr13:65,969,064...66,035,121
Ensembl chr13:66,025,630...66,035,108
JBrowse link
G Gstm2 glutathione S-transferase mu 2 increases expression EXP Bacitracin results in increased expression of GSTM2 mRNA CTD PMID:18289764 NCBI chr 2:195,624,015...195,628,774 JBrowse link
G Havcr1 hepatitis A virus cellular receptor 1 increases expression EXP Bacitracin results in increased expression of HAVCR1 mRNA CTD PMID:18289764 NCBI chr10:31,118,667...31,151,730
Ensembl chr10:31,119,088...31,151,698
JBrowse link
G Hmox1 heme oxygenase 1 increases expression EXP Bacitracin results in increased expression of HMOX1 mRNA CTD PMID:18289764 NCBI chr19:13,466,287...13,474,082
Ensembl chr19:13,467,244...13,474,079
JBrowse link
G Hmox2 heme oxygenase 2 increases expression EXP Bacitracin results in increased expression of HMOX2 mRNA CTD PMID:18289764 NCBI chr10:10,797,076...10,831,178
Ensembl chr10:10,797,055...10,831,148
JBrowse link
G Igfbp1 insulin-like growth factor binding protein 1 increases expression EXP Bacitracin results in increased expression of IGFBP1 mRNA CTD PMID:18289764 NCBI chr14:82,047,415...82,052,482
Ensembl chr14:82,047,415...82,052,482
JBrowse link
G Igkc immunoglobulin kappa constant decreases expression
increases expression
EXP Bacitracin results in decreased expression of IGKC mRNA
Bacitracin results in increased expression of IGKC mRNA
CTD PMID:18289764
G Jun Jun proto-oncogene, AP-1 transcription factor subunit increases expression EXP Bacitracin results in increased expression of JUN mRNA CTD PMID:18289764 NCBI chr 5:109,894,175...109,897,268
Ensembl chr 5:109,893,145...109,897,656
JBrowse link
G Klk1b3 kallikrein 1-related peptidase B3 decreases expression EXP Bacitracin results in decreased expression of NGFG mRNA CTD PMID:18289764 NCBI chr 1:94,709,105...94,713,308
Ensembl chr 1:94,709,105...94,713,308
JBrowse link
G Lcn2 lipocalin 2 increases expression EXP Bacitracin results in increased expression of LCN2 mRNA CTD PMID:18289764 NCBI chr 3:15,680,688...15,684,033
Ensembl chr 3:15,680,687...15,684,095
JBrowse link
G Mgp matrix Gla protein increases expression EXP Bacitracin results in increased expression of MGP mRNA CTD PMID:18289764 NCBI chr 4:169,766,290...169,769,612
Ensembl chr 4:169,766,279...169,769,667
JBrowse link
G Mt1 metallothionein 1 increases expression EXP Bacitracin results in increased expression of MT1A mRNA CTD PMID:18289764 NCBI chr19:10,826,032...10,827,048 JBrowse link
G Nphs2 NPHS2 stomatin family member, podocin decreases expression EXP Bacitracin results in decreased expression of NPHS2 mRNA CTD PMID:18289764 NCBI chr13:68,448,720...68,461,312
Ensembl chr13:68,448,926...68,461,313
JBrowse link
G Oat ornithine aminotransferase increases expression EXP Bacitracin results in increased expression of OAT mRNA CTD PMID:18289764 NCBI chr 1:187,347,862...187,367,644
Ensembl chr 1:187,347,865...187,367,682
JBrowse link
G Rgn regucalcin decreases expression EXP Bacitracin results in decreased expression of RGN mRNA CTD PMID:18289764 NCBI chr  X:1,619,030...1,634,456
Ensembl chr  X:1,619,032...1,634,450
JBrowse link
G Slc22a1 solute carrier family 22 member 1 decreases expression EXP Bacitracin results in decreased expression of SLC22A1 mRNA CTD PMID:18289764 NCBI chr 1:48,076,657...48,103,679
Ensembl chr 1:48,076,666...48,103,678
JBrowse link
G Slc22a6 solute carrier family 22 member 6 decreases expression EXP Bacitracin results in decreased expression of SLC22A6 mRNA CTD PMID:18289764 NCBI chr 1:205,522,579...205,531,179
Ensembl chr 1:205,522,729...205,531,173
JBrowse link
G Spp1 secreted phosphoprotein 1 increases expression EXP Bacitracin results in increased expression of SPP1 mRNA CTD PMID:18289764 NCBI chr14:5,308,885...5,315,120
Ensembl chr14:5,308,885...5,315,162
JBrowse link
G Timp1 TIMP metallopeptidase inhibitor 1 increases expression EXP Bacitracin results in increased expression of TIMP1 mRNA CTD PMID:18289764 NCBI chr  X:1,212,969...1,217,714
Ensembl chr  X:1,212,972...1,217,664
JBrowse link
G Tmsb10 thymosin, beta 10 increases expression EXP Bacitracin results in increased expression of TMSB10 mRNA CTD PMID:18289764 NCBI chr 4:105,009,959...105,011,095
Ensembl chr 4:105,009,212...105,011,028
JBrowse link
G Vcam1 vascular cell adhesion molecule 1 increases expression EXP Bacitracin results in increased expression of VCAM1 mRNA CTD PMID:18289764 NCBI chr 2:204,038,120...204,057,852
Ensembl chr 2:204,038,114...204,057,958
JBrowse link
G Vegfa vascular endothelial growth factor A decreases expression EXP Bacitracin results in decreased expression of VEGFA mRNA CTD PMID:18289764 NCBI chr 9:14,955,300...14,970,641
Ensembl chr 9:14,955,300...14,970,641
JBrowse link
G Vim vimentin increases expression EXP Bacitracin results in increased expression of VIM mRNA CTD PMID:18289764 NCBI chr17:76,668,701...76,677,186
Ensembl chr17:76,668,647...76,677,187
JBrowse link
beta-endorphin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Agt angiotensinogen increases abundance
multiple interactions
EXP AGT protein results in increased abundance of beta-Endorphin
IL1RN protein inhibits the reaction [AGT protein results in increased abundance of beta-Endorphin]
CTD PMID:33872574 NCBI chr19:52,529,139...52,549,618
Ensembl chr19:52,529,185...52,540,977
JBrowse link
G Crh corticotropin releasing hormone decreases secretion
increases secretion
multiple interactions
EXP beta-Endorphin results in decreased secretion of CRH protein
CRF protein results in increased secretion of beta-Endorphin
adinazolam inhibits the reaction [CRF protein results in increased secretion of beta-Endorphin]; beta-Endorphin inhibits the reaction [Nitroprusside results in increased secretion of CRH protein]; Naltrexone inhibits the reaction [beta-Endorphin results in decreased secretion of CRH protein]
CTD PMID:1480515 PMID:3031743 NCBI chr 2:102,143,055...102,144,919
Ensembl chr 2:102,143,055...102,144,919
JBrowse link
G Il1rn interleukin 1 receptor antagonist multiple interactions EXP IL1RN protein inhibits the reaction [AGT protein results in increased abundance of beta-Endorphin] CTD PMID:33872574 NCBI chr 3:7,111,567...7,127,451
Ensembl chr 3:7,111,550...7,127,445
JBrowse link
G Il2 interleukin 2 decreases expression ISO beta-Endorphin results in decreased expression of IL2 mRNA CTD PMID:23965172 NCBI chr 2:120,004,862...120,009,566
Ensembl chr 2:120,004,862...120,009,566
JBrowse link
G Il4 interleukin 4 increases expression ISO beta-Endorphin results in increased expression of IL4 mRNA CTD PMID:23965172 NCBI chr10:37,771,203...37,776,750
Ensembl chr10:37,771,203...37,776,750
JBrowse link
G Mapk1 mitogen activated protein kinase 1 increases phosphorylation ISO beta-Endorphin results in increased phosphorylation of MAPK1 protein CTD PMID:23965172 NCBI chr11:83,957,813...84,023,629
Ensembl chr11:83,957,813...84,023,616
JBrowse link
G Mapk3 mitogen activated protein kinase 3 increases phosphorylation ISO beta-Endorphin results in increased phosphorylation of MAPK3 protein CTD PMID:23965172 NCBI chr 1:181,366,646...181,372,863
Ensembl chr 1:181,366,637...181,372,863
JBrowse link
G Nfkbia NFKB inhibitor alpha increases expression ISO beta-Endorphin results in increased expression of NFKBIA protein CTD PMID:22258905 NCBI chr 6:72,858,713...72,861,941
Ensembl chr 6:72,858,712...72,861,941
JBrowse link
G Pld2 phospholipase D2 increases activity ISO beta-Endorphin results in increased activity of PLD2 protein CTD PMID:23965172 NCBI chr10:55,256,326...55,274,192
Ensembl chr10:55,256,359...55,272,808
JBrowse link
G Usp15 ubiquitin specific peptidase 15 increases expression ISO beta-Endorphin results in increased expression of USP15 mRNA CTD PMID:24068670 NCBI chr 7:58,756,714...58,848,778
Ensembl chr 7:58,756,872...58,848,721
JBrowse link
bivalirudin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Crp C-reactive protein decreases expression ISO bivalirudin results in decreased expression of CRP protein CTD PMID:16118546 NCBI chr13:85,131,635...85,175,179
Ensembl chr13:85,124,977...85,175,178
JBrowse link
G F2 coagulation factor II multiple interactions
decreases activity
increases cleavage
ISO bivalirudin binds to and results in decreased activity of F2 protein; bivalirudin inhibits the reaction [F2 protein results in increased expression of SELP protein]
bivalirudin results in decreased activity of F2 protein
F2 protein results in increased cleavage of bivalirudin
CTD PMID:1290488 PMID:8456428 PMID:15080313 PMID:15155122 PMID:16084352 More... NCBI chr 3:77,596,196...77,609,486
Ensembl chr 3:77,596,198...77,609,486
JBrowse link
G F2r coagulation factor II (thrombin) receptor decreases activity ISO bivalirudin results in decreased activity of F2R protein CTD PMID:19124943 NCBI chr 2:26,869,343...26,885,856
Ensembl chr 2:26,868,404...26,885,870
JBrowse link
G F2rl3 F2R like thrombin or trypsin receptor 3 decreases activity ISO bivalirudin results in decreased activity of F2RL3 protein CTD PMID:19124943 NCBI chr16:17,117,441...17,119,434
Ensembl chr16:17,117,441...17,119,472
JBrowse link
G Mpo myeloperoxidase decreases expression ISO bivalirudin results in decreased expression of MPO protein CTD PMID:18701766 NCBI chr10:72,594,458...72,608,862
Ensembl chr10:72,594,661...72,604,819
JBrowse link
G P2ry12 purinergic receptor P2Y12 affects response to substance ISO P2RY12 affects the susceptibility to bivalirudin CTD PMID:14597584 NCBI chr 2:143,481,468...143,523,340
Ensembl chr 2:143,481,430...143,523,361
JBrowse link
G Pdgfb platelet derived growth factor subunit B affects expression EXP bivalirudin affects the expression of PDGFB protein CTD PMID:10754393 PMID:11316950 NCBI chr 7:111,539,444...111,557,984
Ensembl chr 7:111,540,345...111,557,984
JBrowse link
G Selp selectin P multiple interactions ISO bivalirudin inhibits the reaction [F2 protein results in increased expression of SELP protein] CTD PMID:16845256 NCBI chr13:76,476,229...76,511,846
Ensembl chr13:76,476,295...76,511,845
JBrowse link
calcitonin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Hcrt hypocretin neuropeptide precursor decreases expression EXP salmon calcitonin results in decreased expression of HCRT mRNA CTD PMID:12686383 NCBI chr10:85,689,992...85,691,206
Ensembl chr10:85,689,465...85,691,210
JBrowse link
G Pmch pro-melanin-concentrating hormone decreases expression EXP salmon calcitonin results in decreased expression of PMCH mRNA CTD PMID:12686383 NCBI chr 7:22,511,934...22,513,250
Ensembl chr 7:22,511,934...22,513,250
JBrowse link
corticotropin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Ada adenosine deaminase increases activity ISO Adrenocorticotropic Hormone results in increased activity of ADA protein CTD PMID:8868375 NCBI chr 3:152,398,745...152,422,854
Ensembl chr 3:152,398,747...152,447,088
JBrowse link
G Calca calcitonin-related polypeptide alpha increases abundance EXP CALCA protein results in increased abundance of Adrenocorticotropic Hormone CTD PMID:12639925 NCBI chr 1:168,878,212...168,883,176
Ensembl chr 1:168,878,214...168,883,105
JBrowse link
G Cnp 2',3'-cyclic nucleotide 3' phosphodiesterase decreases activity EXP Adrenocorticotropic Hormone results in decreased activity of CNP protein CTD PMID:3030154 NCBI chr10:85,511,164...85,517,723
Ensembl chr10:85,511,160...85,517,720
JBrowse link
G Crh corticotropin releasing hormone multiple interactions
increases secretion
EXP Astemizole inhibits the reaction [Corticosterone inhibits the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone]]; Corticosterone inhibits the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone]; E 4031 inhibits the reaction [Corticosterone inhibits the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone]]; Tetraethylammonium promotes the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone] CTD PMID:18835572 NCBI chr 2:102,143,055...102,144,919
Ensembl chr 2:102,143,055...102,144,919
JBrowse link
G Cyp17a1 cytochrome P450, family 17, subfamily a, polypeptide 1 affects abundance ISO CYP17A1 protein affects the abundance of Adrenocorticotropic Hormone CTD PMID:18645707 NCBI chr 1:245,535,462...245,543,148
Ensembl chr 1:245,535,462...245,541,573
JBrowse link
G Gh1 growth hormone 1 multiple interactions ISO Adrenocorticotropic Hormone inhibits the reaction [INS protein results in increased secretion of GH1 protein] CTD PMID:3008584 NCBI chr10:91,228,102...91,230,079
Ensembl chr10:91,228,103...91,230,078
JBrowse link
G Htr2a 5-hydroxytryptamine receptor 2A multiple interactions
affects expression
EXP Bupropion inhibits the reaction [Adrenocorticotropic Hormone affects the expression of HTR2A mRNA] CTD PMID:18239281 NCBI chr15:49,950,035...50,022,188
Ensembl chr15:49,950,804...50,020,928
JBrowse link
G Ins2 insulin 2 multiple interactions ISO Adrenocorticotropic Hormone inhibits the reaction [INS protein results in increased secretion of GH1 protein] CTD PMID:3008584 NCBI chr 1:197,843,277...197,992,522
Ensembl chr 1:197,843,281...197,864,775
JBrowse link
G Nr3c1 nuclear receptor subfamily 3, group C, member 1 affects abundance ISO NR3C1 gene polymorphism affects the abundance of Adrenocorticotropic Hormone CTD PMID:17716631 NCBI chr18:31,271,681...31,393,320
Ensembl chr18:31,271,681...31,393,375
JBrowse link
G Ppp1r1b protein phosphatase 1, regulatory (inhibitor) subunit 1B multiple interactions ISO Cocaine promotes the reaction [PPP1R1B protein results in increased abundance of Adrenocorticotropic Hormone] CTD PMID:10516482 NCBI chr10:83,347,731...83,356,775
Ensembl chr10:83,347,731...83,356,775
JBrowse link
G Ucn2 urocortin 2 increases abundance ISO UCN2 protein results in increased abundance of Adrenocorticotropic Hormone CTD PMID:16330704 NCBI chr 8:109,637,624...109,639,173
Ensembl chr 8:109,638,285...109,639,172
JBrowse link
corticotropin-releasing hormone term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Crhr1 corticotropin releasing hormone receptor 1 increases expression
decreases activity
multiple interactions
EXP Corticotropin-Releasing Hormone results in increased expression of CRHR1 mRNA
Corticotropin-Releasing Hormone results in decreased activity of CRHR1 protein
Pentobarbital inhibits the reaction [Corticotropin-Releasing Hormone results in decreased activity of CRHR1 protein]; Pentobarbital inhibits the reaction [Corticotropin-Releasing Hormone results in increased expression of CRHR1 mRNA]
CTD PMID:12093084 NCBI chr10:89,040,203...89,083,481
Ensembl chr10:89,040,203...89,083,481
JBrowse link
cosyntropin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Hsd11b2 hydroxysteroid 11-beta dehydrogenase 2 decreases expression ISO Cosyntropin results in decreased expression of HSD11B2 protein CTD PMID:11082157 NCBI chr19:33,397,656...33,402,899
Ensembl chr19:33,397,656...33,402,899
JBrowse link
enfuvirtide term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Cyp1a2 cytochrome P450, family 1, subfamily a, polypeptide 2 affects activity ISO enfuvirtide affects the activity of CYP1A2 protein CTD PMID:15656696 NCBI chr 8:58,075,367...58,082,255
Ensembl chr 8:58,075,367...58,082,312
JBrowse link
G Cyp2c6v1 cytochrome P450, family 2, subfamily C, polypeptide 6, variant 1 affects activity ISO enfuvirtide affects the activity of CYP2C19 protein CTD PMID:15656696 NCBI chr 1:237,938,521...237,976,238
Ensembl chr 1:237,693,094...238,057,596
JBrowse link
G Cyp2e1 cytochrome P450, family 2, subfamily e, polypeptide 1 affects activity ISO enfuvirtide affects the activity of CYP2E1 protein CTD PMID:15656696 NCBI chr 1:195,840,330...195,850,728
Ensembl chr 1:195,840,058...195,864,023
JBrowse link
ganirelix term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Lhb luteinizing hormone subunit beta decreases secretion
decreases expression
ISO ganirelix results in decreased secretion of LHB protein
ganirelix results in decreased expression of LHB protein
CTD PMID:17579202 PMID:21273126 NCBI chr 1:95,898,269...95,901,973
Ensembl chr 1:95,900,984...95,901,972
Ensembl chr 1:95,900,984...95,901,972
JBrowse link
gastrin-17 term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Birc2 baculoviral IAP repeat-containing 2 multiple interactions ISO [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC2 CTD PMID:17704804 NCBI chr 8:4,968,856...4,989,325
Ensembl chr 8:4,968,842...4,988,732
JBrowse link
G Birc3 baculoviral IAP repeat-containing 3 multiple interactions ISO [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC3 CTD PMID:17704804 NCBI chr 8:5,000,844...5,028,470
Ensembl chr 8:5,000,845...5,015,802
JBrowse link
G Cckbr cholecystokinin B receptor multiple interactions ISO [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC2; [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC3; [gastrin 17 co-treated with CCKBR protein] results in increased expression of IER3 mRNA CTD PMID:17704804 NCBI chr 1:159,771,733...159,781,738
Ensembl chr 1:159,771,733...159,814,881
JBrowse link
G Ier3 immediate early response 3 multiple interactions ISO [gastrin 17 co-treated with CCKBR protein] results in increased expression of IER3 mRNA CTD PMID:17704804 NCBI chr20:2,928,378...2,929,582
Ensembl chr20:2,928,378...2,929,583
JBrowse link
G Nfkb1 nuclear factor kappa B subunit 1 decreases activity ISO gastrin 17 results in decreased activity of NFKB1 protein CTD PMID:15623601 NCBI chr 2:224,016,214...224,132,135
Ensembl chr 2:224,016,214...224,110,404
JBrowse link
G Rela RELA proto-oncogene, NF-kB subunit decreases activity ISO gastrin 17 results in decreased activity of RELA protein CTD PMID:15623601 NCBI chr 1:202,925,001...202,935,484
Ensembl chr 1:202,924,945...202,935,484
JBrowse link
G Sele selectin E decreases expression ISO gastrin 17 results in decreased expression of SELE protein CTD PMID:15623601 NCBI chr13:76,402,841...76,412,741
Ensembl chr13:76,403,304...76,412,741
JBrowse link
ghrelin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Cnr1 cannabinoid receptor 1 multiple interactions EXP Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in decreased expression of CNR1 mRNA] CTD PMID:31468622 NCBI chr 5:48,408,543...48,436,099
Ensembl chr 5:48,408,574...48,435,099
JBrowse link
G Glp1r glucagon-like peptide 1 receptor multiple interactions EXP Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in decreased expression of GLP1R mRNA] CTD PMID:31468622 NCBI chr20:8,972,004...9,010,241
Ensembl chr20:8,972,004...9,010,241
JBrowse link
G Mir33 microRNA 33 multiple interactions EXP Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in increased expression of MIR33A mRNA] CTD PMID:31468622 NCBI chr 7:113,713,855...113,713,923
Ensembl chr 7:113,713,855...113,713,923
JBrowse link
insulin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Insr insulin receptor decreases expression EXP insulin decreases expression of hepatic mRNA in streptozocin treated rats RGD PMID:1280238 RGD:15036814 NCBI chr12:1,193,193...1,330,976
Ensembl chr12:1,197,100...1,330,883
JBrowse link
insulin (human) term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Tnf tumor necrosis factor increases secretion EXP Novorapid inhibits the reaction [Lipopolysaccharide increases secretion of Tnf protein in serum] RGD PMID:18078960 RGD:15023464 NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629
JBrowse link
lepirudin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G F2 coagulation factor II multiple interactions ISO lepirudin binds to and results in decreased activity of F2 protein CTD PMID:15080313 PMID:18449412 NCBI chr 3:77,596,196...77,609,486
Ensembl chr 3:77,596,198...77,609,486
JBrowse link
liraglutide term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Acaca acetyl-CoA carboxylase alpha multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in increased phosphorylation of ACACA protein] CTD PMID:32898504 NCBI chr10:69,014,261...69,276,453
Ensembl chr10:69,014,170...69,276,457
JBrowse link
G Adipoq adiponectin, C1Q and collagen domain containing multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased secretion of ADIPOQ protein] CTD PMID:32898504 NCBI chr11:77,721,912...77,735,644
Ensembl chr11:77,721,912...77,735,564
JBrowse link
G Akt1 AKT serine/threonine kinase 1 multiple interactions ISO Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of AKT1 protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of AKT1 protein]] CTD PMID:31173752 NCBI chr 6:131,713,716...131,735,319
Ensembl chr 6:131,713,720...131,733,921
JBrowse link
G Bax BCL2 associated X, apoptosis regulator multiple interactions ISO
EXP
Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased expression of BAX protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased expression of BAX protein]]
Liraglutide inhibits the reaction [Methotrexate results in increased expression of BAX protein]
CTD PMID:31173752 PMID:31362085 NCBI chr 1:95,940,001...95,945,407
Ensembl chr 1:95,938,808...95,945,368
JBrowse link
G Bcl2 BCL2, apoptosis regulator multiple interactions ISO
EXP
Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased expression of BCL2 protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased expression of BCL2 protein]]
Liraglutide inhibits the reaction [Methotrexate results in decreased expression of BCL2 protein]
CTD PMID:31173752 PMID:31362085 NCBI chr13:22,689,783...22,853,920 JBrowse link
G Casp3 caspase 3 multiple interactions ISO
EXP
Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased cleavage of CASP3 protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased cleavage of CASP3 protein]]
Liraglutide inhibits the reaction [Methotrexate results in increased expression of and results in increased activity of CASP3 protein]
CTD PMID:31173752 PMID:31362085 NCBI chr16:45,662,910...45,681,171
Ensembl chr16:45,662,910...45,684,648
JBrowse link
G Cpt1a carnitine palmitoyltransferase 1A multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased expression of CPT1A protein] CTD PMID:32898504 NCBI chr 1:200,564,634...200,627,059
Ensembl chr 1:200,565,613...200,627,055
JBrowse link
G Creb1 cAMP responsive element binding protein 1 multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in decreased phosphorylation of CREB1 protein] CTD PMID:31362085 NCBI chr 9:65,903,511...65,972,562
Ensembl chr 9:65,903,547...65,970,816
JBrowse link
G Dgat1 diacylglycerol O-acyltransferase 1 multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased expression of DGAT1 protein] CTD PMID:32898504 NCBI chr 7:108,223,860...108,235,413
Ensembl chr 7:108,218,524...108,234,299
JBrowse link
G Glp1r glucagon-like peptide 1 receptor multiple interactions
increases expression
EXP
ISO
Liraglutide inhibits the reaction [nitrofen results in decreased expression of GLP1R mRNA]
Liraglutide binds to and results in increased activity of GLP1R protein
Liraglutide results in increased expression of GLP1R mRNA
CTD PMID:23354098 PMID:23471186 NCBI chr20:8,972,004...9,010,241
Ensembl chr20:8,972,004...9,010,241
JBrowse link
G Gpt glutamic--pyruvic transaminase multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in increased expression of GPT protein] CTD PMID:31362085 NCBI chr 7:108,416,646...108,419,495
Ensembl chr 7:108,416,642...108,419,494
JBrowse link
G Gsk3b glycogen synthase kinase 3 beta multiple interactions ISO Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of GSK3B protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of GSK3B protein]] CTD PMID:31173752 NCBI chr11:62,498,997...62,648,665
Ensembl chr11:62,504,316...62,648,646
JBrowse link
G Hmox1 heme oxygenase 1 multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in increased expression of HMOX1 protein] CTD PMID:31362085 NCBI chr19:13,466,287...13,474,082
Ensembl chr19:13,467,244...13,474,079
JBrowse link
G Il1b interleukin 1 beta multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased expression of CPT1A protein]; Liraglutide inhibits the reaction [IL1B protein results in decreased expression of DGAT1 protein]; Liraglutide inhibits the reaction [IL1B protein results in decreased expression of PPARGC1A protein]; Liraglutide inhibits the reaction [IL1B protein results in decreased secretion of ADIPOQ protein]; Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 mRNA]; Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 protein]; Liraglutide inhibits the reaction [IL1B protein results in increased phosphorylation of ACACA protein] CTD PMID:32898504 NCBI chr 3:116,577,005...116,583,386
Ensembl chr 3:116,577,010...116,583,415
JBrowse link
G Il6 interleukin 6 multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in increased expression of IL6 protein] CTD PMID:31362085 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178
JBrowse link
G Mapt microtubule-associated protein tau multiple interactions ISO Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of MAPT protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of MAPT protein]] CTD PMID:31173752 NCBI chr10:89,138,644...89,236,137
Ensembl chr10:89,138,627...89,236,129
JBrowse link
G Nfe2l2 nuclear factor, erythroid 2-like 2 multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in decreased expression of NFE2L2 protein] CTD PMID:31362085 NCBI chr 3:60,594,239...60,621,785
Ensembl chr 3:60,594,242...60,621,737
JBrowse link
G Nox4 NADPH oxidase 4 multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 mRNA]; Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 protein] CTD PMID:32898504 NCBI chr 1:140,900,886...141,078,844
Ensembl chr 1:140,901,097...141,077,406
JBrowse link
G Ppargc1a PPARG coactivator 1 alpha multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased expression of PPARGC1A protein] CTD PMID:32898504 NCBI chr14:58,860,752...59,516,525
Ensembl chr14:58,861,144...59,512,656
JBrowse link
G Ptgs2 prostaglandin-endoperoxide synthase 2 multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in increased expression of PTGS2 protein] CTD PMID:31362085 NCBI chr13:62,164,080...62,169,770
Ensembl chr13:62,163,932...62,172,188
JBrowse link
G Rela RELA proto-oncogene, NF-kB subunit multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in increased expression of RELA protein] CTD PMID:31362085 NCBI chr 1:202,925,001...202,935,484
Ensembl chr 1:202,924,945...202,935,484
JBrowse link
G Sftpa1 surfactant protein A1 increases expression
multiple interactions
EXP Liraglutide results in increased expression of SFTPA1 mRNA
Liraglutide inhibits the reaction [nitrofen results in decreased expression of SFTPA1 mRNA]; Liraglutide inhibits the reaction [nitrofen results in decreased expression of SFTPA1 protein]
CTD PMID:23354098 NCBI chr16:17,008,180...17,011,686
Ensembl chr16:17,008,180...17,011,685
JBrowse link
G Sftpb surfactant protein B increases expression EXP Liraglutide results in increased expression of SFTPB mRNA CTD PMID:23354098 NCBI chr 4:104,359,303...104,368,439
Ensembl chr 4:104,359,396...104,368,436
JBrowse link
G Tnf tumor necrosis factor multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in increased expression of TNF protein] CTD PMID:31362085 NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629
JBrowse link
G Tsc1 TSC complex subunit 1 multiple interactions EXP Liraglutide reverses the reaction [palmitate fatty acid decreases expression of tsc1 protein in hepatocytes] RGD PMID:31787541 RGD:25823196 NCBI chr 3:11,969,547...12,018,591
Ensembl chr 3:11,979,729...12,015,674
JBrowse link
mastoparan term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Abca1 ATP binding cassette subfamily A member 1 multiple interactions
increases phosphorylation
ISO mastoparan inhibits the reaction [APOA1 protein affects the reaction [ABCA1 protein results in increased export of Cholesterol]]
mastoparan results in increased phosphorylation of ABCA1 protein
CTD PMID:16118212 NCBI chr 5:67,678,267...67,801,162
Ensembl chr 5:67,681,297...67,801,170
JBrowse link
G Apoa1 apolipoprotein A1 multiple interactions ISO mastoparan inhibits the reaction [APOA1 protein affects the reaction [ABCA1 protein results in increased export of Cholesterol]] CTD PMID:16118212 NCBI chr 8:46,527,251...46,529,035
Ensembl chr 8:46,527,144...46,529,035
JBrowse link
G Calm1 calmodulin 1 affects binding EXP mastoparan binds to CALM1 protein CTD PMID:17098364 NCBI chr 6:119,487,691...119,495,759
Ensembl chr 6:119,487,621...119,498,227
JBrowse link
G Il6 interleukin 6 multiple interactions ISO mastoparan inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 protein] CTD PMID:21255617 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178
JBrowse link
G Nos1 nitric oxide synthase 1 decreases activity EXP mastoparan results in decreased activity of NOS1 protein CTD PMID:17098364 NCBI chr12:38,615,111...38,795,492
Ensembl chr12:38,626,714...38,710,945
JBrowse link
melittin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Adam10 ADAM metallopeptidase domain 10 multiple interactions ISO Melitten results in increased cleavage of and results in increased activity of ADAM10 protein CTD PMID:22613720 NCBI chr 8:71,346,008...71,477,889
Ensembl chr 8:71,345,837...71,477,889
JBrowse link
G Adam17 ADAM metallopeptidase domain 17 multiple interactions ISO Melitten results in increased cleavage of and results in increased activity of ADAM17 protein CTD PMID:22613720 NCBI chr 6:40,872,936...40,920,700
Ensembl chr 6:40,872,856...40,920,639
JBrowse link
G Aim2 absent in melanoma 2 multiple interactions ISO AIM2 protein promotes the reaction [Melitten results in increased expression of IL18 protein]; AIM2 protein promotes the reaction [Melitten results in increased expression of IL1B protein] CTD PMID:22973906 NCBI chr13:85,865,206...85,906,996
Ensembl chr13:85,866,284...85,906,975
JBrowse link
G Akt1 AKT serine/threonine kinase 1 multiple interactions ISO Melitten inhibits the reaction [TNF protein results in increased phosphorylation of AKT1 protein] CTD PMID:22926441 NCBI chr 6:131,713,716...131,735,319
Ensembl chr 6:131,713,720...131,733,921
JBrowse link
G Alox5 arachidonate 5-lipoxygenase increases activity ISO Melitten results in increased activity of ALOX5 protein CTD PMID:18475477 NCBI chr 4:149,531,329...149,578,696
Ensembl chr 4:149,531,515...149,578,743
JBrowse link
G Apaf1 apoptotic peptidase activating factor 1 multiple interactions EXP
ISO
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]
Melitten affects the reaction [TGFB1 protein affects the localization of APAF1 protein]
CTD PMID:21354845 PMID:21871910 NCBI chr 7:25,494,143...25,579,540
Ensembl chr 7:25,494,609...25,579,540
JBrowse link
G Bax BCL2 associated X, apoptosis regulator multiple interactions
increases expression
ISO Melitten affects the reaction [TGFB1 protein affects the localization of BAX protein]
Melitten analog results in increased expression of BAX mRNA; Melitten analog results in increased expression of BAX protein; Melitten results in increased expression of BAX protein
CTD PMID:21871910 PMID:22027265 PMID:29387245 NCBI chr 1:95,940,001...95,945,407
Ensembl chr 1:95,938,808...95,945,368
JBrowse link
G Bcl2 BCL2, apoptosis regulator decreases expression
multiple interactions
ISO
EXP
Melitten analog results in decreased expression of BCL2 mRNA; Melitten analog results in decreased expression of BCL2 protein; Melitten results in decreased expression of BCL2 protein
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]
Melitten affects the reaction [TGFB1 protein affects the localization of BCL2 protein]
CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:22027265 PMID:29387245 NCBI chr13:22,689,783...22,853,920 JBrowse link
G Birc3 baculoviral IAP repeat-containing 3 decreases expression ISO Melitten results in decreased expression of BIRC3 protein CTD PMID:21456063 NCBI chr 8:5,000,844...5,028,470
Ensembl chr 8:5,000,845...5,015,802
JBrowse link
G Calm1 calmodulin 1 affects binding EXP Melitten binds to CALM1 protein CTD PMID:17098364 NCBI chr 6:119,487,691...119,495,759
Ensembl chr 6:119,487,621...119,498,227
JBrowse link
G Casp3 caspase 3 increases expression
multiple interactions
ISO
EXP
Melitten analog results in increased expression of CASP3 mRNA; Melitten analog results in increased expression of CASP3 protein; Melitten results in increased expression of CASP3 protein modified form
Melitten results in increased cleavage of and results in increased activity of CASP3 protein
Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]
Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP3 protein]
CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:22027265 PMID:29387245 NCBI chr16:45,662,910...45,681,171
Ensembl chr16:45,662,910...45,684,648
JBrowse link
G Casp8 caspase 8 increases expression ISO Melitten results in increased expression of CASP8 protein modified form CTD PMID:22027265 NCBI chr 9:60,263,863...60,312,542
Ensembl chr 9:60,264,075...60,312,542
JBrowse link
G Casp9 caspase 9 multiple interactions
increases expression
ISO
EXP
Melitten results in increased cleavage of and results in increased activity of CASP9 protein
Melitten analog results in increased expression of CASP9 mRNA; Melitten analog results in increased expression of CASP9 protein
Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein]
Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP9 protein]
CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:29387245 NCBI chr 5:154,108,872...154,126,628
Ensembl chr 5:154,109,046...154,126,626
JBrowse link
G Ccnd1 cyclin D1 decreases expression ISO Melitten results in decreased expression of CCND1 protein CTD PMID:26189965 NCBI chr 1:200,089,002...200,098,524
Ensembl chr 1:200,089,002...200,098,602
JBrowse link
G Cdh1 cadherin 1 increases secretion ISO Melitten results in increased secretion of CDH1 protein CTD PMID:22613720 NCBI chr19:34,492,371...34,561,775
Ensembl chr19:34,492,371...34,561,775
JBrowse link
G Cdk4 cyclin-dependent kinase 4 decreases expression ISO Melitten results in decreased expression of CDK4 protein CTD PMID:26189965 NCBI chr 7:62,885,647...62,889,562
Ensembl chr 7:62,883,105...62,942,403
JBrowse link
G Chrna7 cholinergic receptor nicotinic alpha 7 subunit multiple interactions
increases activity
EXP Bungarotoxins inhibits the reaction [Melitten results in increased activity of CHRNA7 protein]; methyllycaconitine inhibits the reaction [Melitten results in increased activity of CHRNA7 protein] CTD PMID:19910175 NCBI chr 1:116,715,286...116,837,223
Ensembl chr 1:116,714,711...116,837,240
JBrowse link
G Chuk component of inhibitor of nuclear factor kappa B kinase complex multiple interactions
affects binding
ISO [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of and results in increased activity of CHUK protein]
Melitten binds to CHUK protein
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; Dithiothreitol inhibits the reaction [Melitten binds to and results in decreased activity of CHUK protein]; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Glutathione inhibits the reaction [Melitten binds to and results in decreased activity of CHUK protein]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Hydrogen Peroxide inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [Thioacetamide results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased activity of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of CHUK protein]
CTD PMID:17067557 PMID:21969711 NCBI chr 1:242,959,539...242,995,066
Ensembl chr 1:242,959,760...242,995,065
JBrowse link
G Cryab crystallin, alpha B multiple interactions EXP Melitten promotes the reaction [sodium arsenite results in increased expression of CRYAB mRNA]; Melitten promotes the reaction [sodium arsenite results in increased expression of CRYAB protein] CTD PMID:8591993 NCBI chr 8:51,093,441...51,099,161
Ensembl chr 8:51,093,441...51,099,157
JBrowse link
G Drd2 dopamine receptor D2 multiple interactions ISO Melitten inhibits the reaction [Spiperone binds to DRD2 protein] CTD PMID:20969853 NCBI chr 8:49,708,903...49,772,888
Ensembl chr 8:49,708,927...49,772,875
JBrowse link
G Egfr epidermal growth factor receptor increases activity ISO Melitten results in increased activity of EGFR protein CTD PMID:22613720 NCBI chr14:91,176,931...91,349,722
Ensembl chr14:91,177,067...91,344,382
JBrowse link
G Fas Fas cell surface death receptor increases expression ISO Melitten results in increased expression of FAS mRNA; Melitten results in increased expression of FAS protein CTD PMID:16974113 PMID:17854560 NCBI chr 1:231,798,963...231,832,591
Ensembl chr 1:231,798,960...231,832,591
JBrowse link
G Fgf2 fibroblast growth factor 2 decreases expression ISO Melitten results in decreased expression of FGF2 mRNA CTD PMID:18076793 NCBI chr 2:120,236,328...120,290,673
Ensembl chr 2:120,236,328...120,291,221
JBrowse link
G Fn1 fibronectin 1 multiple interactions ISO Melitten inhibits the reaction [Thioacetamide results in increased expression of FN1 protein] CTD PMID:21969711 NCBI chr 9:73,196,044...73,264,695
Ensembl chr 9:73,196,044...73,264,678
JBrowse link
G Gap43 growth associated protein 43 increases phosphorylation ISO Melitten results in increased phosphorylation of GAP43 protein CTD PMID:9852580 NCBI chr11:58,376,371...58,470,047
Ensembl chr11:58,376,371...58,470,045
JBrowse link
G Gli1 GLI family zinc finger 1 decreases expression ISO Melitten results in decreased expression of GLI1 protein CTD PMID:26189965 NCBI chr 7:63,156,926...63,169,579
Ensembl chr 7:63,156,926...63,169,251
JBrowse link
G Gnrh1 gonadotropin releasing hormone 1 multiple interactions ISO GNRH1 protein results in increased susceptibility to [Melitten binds to CGB3 protein] CTD PMID:19261682 NCBI chr15:41,972,482...41,976,690
Ensembl chr15:41,972,905...41,973,581
Ensembl chr15:41,972,905...41,973,581
JBrowse link
G Hrh2 histamine receptor H 2 increases response to substance
increases activity
multiple interactions
EXP HRH2 protein results in increased susceptibility to Melitten
Melitten results in increased activity of HRH2 protein
Ranitidine inhibits the reaction [Melitten results in increased activity of HRH2 protein]
CTD PMID:22995146 NCBI chr17:10,368,355...10,407,791
Ensembl chr17:10,368,298...10,407,631
JBrowse link
G Htr1a 5-hydroxytryptamine receptor 1A multiple interactions ISO Melitten inhibits the reaction [HTR1A protein inhibits the reaction [Colforsin results in increased abundance of Cyclic AMP]] CTD PMID:11356925 NCBI chr 2:36,694,174...36,695,442
Ensembl chr 2:36,694,174...36,695,442
JBrowse link
G Icam1 intercellular adhesion molecule 1 decreases expression ISO Melitten results in decreased expression of ICAM1 protein CTD PMID:12697458 NCBI chr 8:19,553,063...19,565,438
Ensembl chr 8:19,553,645...19,565,438
JBrowse link
G Ikbkb inhibitor of nuclear factor kappa B kinase subunit beta multiple interactions
affects binding
ISO Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]
Melitten binds to IKBKB protein
Dithiothreitol inhibits the reaction [Melitten binds to and results in decreased activity of IKBKB protein]; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Glutathione inhibits the reaction [Melitten binds to and results in decreased activity of IKBKB protein]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Hydrogen Peroxide inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased activity of IKBKB protein]; Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]; Melitten inhibits the reaction [TNF protein results in increased activity of IKBKB protein]
CTD PMID:17067557 NCBI chr16:69,319,487...69,373,251
Ensembl chr16:69,319,554...69,373,250
JBrowse link
G Il18 interleukin 18 increases expression
multiple interactions
ISO Melitten results in increased expression of IL18 protein
AIM2 protein promotes the reaction [Melitten results in increased expression of IL18 protein]
CTD PMID:22973906 NCBI chr 8:50,904,630...50,932,887
Ensembl chr 8:50,906,960...50,932,887
JBrowse link
G Il1b interleukin 1 beta multiple interactions
increases expression
ISO
EXP
AIM2 protein promotes the reaction [Melitten results in increased expression of IL1B protein]
Melitten inhibits the reaction [TNF protein results in increased expression of IL1B protein]
Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of IL1B mRNA]
CTD PMID:17570326 PMID:21969711 PMID:22973906 NCBI chr 3:116,577,005...116,583,386
Ensembl chr 3:116,577,010...116,583,415
JBrowse link
G Il6 interleukin 6 multiple interactions EXP
ISO
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of IL6STP1 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]; Melitten inhibits the reaction [TNF protein results in increased expression of IL6 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein]
Melitten inhibits the reaction [Acetic Acid results in increased expression of IL6 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 mRNA]; Melitten inhibits the reaction [Thioacetamide results in increased expression of IL6 protein]
CTD PMID:17570326 PMID:21354845 PMID:21969711 PMID:33002459 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178
JBrowse link
G Il6r interleukin 6 receptor multiple interactions EXP Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of IL6STP1 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein] CTD PMID:21354845 NCBI chr 2:175,289,157...175,347,719
Ensembl chr 2:175,298,686...175,347,536
JBrowse link
G Jak2 Janus kinase 2 decreases phosphorylation ISO Melitten results in decreased phosphorylation of JAK2 protein CTD PMID:22027265 NCBI chr 1:226,995,334...227,054,381
Ensembl chr 1:226,995,334...227,054,189
JBrowse link
G Jun Jun proto-oncogene, AP-1 transcription factor subunit multiple interactions ISO Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased localization of JUN protein] CTD PMID:20082219 NCBI chr 5:109,894,175...109,897,268
Ensembl chr 5:109,893,145...109,897,656
JBrowse link
G Kdr kinase insert domain receptor decreases expression ISO Melitten results in decreased expression of KDR protein CTD PMID:23110475 NCBI chr14:32,217,871...32,261,018
Ensembl chr14:32,217,871...32,261,018
JBrowse link
G Lhcgr luteinizing hormone/choriogonadotropin receptor multiple interactions ISO LHCGR protein results in increased susceptibility to [Melitten binds to CGB3 protein] CTD PMID:19261682 NCBI chr 6:5,661,871...5,728,109
Ensembl chr 6:5,661,871...5,724,521
JBrowse link
G Mapk1 mitogen activated protein kinase 1 decreases phosphorylation
increases phosphorylation
multiple interactions
ISO
EXP
Melitten results in decreased phosphorylation of MAPK1 protein
Melitten results in increased phosphorylation of MAPK1 protein
Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of MAPK1 protein]
Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of and results in increased activity of MAPK1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK1 protein]; Melitten results in increased phosphorylation of and results in increased activity of MAPK1 protein
CTD PMID:17570326 PMID:17579088 PMID:17654254 PMID:20082219 PMID:22613720 More... NCBI chr11:83,957,813...84,023,629
Ensembl chr11:83,957,813...84,023,616
JBrowse link
G Mapk3 mitogen activated protein kinase 3 multiple interactions
decreases phosphorylation
increases phosphorylation
ISO
EXP
Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of and results in increased activity of MAPK3 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK3 protein]; Melitten results in increased phosphorylation of and results in increased activity of MAPK3 protein
Melitten results in decreased phosphorylation of MAPK3 protein
Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of MAPK3 protein]
Melitten results in increased phosphorylation of MAPK3 protein
CTD PMID:17570326 PMID:17579088 PMID:17654254 PMID:20082219 PMID:22613720 More... NCBI chr 1:181,366,646...181,372,863
Ensembl chr 1:181,366,637...181,372,863
JBrowse link
G Mecp2 methyl CpG binding protein 2 decreases expression ISO Melitten results in decreased expression of MECP2 mRNA; Melitten results in decreased expression of MECP2 protein CTD PMID:26189965 NCBI chr  X:151,781,177...151,844,687
Ensembl chr  X:151,789,930...151,844,689
JBrowse link
G Mmp2 matrix metallopeptidase 2 multiple interactions ISO Melitten inhibits the reaction [TNF protein results in increased secretion of MMP2 protein] CTD PMID:22926441 NCBI chr19:14,154,657...14,182,870
Ensembl chr19:14,154,657...14,182,870
JBrowse link
G Mmp3 matrix metallopeptidase 3 multiple interactions ISO Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of MMP3 protein] CTD PMID:17303203 NCBI chr 8:4,640,397...4,653,963
Ensembl chr 8:4,640,416...4,653,961
JBrowse link
G Mmp9 matrix metallopeptidase 9 multiple interactions ISO Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of and results in increased activity of MMP9 protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of and results in increased secretion of MMP9 protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP9 protein] CTD PMID:19969058 PMID:20082219 PMID:22926441 NCBI chr 3:153,684,158...153,692,118
Ensembl chr 3:153,683,858...153,692,120
JBrowse link
G Nfkb1 nuclear factor kappa B subunit 1 multiple interactions
decreases localization
ISO [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of and results in increased activity of NFKB1 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of NFKB1 protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of NFKB1 protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of NFKB1 protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of NFKB1 protein]]
Melitten results in decreased localization of NFKB1 protein
CTD PMID:15529353 PMID:17067557 PMID:18507870 PMID:21456063 NCBI chr 2:224,016,214...224,132,135
Ensembl chr 2:224,016,214...224,110,404
JBrowse link
G Nfkbia NFKB inhibitor alpha multiple interactions ISO [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]
CTD PMID:15529353 PMID:17067557 PMID:17570326 PMID:18507870 PMID:22926441 NCBI chr 6:72,858,713...72,861,941
Ensembl chr 6:72,858,712...72,861,941
JBrowse link
G Nos1 nitric oxide synthase 1 decreases activity EXP Melitten results in decreased activity of NOS1 protein CTD PMID:17098364 NCBI chr12:38,615,111...38,795,492
Ensembl chr12:38,626,714...38,710,945
JBrowse link
G Nos2 nitric oxide synthase 2 decreases expression
multiple interactions
ISO Melitten results in decreased expression of NOS2 protein
Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[TNF protein results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of NOS2 mRNA]
CTD PMID:15529353 PMID:17067557 PMID:17570326 PMID:21456063 NCBI chr10:63,815,308...63,851,208
Ensembl chr10:63,815,308...63,851,210
JBrowse link
G P2rx7 purinergic receptor P2X 7 increases activity
increases response to substance
ISO Melitten results in increased activity of P2RX7 protein
P2RX7 protein results in increased susceptibility to Melitten
CTD PMID:22613720 NCBI chr12:33,889,709...33,934,168
Ensembl chr12:33,879,745...33,934,619
JBrowse link
G Parp1 poly (ADP-ribose) polymerase 1 multiple interactions ISO Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of PARP1 protein] CTD PMID:21871910 NCBI chr13:92,307,593...92,339,406
Ensembl chr13:92,307,586...92,339,404
JBrowse link
G Pdgfrb platelet derived growth factor receptor beta multiple interactions EXP Melitten results in decreased phosphorylation of and results in decreased activity of PDGFRB protein CTD PMID:17654254 NCBI chr18:54,500,002...54,538,843
Ensembl chr18:54,499,964...54,538,843
JBrowse link
G Pla2g2a phospholipase A2 group IIA multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of PLA2G2A protein] CTD PMID:33002459 NCBI chr 5:151,076,442...151,079,019
Ensembl chr 5:151,076,442...151,079,014
JBrowse link
G Pla2g4a phospholipase A2 group IVA decreases expression ISO Melitten results in decreased expression of PLA2G4A protein CTD PMID:21456063 NCBI chr13:61,877,818...62,022,261
Ensembl chr13:61,877,813...62,022,266
JBrowse link
G Plcg1 phospholipase C, gamma 1 decreases phosphorylation EXP Melitten results in decreased phosphorylation of PLCG1 protein CTD PMID:17654254 NCBI chr 3:149,385,587...149,416,330
Ensembl chr 3:149,385,587...149,416,330
JBrowse link
G Ptch1 patched 1 increases expression ISO Melitten results in increased expression of PTCH1 protein CTD PMID:26189965 NCBI chr17:1,542,705...1,607,730
Ensembl chr17:1,542,877...1,607,333
JBrowse link
G Ptgs2 prostaglandin-endoperoxide synthase 2 multiple interactions
increases expression
decreases expression
ISO [Melitten results in decreased expression of PTGS2 protein] which results in decreased chemical synthesis of Dinoprostone; Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; SB 203580 inhibits the reaction [Melitten results in decreased expression of PTGS2 protein]
Melitten results in increased expression of PTGS2 mRNA; Melitten results in increased expression of PTGS2 protein
[Melitten results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone; Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[TNF protein results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [Acetic Acid results in increased expression of PTGS2 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of PTGS2 mRNA]
CTD PMID:11094054 PMID:11821123 PMID:15529353 PMID:17067557 PMID:17570326 More... NCBI chr13:62,164,080...62,169,770
Ensembl chr13:62,163,932...62,172,188
JBrowse link
G Rab11a RAB11a, member RAS oncogene family multiple interactions ISO Melitten results in decreased localization of [RAB11A protein co-treated with RAB5A protein] CTD PMID:22683840 NCBI chr 8:65,223,698...65,246,461
Ensembl chr 8:65,222,949...65,246,525
JBrowse link
G Rab5a RAB5A, member RAS oncogene family multiple interactions ISO Melitten results in decreased localization of [RAB11A protein co-treated with RAB5A protein]; Melitten results in increased localization of [SLC6A3 protein co-treated with RAB5A protein] CTD PMID:22683840 NCBI chr 9:6,483,906...6,512,877
Ensembl chr 9:6,484,469...6,512,873
JBrowse link
G Rac1 Rac family small GTPase 1 decreases activity ISO Melitten results in decreased activity of RAC1 protein CTD PMID:18506888 NCBI chr12:11,037,028...11,057,251
Ensembl chr12:11,036,698...11,057,251
JBrowse link
G Rela RELA proto-oncogene, NF-kB subunit multiple interactions
decreases localization
ISO
EXP
Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased localization of RELA protein]; Melitten inhibits the reaction [TNF protein affects the localization of RELA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]]
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]
Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]]
Melitten results in decreased localization of RELA protein
CTD PMID:17570326 PMID:18507870 PMID:20082219 PMID:21354845 PMID:21456063 More... NCBI chr 1:202,925,001...202,935,484
Ensembl chr 1:202,924,945...202,935,484
JBrowse link
G Scn10a sodium voltage-gated channel alpha subunit 10 increases expression
multiple interactions
EXP Melitten results in increased expression of SCN10A mRNA; Melitten results in increased expression of SCN10A protein
[Melitten results in increased expression of SCN10A protein] which results in increased transport of Sodium
CTD PMID:23264124 NCBI chr 8:119,350,723...119,462,882
Ensembl chr 8:119,350,724...119,462,614
JBrowse link
G Scn11a sodium voltage-gated channel alpha subunit 11 increases expression
multiple interactions
increases response to substance
EXP Melitten results in increased expression of SCN11A mRNA; Melitten results in increased expression of SCN11A protein
[Melitten results in increased expression of SCN11A protein] which results in increased transport of Sodium
SCN11A protein results in increased susceptibility to Melitten
CTD PMID:23264124 NCBI chr 8:119,495,550...119,567,044
Ensembl chr 8:119,496,769...119,567,044
JBrowse link
G Shh sonic hedgehog signaling molecule decreases expression ISO Melitten results in decreased expression of SHH protein CTD PMID:26189965 NCBI chr 4:6,954,017...6,963,170
Ensembl chr 4:6,954,017...6,963,170
JBrowse link
G Slc6a3 solute carrier family 6 member 3 increases localization
multiple interactions
ISO Melitten results in increased localization of SLC6A3 protein
Cocaine inhibits the reaction [Melitten results in increased localization of SLC6A3 protein]; Melitten inhibits the reaction [2beta-carbomethoxy-3beta-(4-iodophenyl)tropane binds to SLC6A3 protein]; Melitten inhibits the reaction [SLC6A3 protein results in increased uptake of Dopamine]; Melitten results in increased localization of [SLC6A3 protein co-treated with RAB5A protein]
CTD PMID:20969853 PMID:22683840 NCBI chr 1:29,709,443...29,750,413
Ensembl chr 1:29,709,443...29,750,413
JBrowse link
G Stat3 signal transducer and activator of transcription 3 decreases phosphorylation
multiple interactions
ISO
EXP
Melitten results in decreased phosphorylation of STAT3 protein
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]
TNFRSF10A protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]; TNFRSF21 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]; TNFRSF25 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
CTD PMID:21354845 PMID:22027265 NCBI chr10:85,811,206...85,863,057
Ensembl chr10:85,811,218...85,863,057
JBrowse link
G Tbxa2r thromboxane A2 receptor increases response to substance EXP TBXA2R protein results in increased susceptibility to Melitten CTD PMID:16524625 NCBI chr 7:8,383,347...8,390,753
Ensembl chr 7:8,383,378...8,388,176
JBrowse link
G Tgfa transforming growth factor alpha increases secretion ISO Melitten results in increased secretion of TGFA protein CTD PMID:22613720 NCBI chr 4:118,618,043...118,700,897
Ensembl chr 4:118,618,269...118,700,894
JBrowse link
G Tgfb1 transforming growth factor, beta 1 multiple interactions
decreases activity
ISO Melitten affects the reaction [TGFB1 protein affects the localization of APAF1 protein]; Melitten affects the reaction [TGFB1 protein affects the localization of BAX protein]; Melitten affects the reaction [TGFB1 protein affects the localization of BCL2 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP3 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP9 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of PARP1 protein]; Melitten inhibits the reaction [Thioacetamide results in increased expression of TGFB1 protein]
Melitten results in decreased activity of TGFB1 protein
CTD PMID:21871910 PMID:21969711 NCBI chr 1:81,196,532...81,212,848
Ensembl chr 1:81,196,532...81,212,847
JBrowse link
G Tlr4 toll-like receptor 4 multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of TLR4 protein] CTD PMID:33002459 NCBI chr 5:80,145,867...80,159,501
Ensembl chr 5:80,145,826...80,159,628
JBrowse link
G Tnf tumor necrosis factor multiple interactions
decreases secretion
increases expression
ISO
EXP
Melitten inhibits the reaction [TNF protein affects the localization of RELA protein]; Melitten inhibits the reaction [TNF protein results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of AKT1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK3 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP2 protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP9 protein]
Melitten results in decreased secretion of TNF protein
Melitten inhibits the reaction [TNF protein results in increased expression of IL1B protein]; Melitten inhibits the reaction [TNF protein results in increased expression of IL6 protein]
Melitten results in increased expression of TNF mRNA
Melitten inhibits the reaction [[TNF protein results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[TNF protein results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [Acetic Acid results in increased expression of TNF protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of TNF mRNA]; Melitten inhibits the reaction [Thioacetamide results in increased expression of TNF protein]; Melitten inhibits the reaction [TNF protein results in increased activity of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased activity of IKBKB protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]
CTD PMID:11094054 PMID:11821123 PMID:17067557 PMID:17570326 PMID:21969711 More... NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629
JBrowse link
G Tnfrsf10b TNF receptor superfamily member 10b multiple interactions
increases expression
affects response to substance
ISO TNFRSF10A protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
Melitten results in increased expression of TNFRSF10A mRNA
TNFRSF10A protein affects the susceptibility to Melitten
CTD PMID:22027265 NCBI chr15:44,839,818...44,867,582 JBrowse link
G Tnfrsf21 TNF receptor superfamily member 21 increases expression
affects response to substance
multiple interactions
ISO Melitten results in increased expression of TNFRSF21 mRNA
TNFRSF21 protein affects the susceptibility to Melitten
TNFRSF21 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
CTD PMID:22027265 NCBI chr 9:17,879,156...17,954,085
Ensembl chr 9:17,879,156...17,954,085
JBrowse link
G Tnfrsf25 TNF receptor superfamily member 25 increases expression
multiple interactions
affects response to substance
ISO Melitten results in increased expression of TNFRSF25 mRNA
TNFRSF25 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
TNFRSF25 protein affects the susceptibility to Melitten
CTD PMID:22027265 NCBI chr 5:162,621,669...162,626,341
Ensembl chr 5:162,622,075...162,626,341
JBrowse link
G Traf6 TNF receptor associated factor 6 multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of TRAF6 protein] CTD PMID:33002459 NCBI chr 3:87,963,517...87,988,316
Ensembl chr 3:87,963,514...87,983,507
JBrowse link
G Trpv1 transient receptor potential cation channel, subfamily V, member 1 multiple interactions
increases response to substance
increases activity
EXP [Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium; capsazepine inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; capsazepine inhibits the reaction [TRPV1 protein results in increased susceptibility to Melitten]; Indomethacin inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; Masoprocol inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium] CTD PMID:16446039 PMID:21453681 NCBI chr10:57,851,428...57,876,513
Ensembl chr10:57,851,428...57,876,513
JBrowse link
G Vcam1 vascular cell adhesion molecule 1 multiple interactions ISO Melitten inhibits the reaction [Thioacetamide results in increased expression of VCAM1 protein] CTD PMID:21969711 NCBI chr 2:204,038,120...204,057,852
Ensembl chr 2:204,038,114...204,057,958
JBrowse link
G Vegfa vascular endothelial growth factor A multiple interactions
decreases expression
ISO SB 203580 inhibits the reaction [Melitten results in decreased expression of VEGFA protein]
Melitten results in decreased expression of VEGFA mRNA; Melitten results in decreased expression of VEGFA protein
CTD PMID:18076793 PMID:23110475 NCBI chr 9:14,955,300...14,970,641
Ensembl chr 9:14,955,300...14,970,641
JBrowse link
G Xiap X-linked inhibitor of apoptosis decreases expression ISO Melitten results in decreased expression of XIAP protein CTD PMID:21456063 NCBI chr  X:120,890,537...120,938,413
Ensembl chr  X:120,897,907...120,934,700
JBrowse link
Neurokinin A term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Tacr2 tachykinin receptor 2 affects binding ISO Neurokinin A binds to TACR2 protein CTD PMID:15925360 NCBI chr20:30,208,907...30,223,446
Ensembl chr20:30,208,907...30,223,446
JBrowse link
nociceptin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Oprl1 opioid related nociceptin receptor 1 affects binding
multiple interactions
ISO nociceptin binds to OPRL1 protein
Endocannabinoids inhibits the reaction [nociceptin binds to and results in increased activity of OPRL1 protein]; nociceptin binds to and results in increased activity of OPRL1 protein
CTD PMID:20359694 PMID:21866885 PMID:30102254 NCBI chr 3:168,831,934...168,839,920
Ensembl chr 3:168,834,003...168,839,920
JBrowse link
omega-conotoxin GVIA term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Clu clusterin multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [methoxyacetic acid results in increased expression of and results in increased secretion of CLU protein] CTD PMID:14656996 NCBI chr15:40,161,068...40,200,315
Ensembl chr15:40,174,617...40,200,315
JBrowse link
G Fos Fos proto-oncogene, AP-1 transcription factor subunit multiple interactions EXP [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] inhibits the reaction [Potassium Chloride affects the expression of FOS mRNA] CTD PMID:20211981 NCBI chr 6:105,121,170...105,124,036
Ensembl chr 6:105,121,170...105,124,036
JBrowse link
G Kcna1 potassium voltage-gated channel subfamily A member 1 multiple interactions EXP [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] promotes the reaction [Potassium Chloride results in increased expression of KCNA1 mRNA] CTD PMID:20211981 NCBI chr 4:159,464,223...159,472,905
Ensembl chr 4:159,464,188...159,472,682
JBrowse link
G Kcnc3 potassium voltage-gated channel subfamily C member 3 multiple interactions EXP [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] inhibits the reaction [Potassium Chloride results in increased expression of KCNC3 mRNA] CTD PMID:20211981 NCBI chr 1:95,080,960...95,095,165
Ensembl chr 1:95,080,960...95,095,160
JBrowse link
G Sct secretin multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [Potassium Chloride results in increased secretion of SCT protein] CTD PMID:16888165 NCBI chr 1:196,382,941...196,383,635
Ensembl chr 1:196,382,856...196,383,658
JBrowse link
G Snca synuclein alpha multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [SNCA protein results in increased uptake of Calcium] CTD PMID:17179863 NCBI chr 4:89,696,420...89,797,240
Ensembl chr 4:89,696,420...89,796,262
JBrowse link
G Tac1 tachykinin, precursor 1 multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [Potassium results in increased secretion of TAC1 protein modified form] CTD PMID:2325850 NCBI chr 4:35,679,183...35,687,180
Ensembl chr 4:35,679,704...35,687,178
JBrowse link
PR-39 term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Icam1 intercellular adhesion molecule 1 multiple interactions ISO PR 39 inhibits the reaction [TNF protein results in increased expression of ICAM1 protein] CTD PMID:12388057 NCBI chr 8:19,553,063...19,565,438
Ensembl chr 8:19,553,645...19,565,438
JBrowse link
G Sele selectin E multiple interactions ISO PR 39 inhibits the reaction [TNF protein results in increased expression of SELE protein] CTD PMID:12388057 NCBI chr13:76,402,841...76,412,741
Ensembl chr13:76,403,304...76,412,741
JBrowse link
G Tnf tumor necrosis factor multiple interactions ISO PR 39 inhibits the reaction [TNF protein results in increased expression of ICAM1 protein]; PR 39 inhibits the reaction [TNF protein results in increased expression of SELE protein]; PR 39 inhibits the reaction [TNF protein results in increased expression of VCAM1 protein] CTD PMID:12388057 NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629
JBrowse link
G Vcam1 vascular cell adhesion molecule 1 multiple interactions ISO PR 39 inhibits the reaction [TNF protein results in increased expression of VCAM1 protein] CTD PMID:12388057 NCBI chr 2:204,038,120...204,057,852
Ensembl chr 2:204,038,114...204,057,958
JBrowse link
royal jelly term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Bcl2 BCL2, apoptosis regulator multiple interactions ISO royal jelly inhibits the reaction [Nicotine results in decreased expression of BCL2 mRNA] CTD PMID:30896085 NCBI chr13:22,689,783...22,853,920 JBrowse link
G Casp3 caspase 3 multiple interactions ISO royal jelly inhibits the reaction [Nicotine results in increased expression of CASP3 mRNA] CTD PMID:30896085 NCBI chr16:45,662,910...45,681,171
Ensembl chr16:45,662,910...45,684,648
JBrowse link
G Cat catalase multiple interactions EXP
ISO
royal jelly inhibits the reaction [Cisplatin results in decreased activity of CAT protein]
royal jelly inhibits the reaction [Nicotine results in decreased activity of CAT protein]
CTD PMID:20369241 PMID:30896085 NCBI chr 3:89,842,393...89,874,577
Ensembl chr 3:89,842,399...89,874,478
JBrowse link
G Esr1 estrogen receptor 1 multiple interactions
increases activity
affects binding
ISO Estradiol inhibits the reaction [royal jelly binds to ESR1 protein]; royal jelly binds to and results in increased activity of ESR1 protein; royal jelly inhibits the reaction [Estradiol binds to ESR1 protein]
royal jelly results in increased activity of ESR1 protein
CTD PMID:15946813 PMID:17287592 NCBI chr 1:41,106,335...41,499,104
Ensembl chr 1:41,210,475...41,495,002
JBrowse link
G Esr2 estrogen receptor 2 multiple interactions
affects binding
ISO Estradiol inhibits the reaction [royal jelly binds to ESR2 protein]; royal jelly binds to and results in increased activity of ESR2 protein; royal jelly inhibits the reaction [Estradiol binds to ESR2 protein] CTD PMID:15946813 PMID:17287592 NCBI chr 6:94,858,438...94,909,630
Ensembl chr 6:94,809,547...94,908,919
JBrowse link
G Pcna proliferating cell nuclear antigen multiple interactions ISO royal jelly inhibits the reaction [Nicotine results in decreased expression of PCNA protein] CTD PMID:30896085 NCBI chr 3:119,499,039...119,502,911
Ensembl chr 3:119,498,810...119,502,995
JBrowse link
G Tff1 trefoil factor 1 increases expression ISO royal jelly results in increased expression of TFF1 mRNA CTD PMID:15946813 NCBI chr20:9,235,736...9,239,597
Ensembl chr20:9,235,736...9,239,597
JBrowse link
G Tp53 tumor protein p53 multiple interactions ISO royal jelly inhibits the reaction [Nicotine results in increased expression of TRP53 mRNA] CTD PMID:30896085 NCBI chr10:54,300,070...54,311,525
Ensembl chr10:54,300,048...54,311,524
JBrowse link
G Vegfa vascular endothelial growth factor A increases expression ISO
EXP
royal jelly results in increased expression of VEGFA mRNA CTD PMID:15946813 PMID:17287592 NCBI chr 9:14,955,300...14,970,641
Ensembl chr 9:14,955,300...14,970,641
JBrowse link

Term paths to the root
Path 1
Term Annotations click to browse term
  CHEBI ontology 19810
    chemical entity 19810
      molecular entity 19809
        polyatomic entity 19730
          macromolecule 3518
            polypeptide 198
              (12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
              (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
              (4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 0
              Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
              Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 0
              Arthrofactin 0
              CIGB-300 0
              DASKALRSSGMP 0
              DKATIGFEVQEE 0
              DSGEGDFLAEGGGVR 0
              ENPAVHFFKNIVTPRTP 0
              ENPVVAFFKNIVTPRTP 0
              ENPVVHFFFNIVTPRTP 0
              ENPVVHFFKNIVTPRTP 0
              ENPVVHFFYNIVTPRTP 0
              FPAWFTKLYPRT 0
              Gonadorelin hydrochloride 0
              IPQVWRDWFKLP 0
              JNK inhibitor I 0
              KGKGKGKGKGENPAVHFFKNIVTPRTP 0
              KGKGKGKGKGENPVVAFFKNIVTPRTP 0
              KGKGKGKGKGENPVVHFFFNIVTPRTP 0
              KGKGKGKGKGENPVVHFFKNIVTPRTP 0
              KGKGKGKGKGENPVVHFFYNIVTPRTP 0
              LSM-37009 0
              LSM-37015 0
              LSM-37045 0
              LSM-37094 0
              LSM-37129 0
              LSM-37138 0
              LSM-37175 0
              LSM-37192 0
              LSM-37213 0
              Mirabamide C 0
              Mirabamide G 0
              Mirabamide H 0
              N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 0
              N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
              Neurokinin A 1
              Neurokinin B 0
              P-factor 0
              QINTAKWWKTHF 0
              QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
              Rac1 Inhibitor W56 0
              STAT3 inhibitor peptide 0
              Streptomyces coelicolor calcium-dependent antibiotic CDA4b 0
              VSWKTWFPNLAV 0
              Vaby A 0
              Vaby B 0
              Vaby C 0
              Vaby D 0
              Vaby E 0
              Varv E 0
              WHWLQLKPGQPMY 0
              YIIKGLFWDPAC + 0
              YIIKGVFWDPAC + 0
              YSPFHKWFPSMH 0
              abarelix 0
              afamelanotide 1
              albiglutide 0
              amoxicilloyl polylysine 0
              amyloid-beta + 0
              astressin 13
              astressin 2B 6
              bacitracin A + 45
              benzylpenicilloyl polylysine 0
              beta-endorphin 10
              bivalirudin 8
              calcitonin 2
              calcitonin (human synthetic) 0
              calcitonin (pork natural) 0
              calpastatin peptide Ac 184-210 0
              carperitide 0
              cathelicidin + 4
              corticorelin 0
              corticotropin 11
              corticotropin-releasing hormone + 1
              cosyntropin 1
              cyanophycin macromolecule + 0
              defensin + 0
              degarelix 0
              dermaseptin s3(1-16)-NH2 0
              desirudin 0
              elcatonin 0
              elf18 0
              enfuvirtide 3
              exendin-3 0
              exendin-4 0
              ganirelix 1
              gastrin + 7
              ghrelin 3
              insulin + 2
              kisspeptin-54 0
              koshikamide A2 0
              lantibiotic + 0
              lepirudin 1
              liraglutide 25
              lixisenatide 0
              mastoparans + 5
              melittin 79
              nesiritide 0
              nociceptin 1
              omega-conotoxin GVIA 7
              p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 0
              penicilloyl polylysine 0
              peptide YY 0
              poly(glycyl-L-arginine) 0
              pramlintide 0
              protein polypeptide chain + 9
              secretin human 0
              semaglutide 0
              sermorelin 0
              teduglutide 0
              teriparatide 0
              terlipressin 0
              tesamorelin 0
              thymalfasin 0
Path 2
Term Annotations click to browse term
  CHEBI ontology 19810
    subatomic particle 19809
      composite particle 19809
        hadron 19809
          baryon 19809
            nucleon 19809
              atomic nucleus 19809
                atom 19809
                  main group element atom 19706
                    p-block element atom 19706
                      carbon group element atom 19628
                        carbon atom 19618
                          organic molecular entity 19618
                            organic group 18728
                              organic divalent group 18719
                                organodiyl group 18719
                                  carbonyl group 18668
                                    carbonyl compound 18668
                                      carboxylic acid 18365
                                        carboacyl group 17484
                                          univalent carboacyl group 17484
                                            carbamoyl group 17300
                                              carboxamide 17300
                                                peptide 9445
                                                  polypeptide 198
                                                    (12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
                                                    (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
                                                    (4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 0
                                                    Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
                                                    Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 0
                                                    Arthrofactin 0
                                                    CIGB-300 0
                                                    DASKALRSSGMP 0
                                                    DKATIGFEVQEE 0
                                                    DSGEGDFLAEGGGVR 0
                                                    ENPAVHFFKNIVTPRTP 0
                                                    ENPVVAFFKNIVTPRTP 0
                                                    ENPVVHFFFNIVTPRTP 0
                                                    ENPVVHFFKNIVTPRTP 0
                                                    ENPVVHFFYNIVTPRTP 0
                                                    FPAWFTKLYPRT 0
                                                    Gonadorelin hydrochloride 0
                                                    IPQVWRDWFKLP 0
                                                    JNK inhibitor I 0
                                                    KGKGKGKGKGENPAVHFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVAFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFFNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFYNIVTPRTP 0
                                                    LSM-37009 0
                                                    LSM-37015 0
                                                    LSM-37045 0
                                                    LSM-37094 0
                                                    LSM-37129 0
                                                    LSM-37138 0
                                                    LSM-37175 0
                                                    LSM-37192 0
                                                    LSM-37213 0
                                                    Mirabamide C 0
                                                    Mirabamide G 0
                                                    Mirabamide H 0
                                                    N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 0
                                                    N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
                                                    Neurokinin A 1
                                                    Neurokinin B 0
                                                    P-factor 0
                                                    QINTAKWWKTHF 0
                                                    QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
                                                    Rac1 Inhibitor W56 0
                                                    STAT3 inhibitor peptide 0
                                                    Streptomyces coelicolor calcium-dependent antibiotic CDA4b 0
                                                    VSWKTWFPNLAV 0
                                                    Vaby A 0
                                                    Vaby B 0
                                                    Vaby C 0
                                                    Vaby D 0
                                                    Vaby E 0
                                                    Varv E 0
                                                    WHWLQLKPGQPMY 0
                                                    YIIKGLFWDPAC + 0
                                                    YIIKGVFWDPAC + 0
                                                    YSPFHKWFPSMH 0
                                                    abarelix 0
                                                    afamelanotide 1
                                                    albiglutide 0
                                                    amoxicilloyl polylysine 0
                                                    amyloid-beta + 0
                                                    astressin 13
                                                    astressin 2B 6
                                                    bacitracin A + 45
                                                    benzylpenicilloyl polylysine 0
                                                    beta-endorphin 10
                                                    bivalirudin 8
                                                    calcitonin 2
                                                    calcitonin (human synthetic) 0
                                                    calcitonin (pork natural) 0
                                                    calpastatin peptide Ac 184-210 0
                                                    carperitide 0
                                                    cathelicidin + 4
                                                    corticorelin 0
                                                    corticotropin 11
                                                    corticotropin-releasing hormone + 1
                                                    cosyntropin 1
                                                    cyanophycin macromolecule + 0
                                                    defensin + 0
                                                    degarelix 0
                                                    dermaseptin s3(1-16)-NH2 0
                                                    desirudin 0
                                                    elcatonin 0
                                                    elf18 0
                                                    enfuvirtide 3
                                                    exendin-3 0
                                                    exendin-4 0
                                                    ganirelix 1
                                                    gastrin + 7
                                                    ghrelin 3
                                                    insulin + 2
                                                    kisspeptin-54 0
                                                    koshikamide A2 0
                                                    lantibiotic + 0
                                                    lepirudin 1
                                                    liraglutide 25
                                                    lixisenatide 0
                                                    mastoparans + 5
                                                    melittin 79
                                                    nesiritide 0
                                                    nociceptin 1
                                                    omega-conotoxin GVIA 7
                                                    p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 0
                                                    penicilloyl polylysine 0
                                                    peptide YY 0
                                                    poly(glycyl-L-arginine) 0
                                                    pramlintide 0
                                                    protein polypeptide chain + 9
                                                    secretin human 0
                                                    semaglutide 0
                                                    sermorelin 0
                                                    teduglutide 0
                                                    teriparatide 0
                                                    terlipressin 0
                                                    tesamorelin 0
                                                    thymalfasin 0
paths to the root