Submit Data |  Help |  Video Tutorials |  News |  Publications |  FTP Download |  REST API |  Citing RGD |  Contact   

ONTOLOGY REPORT - ANNOTATIONS


Term:peptidyl amide
go back to main search page
Accession:CHEBI:15722 term browser browse the term
Definition:A peptide that has a carbamoyl group at the C-terminus.
Synonyms:related_synonym: Formula=(C2H2NOR)n.C2H5N2OR;   peptidyl amides
 alt_id: CHEBI:14762;   CHEBI:8007
 xref: KEGG:C02179;   MetaCyc:PEPTIDAMIDE-CPD
 cyclic_relationship: is_conjugate_base_of CHEBI:136962


show annotations for term's descendants       view all columns           Sort by:
 
mastoparan term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Abca1 ATP binding cassette subfamily A member 1 JBrowse link 5 69,857,717 69,983,042 RGD:6480464
G Apoa1 apolipoprotein A1 JBrowse link 8 50,525,091 50,526,875 RGD:6480464
G Calm1 calmodulin 1 JBrowse link 6 124,217,241 124,225,292 RGD:6480464
G Il6 interleukin 6 JBrowse link 4 3,043,231 3,047,807 RGD:6480464
G Nos1 nitric oxide synthase 1 JBrowse link 12 44,214,949 44,405,530 RGD:6480464
melittin term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Adam10 ADAM metallopeptidase domain 10 JBrowse link 8 77,107,355 77,237,483 RGD:6480464
G Adam17 ADAM metallopeptidase domain 17 JBrowse link 6 43,400,525 43,448,280 RGD:6480464
G Aim2 absent in melanoma 2 JBrowse link 13 91,919,834 91,963,080 RGD:6480464
G Akt1 AKT serine/threonine kinase 1 JBrowse link 6 137,218,398 137,239,970 RGD:6480464
G Alox5 arachidonate 5-lipoxygenase JBrowse link 4 148,398,004 148,446,308 RGD:6480464
G Apaf1 apoptotic peptidase activating factor 1 JBrowse link 7 31,699,309 31,784,192 RGD:6480464
G Bax BCL2 associated X, apoptosis regulator JBrowse link 1 101,451,801 101,457,207 RGD:6480464
G Bcl2 BCL2, apoptosis regulator JBrowse link 13 26,605,426 26,769,374 RGD:6480464
G Birc3 baculoviral IAP repeat-containing 3 JBrowse link 8 6,048,590 6,076,828 RGD:6480464
G Calm1 calmodulin 1 JBrowse link 6 124,217,241 124,225,292 RGD:6480464
G Casp3 caspase 3 JBrowse link 16 48,845,011 48,863,249 RGD:6480464
G Casp8 caspase 8 JBrowse link 9 65,614,142 65,662,624 RGD:6480464
G Casp9 caspase 9 JBrowse link 5 160,356,211 160,373,774 RGD:6480464
G Ccnd1 cyclin D1 JBrowse link 1 218,090,750 218,100,447 RGD:6480464
G Cdh1 cadherin 1 JBrowse link 19 38,768,467 38,838,395 RGD:6480464
G Cdk4 cyclin-dependent kinase 4 JBrowse link 7 70,345,971 70,352,689 RGD:6480464
G Chrna7 cholinergic receptor nicotinic alpha 7 subunit JBrowse link 1 123,897,341 124,039,263 RGD:6480464
G Chuk component of inhibitor of nuclear factor kappa B kinase complex JBrowse link 1 263,848,829 263,884,354 RGD:6480464
G Cryab crystallin, alpha B JBrowse link 8 55,178,543 55,182,546 RGD:6480464
G Drd2 dopamine receptor D2 JBrowse link 8 53,678,777 53,743,643 RGD:6480464
G Egfr epidermal growth factor receptor JBrowse link 14 99,919,485 100,104,136 RGD:6480464
G Fas Fas cell surface death receptor JBrowse link 1 252,589,785 252,624,790 RGD:6480464
G Fgf2 fibroblast growth factor 2 JBrowse link 2 124,081,072 124,134,133 RGD:6480464
G Fn1 fibronectin 1 JBrowse link 9 78,900,111 78,969,018 RGD:6480464
G Gap43 growth associated protein 43 JBrowse link 11 58,624,198 58,717,916 RGD:6480464
G Gli1 GLI family zinc finger 1 JBrowse link 7 70,620,794 70,633,171 RGD:6480464
G Gnrh1 gonadotropin releasing hormone 1 JBrowse link 15 44,441,856 44,446,064 RGD:6480464
G Hrh2 histamine receptor H 2 JBrowse link 17 10,912,959 10,931,389 RGD:6480464
G Htr1a 5-hydroxytryptamine receptor 1A JBrowse link 2 36,246,628 36,247,896 RGD:6480464
G Icam1 intercellular adhesion molecule 1 JBrowse link 8 22,035,287 22,047,049 RGD:6480464
G Ikbkb inhibitor of nuclear factor kappa B kinase subunit beta JBrowse link 16 74,177,233 74,230,809 RGD:6480464
G Il18 interleukin 18 JBrowse link 8 55,009,666 55,016,286 RGD:6480464
G Il1b interleukin 1 beta JBrowse link 3 121,876,256 121,882,637 RGD:6480464
G Il6 interleukin 6 JBrowse link 4 3,043,231 3,047,807 RGD:6480464
G Il6r interleukin 6 receptor JBrowse link 2 189,196,180 189,255,987 RGD:6480464
G Jak2 Janus kinase 2 JBrowse link 1 247,398,667 247,457,521 RGD:6480464
G Jun Jun proto-oncogene, AP-1 transcription factor subunit JBrowse link 5 114,011,184 114,014,277 RGD:6480464
G Kdr kinase insert domain receptor JBrowse link 14 34,727,677 34,787,127 RGD:6480464
G Lhcgr luteinizing hormone/choriogonadotropin receptor JBrowse link 6 12,493,182 12,554,482 RGD:6480464
G Mapk1 mitogen activated protein kinase 1 JBrowse link 11 88,203,863 88,273,301 RGD:6480464
G Mapk3 mitogen activated protein kinase 3 JBrowse link 1 198,192,773 198,198,975 RGD:6480464
G Mecp2 methyl CpG binding protein 2 JBrowse link X 156,650,389 156,713,813 RGD:6480464
G Mmp2 matrix metallopeptidase 2 JBrowse link 19 15,542,771 15,570,589 RGD:6480464
G Mmp3 matrix metallopeptidase 3 JBrowse link 8 5,676,608 5,698,579 RGD:6480464
G Mmp9 matrix metallopeptidase 9 JBrowse link 3 161,413,410 161,421,473 RGD:6480464
G Nfkb1 nuclear factor kappa B subunit 1 JBrowse link 2 240,773,520 240,890,053 RGD:6480464
G Nfkbia NFKB inhibitor alpha JBrowse link 6 76,267,227 76,270,457 RGD:6480464
G Nos1 nitric oxide synthase 1 JBrowse link 12 44,214,949 44,405,530 RGD:6480464
G Nos2 nitric oxide synthase 2 JBrowse link 10 66,188,290 66,221,621 RGD:6480464
G P2rx7 purinergic receptor P2X 7 JBrowse link 12 39,353,613 39,396,042 RGD:6480464
G Parp1 poly (ADP-ribose) polymerase 1 JBrowse link 13 98,857,255 98,889,444 RGD:6480464
G Pdgfrb platelet derived growth factor receptor beta JBrowse link 18 56,364,586 56,406,381 RGD:6480464
G Pla2g4a phospholipase A2 group IVA JBrowse link 13 67,062,252 67,206,688 RGD:6480464
G Plcg1 phospholipase C, gamma 1 JBrowse link 3 156,727,642 156,758,307 RGD:6480464
G Ptch1 patched 1 JBrowse link 17 1,032,242 1,085,885 RGD:6480464
G Ptgs2 prostaglandin-endoperoxide synthase 2 JBrowse link 13 67,351,230 67,356,920 RGD:6480464
G Rab11a RAB11a, member RAS oncogene family JBrowse link 8 70,192,975 70,215,719 RGD:6480464
G Rab5a RAB5A, member RAS oncogene family JBrowse link 9 5,910 6,065 RGD:6480464
G Rac1 Rac family small GTPase 1 JBrowse link 12 13,090,316 13,111,841 RGD:6480464
G Rela RELA proto-oncogene, NF-kB subunit JBrowse link 1 220,992,770 221,003,249 RGD:6480464
G Scn10a sodium voltage-gated channel alpha subunit 10 JBrowse link 8 128,298,593 128,416,896 RGD:6480464
G Scn11a sodium voltage-gated channel alpha subunit 11 JBrowse link 8 128,450,793 128,527,510 RGD:6480464
G Shh sonic hedgehog signaling molecule JBrowse link 4 718,538 727,691 RGD:6480464
G Slc6a3 solute carrier family 6 member 3 JBrowse link 1 32,323,011 32,363,983 RGD:6480464
G Stat3 signal transducer and activator of transcription 3 JBrowse link 10 88,790,401 88,842,263 RGD:6480464
G Tbxa2r thromboxane A2 receptor JBrowse link 7 11,253,153 11,259,233 RGD:6480464
G Tgfa transforming growth factor alpha JBrowse link 4 117,961,877 118,045,923 RGD:6480464
G Tgfb1 transforming growth factor, beta 1 JBrowse link 1 82,480,875 82,497,196 RGD:6480464
G Tnf tumor necrosis factor JBrowse link 20 5,189,382 5,192,000 RGD:6480464
G Tnfrsf10b tumor necrosis factor receptor superfamily, member 10b JBrowse link 15 51,433,853 51,464,215 RGD:6480464
G Tnfrsf21 TNF receptor superfamily member 21 JBrowse link 9 20,546,159 20,621,051 RGD:6480464
G Tnfrsf25 TNF receptor superfamily member 25 JBrowse link 5 169,288,419 169,293,137 RGD:6480464
G Trpv1 transient receptor potential cation channel, subfamily V, member 1 JBrowse link 10 59,799,123 59,824,208 RGD:6480464
G Vcam1 vascular cell adhesion molecule 1 JBrowse link 2 219,071,193 219,090,931 RGD:6480464
G Vegfa vascular endothelial growth factor A JBrowse link 9 17,340,341 17,355,681 RGD:6480464
G Xiap X-linked inhibitor of apoptosis JBrowse link X 128,409,425 128,455,786 RGD:6480464
omega-conotoxin GVIA term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Clu clusterin JBrowse link 15 42,626,612 42,665,858 RGD:6480464
G Fos Fos proto-oncogene, AP-1 transcription factor subunit JBrowse link 6 109,300,433 109,303,299 RGD:6480464
G Kcna1 potassium voltage-gated channel subfamily A member 1 JBrowse link 4 159,190,781 159,192,526 RGD:6480464
G Kcnc3 potassium voltage-gated channel subfamily C member 3 JBrowse link 1 100,593,453 100,607,874 RGD:6480464
G Sct secretin JBrowse link 1 214,264,865 214,277,437 RGD:6480464
G Snca synuclein alpha JBrowse link 4 90,782,412 90,883,236 RGD:6480464
G Tac1 tachykinin, precursor 1 JBrowse link 4 33,638,853 33,646,819 RGD:6480464

Term paths to the root
Path 1
Term Annotations click to browse term
  CHEBI ontology 19716
    chemical entity 19714
      group 19628
        organic group 18407
          amino-acid residue 9316
            peptide 9315
              peptidyl amide 85
                Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 0
                JNK inhibitor I 0
                QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
                corticotropin-releasing hormone (human) 0
                corticotropin-releasing hormone (ovine) 0
                dermaseptin s3(1-16)-NH2 0
                gastrin-14 0
                kisspeptin-54 0
                lixisenatide 0
                mastoparan 5
                mastoparan-A 0
                mastoparan-AF 0
                mastoparan-B 0
                mastoparan-D 0
                mastoparan-M 0
                mastoparan-V 0
                melittin 76
                omega-conotoxin GVIA 7
                peptide YY 0
                tetragastrin 0
Path 2
Term Annotations click to browse term
  CHEBI ontology 19716
    subatomic particle 19712
      composite particle 19712
        hadron 19712
          baryon 19712
            nucleon 19712
              atomic nucleus 19712
                atom 19712
                  main group element atom 19598
                    p-block element atom 19598
                      carbon group element atom 19486
                        carbon atom 19480
                          organic molecular entity 19480
                            organic group 18407
                              organic divalent group 18397
                                organodiyl group 18397
                                  carbonyl group 18285
                                    carbonyl compound 18285
                                      carboxylic acid 17940
                                        carboacyl group 16948
                                          univalent carboacyl group 16948
                                            carbamoyl group 16630
                                              carboxamide 16630
                                                peptide 9315
                                                  peptidyl amide 85
                                                    Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 0
                                                    JNK inhibitor I 0
                                                    QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
                                                    corticotropin-releasing hormone (human) 0
                                                    corticotropin-releasing hormone (ovine) 0
                                                    dermaseptin s3(1-16)-NH2 0
                                                    gastrin-14 0
                                                    kisspeptin-54 0
                                                    lixisenatide 0
                                                    mastoparan 5
                                                    mastoparan-A 0
                                                    mastoparan-AF 0
                                                    mastoparan-B 0
                                                    mastoparan-D 0
                                                    mastoparan-M 0
                                                    mastoparan-V 0
                                                    melittin 76
                                                    omega-conotoxin GVIA 7
                                                    peptide YY 0
                                                    tetragastrin 0
paths to the root

NHLBI Logo

RGD is funded by grant HL64541 from the National Heart, Lung, and Blood Institute on behalf of the NIH.