Send us a Message



Submit Data |  Help |  Video Tutorials |  News |  Publications |  Download |  REST API |  Citing RGD |  Contact   

CHEBI ONTOLOGY - ANNOTATIONS

The Chemical Entities of Biological Interest (ChEBI) ontology is downloaded weekly from EMBL-EBI at http://www.ebi.ac.uk/chebi/. The data is made available under the Creative Commons License (CC BY 3.0, http://creativecommons.org/licenses/by/3.0/). For more information see: Degtyarenko et al. (2008) ChEBI: a database and ontology for chemical entities of biological interest. Nucleic Acids Res. 36, D344–D350.

Term:peptidyl amide
go back to main search page
Accession:CHEBI:15722 term browser browse the term
Definition:A peptide that has a carbamoyl group at the C-terminus.
Synonyms:related_synonym: Formula=(C2H2NOR)n.C2H5N2OR;   peptidyl amides
 alt_id: CHEBI:14762;   CHEBI:8007
 xref: KEGG:C02179;   MetaCyc:PEPTIDAMIDE-CPD
 cyclic_relationship: is_conjugate_base_of CHEBI:136962



show annotations for term's descendants           Sort by:
mastoparan term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Abca1 ATP binding cassette subfamily A member 1 multiple interactions
increases phosphorylation
ISO mastoparan inhibits the reaction [APOA1 protein affects the reaction [ABCA1 protein results in increased export of Cholesterol]]
mastoparan results in increased phosphorylation of ABCA1 protein
CTD PMID:16118212 NCBI chr 5:67,678,267...67,801,162
Ensembl chr 5:67,681,297...67,801,170
JBrowse link
G Apoa1 apolipoprotein A1 multiple interactions ISO mastoparan inhibits the reaction [APOA1 protein affects the reaction [ABCA1 protein results in increased export of Cholesterol]] CTD PMID:16118212 NCBI chr 8:46,527,251...46,529,035
Ensembl chr 8:46,527,144...46,529,035
JBrowse link
G Calm1 calmodulin 1 affects binding EXP mastoparan binds to CALM1 protein CTD PMID:17098364 NCBI chr 6:119,487,691...119,495,759
Ensembl chr 6:119,487,621...119,498,227
JBrowse link
G Il6 interleukin 6 multiple interactions ISO mastoparan inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 protein] CTD PMID:21255617 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178
JBrowse link
G Nos1 nitric oxide synthase 1 decreases activity EXP mastoparan results in decreased activity of NOS1 protein CTD PMID:17098364 NCBI chr12:38,615,111...38,795,492
Ensembl chr12:38,626,714...38,710,945
JBrowse link
melittin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Actb actin, beta increases expression ISO Melitten results in increased expression of ACTB protein CTD PMID:34375656 NCBI chr12:11,663,112...11,666,697
Ensembl chr12:11,663,109...11,672,877
JBrowse link
G Adam10 ADAM metallopeptidase domain 10 multiple interactions ISO Melitten results in increased cleavage of and results in increased activity of ADAM10 protein CTD PMID:22613720 NCBI chr 8:71,346,008...71,477,889
Ensembl chr 8:71,345,837...71,477,889
JBrowse link
G Adam17 ADAM metallopeptidase domain 17 multiple interactions ISO Melitten results in increased cleavage of and results in increased activity of ADAM17 protein CTD PMID:22613720 NCBI chr 6:40,872,936...40,920,700
Ensembl chr 6:40,872,856...40,920,639
JBrowse link
G Aim2 absent in melanoma 2 multiple interactions ISO AIM2 protein promotes the reaction [Melitten results in increased expression of IL18 protein]; AIM2 protein promotes the reaction [Melitten results in increased expression of IL1B protein] CTD PMID:22973906 NCBI chr13:85,865,206...85,906,996
Ensembl chr13:85,866,284...85,906,975
JBrowse link
G Akt1 AKT serine/threonine kinase 1 multiple interactions ISO Melitten inhibits the reaction [TNF protein results in increased phosphorylation of AKT1 protein] CTD PMID:22926441 NCBI chr 6:131,713,716...131,735,319
Ensembl chr 6:131,713,720...131,733,921
JBrowse link
G Alox5 arachidonate 5-lipoxygenase increases activity ISO Melitten results in increased activity of ALOX5 protein CTD PMID:18475477 NCBI chr 4:149,531,329...149,578,696
Ensembl chr 4:149,531,515...149,578,743
JBrowse link
G Apaf1 apoptotic peptidase activating factor 1 multiple interactions EXP
ISO
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]
Melitten affects the reaction [TGFB1 protein affects the localization of APAF1 protein]
CTD PMID:21354845 PMID:21871910 NCBI chr 7:25,494,143...25,579,540
Ensembl chr 7:25,494,609...25,579,540
JBrowse link
G Bak1 BCL2-antagonist/killer 1 increases expression ISO Melitten results in increased expression of BAK1 protein CTD PMID:34375656 NCBI chr20:5,100,480...5,109,669
Ensembl chr20:5,100,480...5,109,264
JBrowse link
G Bax BCL2 associated X, apoptosis regulator increases expression
multiple interactions
ISO Melitten analog results in increased expression of BAX mRNA; Melitten analog results in increased expression of BAX protein; Melitten results in increased expression of BAX protein
Melitten affects the reaction [TGFB1 protein affects the localization of BAX protein]
CTD PMID:21871910 PMID:22027265 PMID:29387245 PMID:34375656 NCBI chr 1:95,940,001...95,945,407
Ensembl chr 1:95,938,808...95,945,368
JBrowse link
G Bcl2 BCL2, apoptosis regulator multiple interactions
decreases expression
ISO
EXP
Melitten affects the reaction [TGFB1 protein affects the localization of BCL2 protein]
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]
Melitten analog results in decreased expression of BCL2 mRNA; Melitten analog results in decreased expression of BCL2 protein; Melitten results in decreased expression of BCL2 protein
CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:22027265 PMID:29387245 NCBI chr13:22,689,783...22,853,920
Ensembl chr13:22,684,989...22,853,743
Ensembl chr13:22,684,989...22,853,743
JBrowse link
G Birc3 baculoviral IAP repeat-containing 3 decreases expression ISO Melitten results in decreased expression of BIRC3 protein CTD PMID:21456063 NCBI chr 8:5,000,844...5,028,470
Ensembl chr 8:5,000,845...5,015,802
JBrowse link
G Calm1 calmodulin 1 affects binding EXP Melitten binds to CALM1 protein CTD PMID:17098364 NCBI chr 6:119,487,691...119,495,759
Ensembl chr 6:119,487,621...119,498,227
JBrowse link
G Casp3 caspase 3 multiple interactions
decreases expression
increases expression
ISO
EXP
Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP3 protein]
Melitten results in decreased expression of CASP3 protein
Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]
Melitten analog results in increased expression of CASP3 mRNA; Melitten analog results in increased expression of CASP3 protein; Melitten results in increased expression of CASP3 protein modified form
Melitten results in increased cleavage of and results in increased activity of CASP3 protein
CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:22027265 PMID:29387245 More... NCBI chr16:45,662,910...45,681,171
Ensembl chr16:45,662,910...45,684,648
JBrowse link
G Casp8 caspase 8 increases expression ISO Melitten results in increased expression of CASP8 protein modified form CTD PMID:22027265 NCBI chr 9:60,263,863...60,312,542
Ensembl chr 9:60,264,075...60,312,542
JBrowse link
G Casp9 caspase 9 multiple interactions
increases expression
ISO
EXP
Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP9 protein]
Melitten analog results in increased expression of CASP9 mRNA; Melitten analog results in increased expression of CASP9 protein
Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein]
Melitten results in increased cleavage of and results in increased activity of CASP9 protein
CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:29387245 NCBI chr 5:154,108,872...154,126,628
Ensembl chr 5:154,109,046...154,126,626
JBrowse link
G Ccnd1 cyclin D1 decreases expression ISO Melitten results in decreased expression of CCND1 protein CTD PMID:26189965 NCBI chr 1:200,089,002...200,098,524
Ensembl chr 1:200,089,002...200,098,602
JBrowse link
G Cdh1 cadherin 1 increases secretion ISO Melitten results in increased secretion of CDH1 protein CTD PMID:22613720 NCBI chr19:34,492,371...34,561,775
Ensembl chr19:34,492,371...34,561,775
JBrowse link
G Cdk4 cyclin-dependent kinase 4 decreases expression ISO Melitten results in decreased expression of CDK4 protein CTD PMID:26189965 NCBI chr 7:62,885,647...62,889,562
Ensembl chr 7:62,883,105...62,942,403
JBrowse link
G Chrna7 cholinergic receptor nicotinic alpha 7 subunit multiple interactions
increases activity
EXP Bungarotoxins inhibits the reaction [Melitten results in increased activity of CHRNA7 protein]; methyllycaconitine inhibits the reaction [Melitten results in increased activity of CHRNA7 protein] CTD PMID:19910175 NCBI chr 1:116,715,286...116,837,223
Ensembl chr 1:116,714,711...116,837,240
JBrowse link
G Chuk component of inhibitor of nuclear factor kappa B kinase complex multiple interactions
affects binding
ISO [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; Dithiothreitol inhibits the reaction [Melitten binds to and results in decreased activity of CHUK protein]; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Glutathione inhibits the reaction [Melitten binds to and results in decreased activity of CHUK protein]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Hydrogen Peroxide inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [Thioacetamide results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased activity of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of CHUK protein]
Melitten binds to CHUK protein
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of and results in increased activity of CHUK protein]
CTD PMID:17067557 PMID:21969711 NCBI chr 1:242,959,539...242,995,066
Ensembl chr 1:242,959,760...242,995,065
JBrowse link
G Cryab crystallin, alpha B multiple interactions EXP Melitten promotes the reaction [sodium arsenite results in increased expression of CRYAB mRNA]; Melitten promotes the reaction [sodium arsenite results in increased expression of CRYAB protein] CTD PMID:8591993 NCBI chr 8:51,093,441...51,099,161
Ensembl chr 8:51,093,441...51,099,157
JBrowse link
G Drd2 dopamine receptor D2 multiple interactions ISO Melitten inhibits the reaction [Spiperone binds to DRD2 protein] CTD PMID:20969853 NCBI chr 8:49,708,903...49,772,888
Ensembl chr 8:49,708,927...49,772,875
JBrowse link
G Egfr epidermal growth factor receptor increases activity ISO Melitten results in increased activity of EGFR protein CTD PMID:22613720 NCBI chr14:91,176,931...91,349,722
Ensembl chr14:91,177,067...91,344,382
JBrowse link
G Fas Fas cell surface death receptor increases expression ISO Melitten results in increased expression of FAS mRNA; Melitten results in increased expression of FAS protein CTD PMID:16974113 PMID:17854560 NCBI chr 1:231,798,963...231,832,591
Ensembl chr 1:231,798,960...231,832,591
JBrowse link
G Fgf2 fibroblast growth factor 2 decreases expression ISO Melitten results in decreased expression of FGF2 mRNA CTD PMID:18076793 NCBI chr 2:120,236,328...120,290,673
Ensembl chr 2:120,236,328...120,291,221
JBrowse link
G Fn1 fibronectin 1 multiple interactions ISO Melitten inhibits the reaction [Thioacetamide results in increased expression of FN1 protein] CTD PMID:21969711 NCBI chr 9:73,196,044...73,264,695
Ensembl chr 9:73,196,044...73,264,678
JBrowse link
G Gap43 growth associated protein 43 increases phosphorylation ISO Melitten results in increased phosphorylation of GAP43 protein CTD PMID:9852580 NCBI chr11:58,376,371...58,470,047
Ensembl chr11:58,376,371...58,470,045
JBrowse link
G Gli1 GLI family zinc finger 1 decreases expression ISO Melitten results in decreased expression of GLI1 protein CTD PMID:26189965 NCBI chr 7:63,156,926...63,169,579
Ensembl chr 7:63,156,926...63,169,251
JBrowse link
G Gnrh1 gonadotropin releasing hormone 1 multiple interactions ISO GNRH1 protein results in increased susceptibility to [Melitten binds to CGB3 protein] CTD PMID:19261682 NCBI chr15:41,972,482...41,976,690
Ensembl chr15:41,972,905...41,973,581
Ensembl chr15:41,972,905...41,973,581
JBrowse link
G H19 H19 imprinted maternally expressed transcript decreases expression ISO Melitten results in decreased expression of H19 mRNA CTD PMID:34375656 NCBI chr 1:197,730,698...197,733,374
Ensembl chr 1:197,730,698...197,733,134
JBrowse link
G Hrh2 histamine receptor H 2 increases activity
multiple interactions
increases response to substance
EXP Melitten results in increased activity of HRH2 protein
Ranitidine inhibits the reaction [Melitten results in increased activity of HRH2 protein]
HRH2 protein results in increased susceptibility to Melitten
CTD PMID:22995146 NCBI chr17:10,368,355...10,407,791
Ensembl chr17:10,368,298...10,407,631
JBrowse link
G Htr1a 5-hydroxytryptamine receptor 1A multiple interactions ISO Melitten inhibits the reaction [HTR1A protein inhibits the reaction [Colforsin results in increased abundance of Cyclic AMP]] CTD PMID:11356925 NCBI chr 2:36,694,174...36,695,442
Ensembl chr 2:36,694,174...36,695,442
JBrowse link
G Icam1 intercellular adhesion molecule 1 decreases expression ISO Melitten results in decreased expression of ICAM1 protein CTD PMID:12697458 NCBI chr 8:19,553,063...19,565,438
Ensembl chr 8:19,553,645...19,565,438
JBrowse link
G Ikbkb inhibitor of nuclear factor kappa B kinase subunit beta multiple interactions
affects binding
ISO Dithiothreitol inhibits the reaction [Melitten binds to and results in decreased activity of IKBKB protein]; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Glutathione inhibits the reaction [Melitten binds to and results in decreased activity of IKBKB protein]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Hydrogen Peroxide inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased activity of IKBKB protein]; Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]; Melitten inhibits the reaction [TNF protein results in increased activity of IKBKB protein]
Melitten binds to IKBKB protein
CTD PMID:17067557 NCBI chr16:69,319,487...69,373,251
Ensembl chr16:69,319,554...69,373,250
JBrowse link
G Il18 interleukin 18 increases expression
multiple interactions
ISO Melitten results in increased expression of IL18 protein
AIM2 protein promotes the reaction [Melitten results in increased expression of IL18 protein]
CTD PMID:22973906 NCBI chr 8:50,904,630...50,932,887
Ensembl chr 8:50,906,960...50,932,887
JBrowse link
G Il1b interleukin 1 beta multiple interactions
increases expression
EXP
ISO
Melitten inhibits the reaction [TNF protein results in increased expression of IL1B protein]
Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of IL1B mRNA]
AIM2 protein promotes the reaction [Melitten results in increased expression of IL1B protein]
CTD PMID:17570326 PMID:21969711 PMID:22973906 NCBI chr 3:116,577,005...116,583,386
Ensembl chr 3:116,577,010...116,583,415
JBrowse link
G Il6 interleukin 6 multiple interactions EXP
ISO
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of IL6STP1 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]; Melitten inhibits the reaction [TNF protein results in increased expression of IL6 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein]
Melitten inhibits the reaction [Acetic Acid results in increased expression of IL6 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 mRNA]; Melitten inhibits the reaction [Thioacetamide results in increased expression of IL6 protein]
CTD PMID:17570326 PMID:21354845 PMID:21969711 PMID:33002459 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178
JBrowse link
G Il6r interleukin 6 receptor multiple interactions EXP Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of IL6STP1 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein] CTD PMID:21354845 NCBI chr 2:175,289,157...175,347,719
Ensembl chr 2:175,298,686...175,347,536
JBrowse link
G Jak2 Janus kinase 2 decreases phosphorylation ISO Melitten results in decreased phosphorylation of JAK2 protein CTD PMID:22027265 NCBI chr 1:226,995,334...227,054,381
Ensembl chr 1:226,995,334...227,054,189
JBrowse link
G Jun Jun proto-oncogene, AP-1 transcription factor subunit multiple interactions ISO Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased localization of JUN protein] CTD PMID:20082219 NCBI chr 5:109,894,175...109,897,268
Ensembl chr 5:109,893,145...109,897,656
JBrowse link
G Kdr kinase insert domain receptor decreases expression ISO Melitten results in decreased expression of KDR protein CTD PMID:23110475 NCBI chr14:32,217,871...32,261,018
Ensembl chr14:32,217,871...32,261,018
JBrowse link
G Lhcgr luteinizing hormone/choriogonadotropin receptor multiple interactions ISO LHCGR protein results in increased susceptibility to [Melitten binds to CGB3 protein] CTD PMID:19261682 NCBI chr 6:5,661,871...5,728,109
Ensembl chr 6:5,661,871...5,724,521
JBrowse link
G Mapk1 mitogen activated protein kinase 1 increases phosphorylation
multiple interactions
decreases phosphorylation
ISO
EXP
Melitten results in increased phosphorylation of MAPK1 protein
Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of MAPK1 protein]
Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of and results in increased activity of MAPK1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK1 protein]; Melitten results in increased phosphorylation of and results in increased activity of MAPK1 protein
Melitten results in decreased phosphorylation of MAPK1 protein
CTD PMID:17570326 PMID:17579088 PMID:17654254 PMID:20082219 PMID:22613720 More... NCBI chr11:83,957,813...84,023,629
Ensembl chr11:83,957,813...84,023,616
JBrowse link
G Mapk3 mitogen activated protein kinase 3 multiple interactions
decreases phosphorylation
increases phosphorylation
ISO
EXP
Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of and results in increased activity of MAPK3 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK3 protein]; Melitten results in increased phosphorylation of and results in increased activity of MAPK3 protein
Melitten results in decreased phosphorylation of MAPK3 protein
Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of MAPK3 protein]
Melitten results in increased phosphorylation of MAPK3 protein
CTD PMID:17570326 PMID:17579088 PMID:17654254 PMID:20082219 PMID:22613720 More... NCBI chr 1:181,366,646...181,372,863
Ensembl chr 1:181,366,637...181,372,863
JBrowse link
G Mecp2 methyl CpG binding protein 2 decreases expression ISO Melitten results in decreased expression of MECP2 mRNA; Melitten results in decreased expression of MECP2 protein CTD PMID:26189965 NCBI chr  X:151,781,177...151,844,687
Ensembl chr  X:151,789,930...151,844,689
JBrowse link
G Mmp2 matrix metallopeptidase 2 multiple interactions ISO Melitten inhibits the reaction [TNF protein results in increased secretion of MMP2 protein] CTD PMID:22926441 NCBI chr19:14,154,657...14,182,870
Ensembl chr19:14,154,657...14,182,870
JBrowse link
G Mmp3 matrix metallopeptidase 3 multiple interactions ISO Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of MMP3 protein] CTD PMID:17303203 NCBI chr 8:4,640,397...4,653,963
Ensembl chr 8:4,640,416...4,653,961
JBrowse link
G Mmp9 matrix metallopeptidase 9 multiple interactions ISO Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of and results in increased activity of MMP9 protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of and results in increased secretion of MMP9 protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP9 protein] CTD PMID:19969058 PMID:20082219 PMID:22926441 NCBI chr 3:153,684,158...153,692,118
Ensembl chr 3:153,683,858...153,692,120
JBrowse link
G Nfkb1 nuclear factor kappa B subunit 1 multiple interactions
decreases localization
ISO [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of and results in increased activity of NFKB1 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of NFKB1 protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of NFKB1 protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of NFKB1 protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of NFKB1 protein]]
Melitten results in decreased localization of NFKB1 protein
CTD PMID:15529353 PMID:17067557 PMID:18507870 PMID:21456063 NCBI chr 2:224,016,214...224,132,135
Ensembl chr 2:224,016,214...224,110,404
JBrowse link
G Nfkbia NFKB inhibitor alpha multiple interactions ISO [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]
CTD PMID:15529353 PMID:17067557 PMID:17570326 PMID:18507870 PMID:22926441 NCBI chr 6:72,858,713...72,861,941
Ensembl chr 6:72,858,712...72,861,941
JBrowse link
G Nos1 nitric oxide synthase 1 decreases activity EXP Melitten results in decreased activity of NOS1 protein CTD PMID:17098364 NCBI chr12:38,615,111...38,795,492
Ensembl chr12:38,626,714...38,710,945
JBrowse link
G Nos2 nitric oxide synthase 2 multiple interactions
decreases expression
ISO Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[TNF protein results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of NOS2 mRNA]
Melitten results in decreased expression of NOS2 protein
CTD PMID:15529353 PMID:17067557 PMID:17570326 PMID:21456063 NCBI chr10:63,815,308...63,851,208
Ensembl chr10:63,815,308...63,851,210
JBrowse link
G P2rx7 purinergic receptor P2X 7 increases response to substance
increases activity
ISO P2RX7 protein results in increased susceptibility to Melitten
Melitten results in increased activity of P2RX7 protein
CTD PMID:22613720 NCBI chr12:33,889,709...33,934,168
Ensembl chr12:33,879,745...33,934,619
JBrowse link
G Parp1 poly (ADP-ribose) polymerase 1 multiple interactions ISO Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of PARP1 protein] CTD PMID:21871910 NCBI chr13:92,307,593...92,339,406
Ensembl chr13:92,307,586...92,339,404
JBrowse link
G Pdgfrb platelet derived growth factor receptor beta multiple interactions EXP Melitten results in decreased phosphorylation of and results in decreased activity of PDGFRB protein CTD PMID:17654254 NCBI chr18:54,500,002...54,538,843
Ensembl chr18:54,499,964...54,538,843
JBrowse link
G Pla2g2a phospholipase A2 group IIA multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of PLA2G2A protein] CTD PMID:33002459 NCBI chr 5:151,076,442...151,079,019
Ensembl chr 5:151,076,442...151,079,014
JBrowse link
G Pla2g4a phospholipase A2 group IVA decreases expression ISO Melitten results in decreased expression of PLA2G4A protein CTD PMID:21456063 NCBI chr13:61,877,818...62,022,261
Ensembl chr13:61,877,813...62,022,266
JBrowse link
G Plcg1 phospholipase C, gamma 1 decreases phosphorylation EXP Melitten results in decreased phosphorylation of PLCG1 protein CTD PMID:17654254 NCBI chr 3:149,385,587...149,416,330
Ensembl chr 3:149,385,587...149,416,330
JBrowse link
G Ptch1 patched 1 increases expression ISO Melitten results in increased expression of PTCH1 protein CTD PMID:26189965 NCBI chr17:1,542,705...1,607,730
Ensembl chr17:1,542,877...1,607,333
JBrowse link
G Ptgs2 prostaglandin-endoperoxide synthase 2 multiple interactions
increases expression
decreases expression
ISO [Melitten results in decreased expression of PTGS2 protein] which results in decreased chemical synthesis of Dinoprostone; Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; SB 203580 inhibits the reaction [Melitten results in decreased expression of PTGS2 protein]
Melitten results in increased expression of PTGS2 mRNA; Melitten results in increased expression of PTGS2 protein
[Melitten results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone; Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[TNF protein results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [Acetic Acid results in increased expression of PTGS2 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of PTGS2 mRNA]
CTD PMID:11094054 PMID:11821123 PMID:15529353 PMID:17067557 PMID:17570326 More... NCBI chr13:62,164,080...62,169,770
Ensembl chr13:62,163,932...62,172,188
JBrowse link
G Rab11a RAB11a, member RAS oncogene family multiple interactions ISO Melitten results in decreased localization of [RAB11A protein co-treated with RAB5A protein] CTD PMID:22683840 NCBI chr 8:65,223,698...65,246,461
Ensembl chr 8:65,222,949...65,246,525
JBrowse link
G Rab5a RAB5A, member RAS oncogene family multiple interactions ISO Melitten results in decreased localization of [RAB11A protein co-treated with RAB5A protein]; Melitten results in increased localization of [SLC6A3 protein co-treated with RAB5A protein] CTD PMID:22683840 NCBI chr 9:6,483,906...6,512,877
Ensembl chr 9:6,484,469...6,512,873
JBrowse link
G Rac1 Rac family small GTPase 1 decreases activity ISO Melitten results in decreased activity of RAC1 protein CTD PMID:18506888 NCBI chr12:11,037,028...11,057,251
Ensembl chr12:11,036,698...11,057,251
JBrowse link
G Rela RELA proto-oncogene, NF-kB subunit multiple interactions
decreases localization
ISO
EXP
Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]]
Melitten results in decreased localization of RELA protein
Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased localization of RELA protein]; Melitten inhibits the reaction [TNF protein affects the localization of RELA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]]
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]
CTD PMID:17570326 PMID:18507870 PMID:20082219 PMID:21354845 PMID:21456063 More... NCBI chr 1:202,925,001...202,935,484
Ensembl chr 1:202,924,945...202,935,484
JBrowse link
G Scn10a sodium voltage-gated channel alpha subunit 10 increases expression
multiple interactions
EXP Melitten results in increased expression of SCN10A mRNA; Melitten results in increased expression of SCN10A protein
[Melitten results in increased expression of SCN10A protein] which results in increased transport of Sodium
CTD PMID:23264124 NCBI chr 8:119,350,723...119,462,882
Ensembl chr 8:119,350,724...119,462,614
JBrowse link
G Scn11a sodium voltage-gated channel alpha subunit 11 increases expression
multiple interactions
increases response to substance
EXP Melitten results in increased expression of SCN11A mRNA; Melitten results in increased expression of SCN11A protein
[Melitten results in increased expression of SCN11A protein] which results in increased transport of Sodium
SCN11A protein results in increased susceptibility to Melitten
CTD PMID:23264124 NCBI chr 8:119,495,550...119,567,044
Ensembl chr 8:119,496,769...119,567,044
JBrowse link
G Shh sonic hedgehog signaling molecule decreases expression ISO Melitten results in decreased expression of SHH protein CTD PMID:26189965 NCBI chr 4:6,954,017...6,963,170
Ensembl chr 4:6,954,017...6,963,170
JBrowse link
G Slc6a3 solute carrier family 6 member 3 increases localization
multiple interactions
ISO Melitten results in increased localization of SLC6A3 protein
Cocaine inhibits the reaction [Melitten results in increased localization of SLC6A3 protein]; Melitten inhibits the reaction [2beta-carbomethoxy-3beta-(4-iodophenyl)tropane binds to SLC6A3 protein]; Melitten inhibits the reaction [SLC6A3 protein results in increased uptake of Dopamine]; Melitten results in increased localization of [SLC6A3 protein co-treated with RAB5A protein]
CTD PMID:20969853 PMID:22683840 NCBI chr 1:29,709,443...29,750,413
Ensembl chr 1:29,709,443...29,750,413
JBrowse link
G Stat3 signal transducer and activator of transcription 3 decreases phosphorylation
multiple interactions
ISO
EXP
Melitten results in decreased phosphorylation of STAT3 protein
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]
TNFRSF10A protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]; TNFRSF21 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]; TNFRSF25 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
CTD PMID:21354845 PMID:22027265 NCBI chr10:85,811,206...85,863,057
Ensembl chr10:85,811,218...85,863,057
JBrowse link
G Tbxa2r thromboxane A2 receptor increases response to substance EXP TBXA2R protein results in increased susceptibility to Melitten CTD PMID:16524625 NCBI chr 7:8,383,347...8,390,753
Ensembl chr 7:8,383,378...8,388,176
JBrowse link
G Tgfa transforming growth factor alpha increases secretion ISO Melitten results in increased secretion of TGFA protein CTD PMID:22613720 NCBI chr 4:118,618,043...118,700,897
Ensembl chr 4:118,618,269...118,700,894
JBrowse link
G Tgfb1 transforming growth factor, beta 1 multiple interactions
decreases activity
ISO Melitten affects the reaction [TGFB1 protein affects the localization of APAF1 protein]; Melitten affects the reaction [TGFB1 protein affects the localization of BAX protein]; Melitten affects the reaction [TGFB1 protein affects the localization of BCL2 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP3 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP9 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of PARP1 protein]; Melitten inhibits the reaction [Thioacetamide results in increased expression of TGFB1 protein]
Melitten results in decreased activity of TGFB1 protein
CTD PMID:21871910 PMID:21969711 NCBI chr 1:81,196,532...81,212,848
Ensembl chr 1:81,196,532...81,212,847
JBrowse link
G Tlr4 toll-like receptor 4 multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of TLR4 protein] CTD PMID:33002459 NCBI chr 5:80,145,867...80,159,501
Ensembl chr 5:80,145,826...80,159,628
JBrowse link
G Tnf tumor necrosis factor multiple interactions
decreases secretion
increases expression
ISO
EXP
Melitten inhibits the reaction [TNF protein affects the localization of RELA protein]; Melitten inhibits the reaction [TNF protein results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of AKT1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK3 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP2 protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP9 protein]
Melitten results in decreased secretion of TNF protein
Melitten inhibits the reaction [TNF protein results in increased expression of IL1B protein]; Melitten inhibits the reaction [TNF protein results in increased expression of IL6 protein]
Melitten results in increased expression of TNF mRNA
Melitten inhibits the reaction [[TNF protein results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[TNF protein results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [Acetic Acid results in increased expression of TNF protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of TNF mRNA]; Melitten inhibits the reaction [Thioacetamide results in increased expression of TNF protein]; Melitten inhibits the reaction [TNF protein results in increased activity of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased activity of IKBKB protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]
CTD PMID:11094054 PMID:11821123 PMID:17067557 PMID:17570326 PMID:21969711 More... NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629
JBrowse link
G Tnfrsf10b TNF receptor superfamily member 10b multiple interactions
increases expression
affects response to substance
ISO TNFRSF10A protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
Melitten results in increased expression of TNFRSF10A mRNA
TNFRSF10A protein affects the susceptibility to Melitten
CTD PMID:22027265 NCBI chr15:44,839,818...44,867,582
Ensembl chr15:44,840,386...44,867,467
JBrowse link
G Tnfrsf21 TNF receptor superfamily member 21 increases expression
affects response to substance
multiple interactions
ISO Melitten results in increased expression of TNFRSF21 mRNA
TNFRSF21 protein affects the susceptibility to Melitten
TNFRSF21 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
CTD PMID:22027265 NCBI chr 9:17,879,156...17,954,085
Ensembl chr 9:17,879,156...17,954,085
JBrowse link
G Tnfrsf25 TNF receptor superfamily member 25 increases expression
multiple interactions
affects response to substance
ISO Melitten results in increased expression of TNFRSF25 mRNA
TNFRSF25 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
TNFRSF25 protein affects the susceptibility to Melitten
CTD PMID:22027265 NCBI chr 5:162,621,669...162,626,341
Ensembl chr 5:162,622,075...162,626,341
JBrowse link
G Traf6 TNF receptor associated factor 6 multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of TRAF6 protein] CTD PMID:33002459 NCBI chr 3:87,963,517...87,988,316
Ensembl chr 3:87,963,514...87,983,507
JBrowse link
G Trpv1 transient receptor potential cation channel, subfamily V, member 1 multiple interactions
increases response to substance
increases activity
EXP [Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium; capsazepine inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; capsazepine inhibits the reaction [TRPV1 protein results in increased susceptibility to Melitten]; Indomethacin inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; Masoprocol inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium] CTD PMID:16446039 PMID:21453681 NCBI chr10:57,851,428...57,876,513
Ensembl chr10:57,851,428...57,876,513
JBrowse link
G Vcam1 vascular cell adhesion molecule 1 multiple interactions ISO Melitten inhibits the reaction [Thioacetamide results in increased expression of VCAM1 protein] CTD PMID:21969711 NCBI chr 2:204,038,120...204,057,852
Ensembl chr 2:204,038,114...204,057,958
JBrowse link
G Vdac1 voltage-dependent anion channel 1 increases expression ISO Melitten results in increased expression of VDAC1 protein CTD PMID:34375656 NCBI chr10:36,532,306...36,559,642
Ensembl chr10:36,532,244...36,559,640
JBrowse link
G Vegfa vascular endothelial growth factor A multiple interactions
decreases expression
ISO SB 203580 inhibits the reaction [Melitten results in decreased expression of VEGFA protein]
Melitten results in decreased expression of VEGFA mRNA; Melitten results in decreased expression of VEGFA protein
CTD PMID:18076793 PMID:23110475 NCBI chr 9:14,955,300...14,970,641
Ensembl chr 9:14,955,300...14,970,641
JBrowse link
G Xiap X-linked inhibitor of apoptosis decreases expression ISO Melitten results in decreased expression of XIAP protein CTD PMID:21456063 NCBI chr  X:120,890,537...120,938,413
Ensembl chr  X:120,897,907...120,934,700
JBrowse link
G Xist X inactive specific transcript increases expression ISO Melitten results in increased expression of XIST mRNA CTD PMID:34375656 NCBI chr  X:68,474,987...68,492,500 JBrowse link
omega-conotoxin GVIA term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Clu clusterin multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [methoxyacetic acid results in increased expression of and results in increased secretion of CLU protein] CTD PMID:14656996 NCBI chr15:40,161,068...40,200,315
Ensembl chr15:40,174,617...40,200,315
JBrowse link
G Fos Fos proto-oncogene, AP-1 transcription factor subunit multiple interactions EXP [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] inhibits the reaction [Potassium Chloride affects the expression of FOS mRNA] CTD PMID:20211981 NCBI chr 6:105,121,170...105,124,036
Ensembl chr 6:105,121,170...105,124,036
JBrowse link
G Kcna1 potassium voltage-gated channel subfamily A member 1 multiple interactions EXP [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] promotes the reaction [Potassium Chloride results in increased expression of KCNA1 mRNA] CTD PMID:20211981 NCBI chr 4:159,464,223...159,472,905
Ensembl chr 4:159,464,188...159,472,682
JBrowse link
G Kcnc3 potassium voltage-gated channel subfamily C member 3 multiple interactions EXP [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] inhibits the reaction [Potassium Chloride results in increased expression of KCNC3 mRNA] CTD PMID:20211981 NCBI chr 1:95,080,960...95,095,165
Ensembl chr 1:95,080,960...95,095,160
JBrowse link
G Sct secretin multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [Potassium Chloride results in increased secretion of SCT protein] CTD PMID:16888165 NCBI chr 1:196,382,941...196,383,635
Ensembl chr 1:196,382,856...196,383,658
JBrowse link
G Snca synuclein alpha multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [SNCA protein results in increased uptake of Calcium] CTD PMID:17179863 NCBI chr 4:89,696,420...89,797,240
Ensembl chr 4:89,696,420...89,796,262
JBrowse link
G Tac1 tachykinin, precursor 1 multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [Potassium results in increased secretion of TAC1 protein modified form] CTD PMID:2325850 NCBI chr 4:35,679,183...35,687,180
Ensembl chr 4:35,679,704...35,687,178
JBrowse link

Term paths to the root
Path 1
Term Annotations click to browse term
  CHEBI ontology 19751
    chemical entity 19749
      group 19713
        organic group 18846
          amino-acid residue 9548
            peptide 9547
              peptidyl amide 93
                Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 0
                JNK inhibitor I 0
                QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
                corticotropin-releasing hormone (human) 0
                corticotropin-releasing hormone (ovine) 0
                dermaseptin s3(1-16)-NH2 0
                gastrin-14 0
                kisspeptin-54 0
                lixisenatide 0
                mastoparan 5
                mastoparan-A 0
                mastoparan-AF 0
                mastoparan-B 0
                mastoparan-D 0
                mastoparan-M 0
                mastoparan-V 0
                melittin 84
                omega-conotoxin GVIA 7
                peptide YY 0
                tetragastrin 0
Path 2
Term Annotations click to browse term
  CHEBI ontology 19751
    subatomic particle 19749
      composite particle 19749
        hadron 19749
          baryon 19749
            nucleon 19749
              atomic nucleus 19749
                atom 19749
                  main group element atom 19698
                    p-block element atom 19698
                      carbon group element atom 19644
                        carbon atom 19640
                          organic molecular entity 19640
                            organic group 18846
                              organic divalent group 18832
                                organodiyl group 18832
                                  carbonyl group 18799
                                    carbonyl compound 18799
                                      carboxylic acid 18515
                                        carboacyl group 17655
                                          univalent carboacyl group 17655
                                            carbamoyl group 17498
                                              carboxamide 17498
                                                peptide 9547
                                                  peptidyl amide 93
                                                    Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 0
                                                    JNK inhibitor I 0
                                                    QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
                                                    corticotropin-releasing hormone (human) 0
                                                    corticotropin-releasing hormone (ovine) 0
                                                    dermaseptin s3(1-16)-NH2 0
                                                    gastrin-14 0
                                                    kisspeptin-54 0
                                                    lixisenatide 0
                                                    mastoparan 5
                                                    mastoparan-A 0
                                                    mastoparan-AF 0
                                                    mastoparan-B 0
                                                    mastoparan-D 0
                                                    mastoparan-M 0
                                                    mastoparan-V 0
                                                    melittin 84
                                                    omega-conotoxin GVIA 7
                                                    peptide YY 0
                                                    tetragastrin 0
paths to the root