Send us a Message
Submit Data |  Help |  Video Tutorials |  News |  Publications |  Download |  REST API |  Citing RGD |  Contact   
Search RGD Grant Resources Citing RGD About Us Contact Us
Genes Variants Community Projects QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data
OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer)
Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease
Find Models   new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive
Pathways
Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources

CHEBI ONTOLOGY - ANNOTATIONS

The Chemical Entities of Biological Interest (ChEBI) ontology is downloaded weekly from EMBL-EBI at http://www.ebi.ac.uk/chebi/. The data is made available under the Creative Commons License (CC BY 3.0, http://creativecommons.org/licenses/by/3.0/). For more information see: Degtyarenko et al. (2008) ChEBI: a database and ontology for chemical entities of biological interest. Nucleic Acids Res. 36, D344–D350.
Term:peptidyl amide
go back to main search page
Accession:CHEBI:15722 term browser browse the term
Definition:A peptide that has a carbamoyl group at the C-terminus.
Synonyms:related_synonym: Formula=(C2H2NOR)n.C2H5N2OR;   peptidyl amides
 alt_id: CHEBI:14762;   CHEBI:8007
 xref: KEGG:C02179;   MetaCyc:PEPTIDAMIDE-CPD
 cyclic_relationship: is_conjugate_base_of CHEBI:136962


show annotations for term's descendants           Sort by:
mastoparan term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Abca1 ATP binding cassette subfamily A member 1 multiple interactions
increases phosphorylation		 ISO mastoparan inhibits the reaction [APOA1 protein affects the reaction [ABCA1 protein results in increased export of Cholesterol]]
mastoparan results in increased phosphorylation of ABCA1 protein		 CTD PMID:16118212 NCBI chr 5:67,678,267...67,801,162
Ensembl chr 5:67,681,297...67,801,170 		JBrowse link
G Apoa1 apolipoprotein A1 multiple interactions ISO mastoparan inhibits the reaction [APOA1 protein affects the reaction [ABCA1 protein results in increased export of Cholesterol]] CTD PMID:16118212 NCBI chr 8:46,527,251...46,529,035
Ensembl chr 8:46,527,144...46,529,035 		JBrowse link
G Calm1 calmodulin 1 affects binding EXP mastoparan binds to CALM1 protein CTD PMID:17098364 NCBI chr 6:119,487,691...119,495,759
Ensembl chr 6:119,487,621...119,498,227 		JBrowse link
G Il6 interleukin 6 multiple interactions ISO mastoparan inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 protein] CTD PMID:21255617 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178 		JBrowse link
G Nos1 nitric oxide synthase 1 decreases activity EXP mastoparan results in decreased activity of NOS1 protein CTD PMID:17098364 NCBI chr12:38,615,111...38,795,492
Ensembl chr12:38,626,714...38,710,945 		JBrowse link
melittin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Actb actin, beta increases expression ISO Melitten results in increased expression of ACTB protein CTD PMID:34375656 NCBI chr12:11,663,112...11,666,697
Ensembl chr12:11,663,109...11,672,877 		JBrowse link
G Adam10 ADAM metallopeptidase domain 10 multiple interactions ISO Melitten results in increased cleavage of and results in increased activity of ADAM10 protein CTD PMID:22613720 NCBI chr 8:71,346,008...71,477,889
Ensembl chr 8:71,345,837...71,477,889 		JBrowse link
G Adam17 ADAM metallopeptidase domain 17 multiple interactions ISO Melitten results in increased cleavage of and results in increased activity of ADAM17 protein CTD PMID:22613720 NCBI chr 6:40,872,936...40,920,700
Ensembl chr 6:40,872,856...40,920,639 		JBrowse link
G Aim2 absent in melanoma 2 multiple interactions ISO AIM2 protein promotes the reaction [Melitten results in increased expression of IL18 protein]; AIM2 protein promotes the reaction [Melitten results in increased expression of IL1B protein] CTD PMID:22973906 NCBI chr13:85,865,206...85,906,996
Ensembl chr13:85,866,284...85,906,975 		JBrowse link
G Akt1 AKT serine/threonine kinase 1 multiple interactions ISO Melitten inhibits the reaction [TNF protein results in increased phosphorylation of AKT1 protein] CTD PMID:22926441 NCBI chr 6:131,713,716...131,735,319
Ensembl chr 6:131,713,720...131,733,921 		JBrowse link
G Alox5 arachidonate 5-lipoxygenase increases activity ISO Melitten results in increased activity of ALOX5 protein CTD PMID:18475477 NCBI chr 4:149,531,329...149,578,696
Ensembl chr 4:149,531,515...149,578,743 		JBrowse link
G Apaf1 apoptotic peptidase activating factor 1 multiple interactions EXP
ISO		 Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]
Melitten affects the reaction [TGFB1 protein affects the localization of APAF1 protein]		 CTD PMID:21354845 PMID:21871910 NCBI chr 7:25,494,143...25,579,540
Ensembl chr 7:25,494,609...25,579,540 		JBrowse link
G Atp5po ATP synthase peripheral stalk subunit OSCP decreases expression ISO Melitten results in decreased expression of ATP5PO mRNA CTD PMID:37678661 NCBI chr11:31,165,218...31,171,530
Ensembl chr11:31,165,217...31,171,592 		JBrowse link
G Bak1 BCL2-antagonist/killer 1 increases expression ISO Melitten results in increased expression of BAK1 protein CTD PMID:34375656 NCBI chr20:5,100,480...5,109,669
Ensembl chr20:5,100,480...5,109,264 		JBrowse link
G Bax BCL2 associated X, apoptosis regulator multiple interactions
increases expression		 ISO Melitten affects the reaction [TGFB1 protein affects the localization of BAX protein]
Melitten results in increased expression of BAX protein
Melitten analog results in increased expression of BAX mRNA; Melitten analog results in increased expression of BAX protein; Melitten results in increased expression of BAX protein		 CTD PMID:21871910 PMID:22027265 PMID:29387245 PMID:34375656 PMID:37678661 NCBI chr 1:95,940,001...95,945,407
Ensembl chr 1:95,938,808...95,945,368 		JBrowse link
G Bcl2 BCL2, apoptosis regulator decreases expression
multiple interactions		 ISO
EXP		 Melitten analog results in decreased expression of BCL2 mRNA; Melitten analog results in decreased expression of BCL2 protein; Melitten results in decreased expression of BCL2 protein
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]
Melitten affects the reaction [TGFB1 protein affects the localization of BCL2 protein]		 CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:22027265 PMID:29387245 More... NCBI chr13:22,689,783...22,853,920
Ensembl chr13:22,684,989...22,853,743
Ensembl chr13:22,684,989...22,853,743 		JBrowse link
G Bdnf brain-derived neurotrophic factor decreases expression ISO Melitten results in decreased expression of BDNF protein CTD PMID:37678661 NCBI chr 3:96,165,042...96,215,621
Ensembl chr 3:96,165,042...96,215,615 		JBrowse link
G Birc3 baculoviral IAP repeat-containing 3 decreases expression ISO Melitten results in decreased expression of BIRC3 protein CTD PMID:21456063 NCBI chr 8:5,000,844...5,028,470
Ensembl chr 8:5,000,845...5,015,802 		JBrowse link
G Calm1 calmodulin 1 affects binding EXP Melitten binds to CALM1 protein CTD PMID:17098364 NCBI chr 6:119,487,691...119,495,759
Ensembl chr 6:119,487,621...119,498,227 		JBrowse link
G Casp3 caspase 3 increases expression
increases cleavage
decreases expression
multiple interactions		 ISO
EXP		 Melitten analog results in increased expression of CASP3 mRNA; Melitten analog results in increased expression of CASP3 protein; Melitten results in increased expression of CASP3 protein modified form
Melitten results in increased cleavage of CASP3 protein
Melitten results in decreased expression of CASP3 protein
Melitten results in increased cleavage of and results in increased activity of CASP3 protein
Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]
Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP3 protein]		 CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:22027265 PMID:29387245 More... NCBI chr16:45,662,910...45,681,171
Ensembl chr16:45,662,910...45,684,648 		JBrowse link
G Casp8 caspase 8 increases expression ISO Melitten results in increased expression of CASP8 protein modified form CTD PMID:22027265 NCBI chr 9:60,263,863...60,312,542
Ensembl chr 9:60,264,075...60,312,542 		JBrowse link
G Casp9 caspase 9 multiple interactions
increases expression		 ISO
EXP		 Melitten results in increased cleavage of and results in increased activity of CASP9 protein
Melitten analog results in increased expression of CASP9 mRNA; Melitten analog results in increased expression of CASP9 protein
Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein]
Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP9 protein]		 CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:29387245 NCBI chr 5:154,108,872...154,126,628
Ensembl chr 5:154,109,046...154,126,626 		JBrowse link
G Ccnd1 cyclin D1 decreases expression ISO Melitten results in decreased expression of CCND1 protein CTD PMID:26189965 NCBI chr 1:200,089,002...200,098,524
Ensembl chr 1:200,089,002...200,098,602 		JBrowse link
G Cdh1 cadherin 1 increases secretion ISO Melitten results in increased secretion of CDH1 protein CTD PMID:22613720 NCBI chr19:34,492,371...34,561,775
Ensembl chr19:34,492,371...34,561,775 		JBrowse link
G Cdk4 cyclin-dependent kinase 4 decreases expression ISO Melitten results in decreased expression of CDK4 protein CTD PMID:26189965 NCBI chr 7:62,886,124...62,889,562
Ensembl chr 7:62,883,105...62,942,403 		JBrowse link
G Chrna7 cholinergic receptor nicotinic alpha 7 subunit multiple interactions
increases activity		 EXP Bungarotoxins inhibits the reaction [Melitten results in increased activity of CHRNA7 protein]; methyllycaconitine inhibits the reaction [Melitten results in increased activity of CHRNA7 protein] CTD PMID:19910175 NCBI chr 1:116,711,559...116,837,269
Ensembl chr 1:116,714,711...116,837,240 		JBrowse link
G Chuk component of inhibitor of nuclear factor kappa B kinase complex multiple interactions
affects binding		 ISO [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of and results in increased activity of CHUK protein]
Melitten binds to CHUK protein
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; Dithiothreitol inhibits the reaction [Melitten binds to and results in decreased activity of CHUK protein]; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Glutathione inhibits the reaction [Melitten binds to and results in decreased activity of CHUK protein]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Hydrogen Peroxide inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [Thioacetamide results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased activity of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of CHUK protein]		 CTD PMID:17067557 PMID:21969711 NCBI chr 1:242,959,539...242,995,066
Ensembl chr 1:242,959,760...242,995,065 		JBrowse link
G Creb1 cAMP responsive element binding protein 1 decreases phosphorylation ISO Melitten results in decreased phosphorylation of CREB1 protein CTD PMID:37678661 NCBI chr 9:65,903,511...65,972,562
Ensembl chr 9:65,903,547...65,970,816 		JBrowse link
G Cryab crystallin, alpha B multiple interactions EXP Melitten promotes the reaction [sodium arsenite results in increased expression of CRYAB mRNA]; Melitten promotes the reaction [sodium arsenite results in increased expression of CRYAB protein] CTD PMID:8591993 NCBI chr 8:51,093,441...51,099,161
Ensembl chr 8:51,093,441...51,099,157 		JBrowse link
G Dlg4 discs large MAGUK scaffold protein 4 decreases expression ISO Melitten results in decreased expression of DLG4 protein CTD PMID:37678661 NCBI chr10:54,740,700...54,769,097
Ensembl chr10:54,739,470...54,767,153 		JBrowse link
G Dnah12 dynein, axonemal, heavy chain 12 decreases expression ISO Melitten results in decreased expression of DNAH12 mRNA CTD PMID:37678661 NCBI chr16:1,936,354...2,092,663
Ensembl chr16:1,937,817...2,092,664 		JBrowse link
G Dnah17 dynein, axonemal, heavy chain 17 increases expression ISO Melitten results in increased expression of DNAH17 mRNA CTD PMID:37678661 NCBI chr10:103,244,144...103,364,953
Ensembl chr10:103,249,363...103,364,901 		JBrowse link
G Drd2 dopamine receptor D2 multiple interactions ISO Melitten inhibits the reaction [Spiperone binds to DRD2 protein] CTD PMID:20969853 NCBI chr 8:49,708,927...49,772,876
Ensembl chr 8:49,708,927...49,772,875 		JBrowse link
G Egfr epidermal growth factor receptor increases activity ISO Melitten results in increased activity of EGFR protein CTD PMID:22613720 NCBI chr14:91,176,979...91,349,722
Ensembl chr14:91,177,067...91,344,382 		JBrowse link
G Fas Fas cell surface death receptor increases expression ISO Melitten results in increased expression of FAS mRNA; Melitten results in increased expression of FAS protein CTD PMID:16974113 PMID:17854560 NCBI chr 1:231,798,963...231,832,591
Ensembl chr 1:231,798,960...231,832,591 		JBrowse link
G Fgf2 fibroblast growth factor 2 decreases expression ISO Melitten results in decreased expression of FGF2 mRNA CTD PMID:18076793 NCBI chr 2:120,236,328...120,290,673
Ensembl chr 2:120,236,328...120,291,221 		JBrowse link
G Fn1 fibronectin 1 multiple interactions ISO Melitten inhibits the reaction [Thioacetamide results in increased expression of FN1 protein] CTD PMID:21969711 NCBI chr 9:73,196,044...73,264,695
Ensembl chr 9:73,196,044...73,264,678 		JBrowse link
G Gap43 growth associated protein 43 increases phosphorylation
decreases expression		 ISO Melitten results in increased phosphorylation of GAP43 protein
Melitten results in decreased expression of GAP43 protein		 CTD PMID:9852580 PMID:37678661 NCBI chr11:58,376,371...58,470,047
Ensembl chr11:58,376,371...58,470,045 		JBrowse link
G Gli1 GLI family zinc finger 1 decreases expression ISO Melitten results in decreased expression of GLI1 protein CTD PMID:26189965 NCBI chr 7:63,156,926...63,169,579
Ensembl chr 7:63,156,926...63,169,251 		JBrowse link
G Gng11 G protein subunit gamma 11 decreases expression ISO Melitten results in decreased expression of GNG11 mRNA CTD PMID:37678661 NCBI chr 4:32,023,003...32,028,443
Ensembl chr 4:32,023,003...32,028,442 		JBrowse link
G Gnrh1 gonadotropin releasing hormone 1 multiple interactions ISO GNRH1 protein results in increased susceptibility to [Melitten binds to CGB3 protein] CTD PMID:19261682 NCBI chr15:41,972,482...41,976,690
Ensembl chr15:41,972,905...41,973,581
Ensembl chr15:41,972,905...41,973,581 		JBrowse link
G H19 H19 imprinted maternally expressed transcript decreases expression ISO Melitten results in decreased expression of H19 mRNA CTD PMID:34375656 NCBI chr 1:197,730,698...197,733,374
Ensembl chr 1:197,730,698...197,733,134 		JBrowse link
G Hrh2 histamine receptor H 2 increases response to substance
increases activity
multiple interactions		 EXP HRH2 protein results in increased susceptibility to Melitten
Melitten results in increased activity of HRH2 protein
Ranitidine inhibits the reaction [Melitten results in increased activity of HRH2 protein]		 CTD PMID:22995146 NCBI chr17:10,366,004...10,407,791
Ensembl chr17:10,368,298...10,407,631 		JBrowse link
G Htr1a 5-hydroxytryptamine receptor 1A multiple interactions ISO Melitten inhibits the reaction [HTR1A protein inhibits the reaction [Colforsin results in increased abundance of Cyclic AMP]] CTD PMID:11356925 NCBI chr 2:36,693,462...36,698,026
Ensembl chr 2:36,694,174...36,695,442 		JBrowse link
G Icam1 intercellular adhesion molecule 1 decreases expression ISO Melitten results in decreased expression of ICAM1 protein CTD PMID:12697458 NCBI chr 8:19,553,063...19,565,438
Ensembl chr 8:19,553,645...19,565,438 		JBrowse link
G Ikbkb inhibitor of nuclear factor kappa B kinase subunit beta multiple interactions
affects binding		 ISO Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]
Melitten binds to IKBKB protein
Dithiothreitol inhibits the reaction [Melitten binds to and results in decreased activity of IKBKB protein]; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Glutathione inhibits the reaction [Melitten binds to and results in decreased activity of IKBKB protein]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Hydrogen Peroxide inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased activity of IKBKB protein]; Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]; Melitten inhibits the reaction [TNF protein results in increased activity of IKBKB protein]		 CTD PMID:17067557 NCBI chr16:69,319,487...69,373,251
Ensembl chr16:69,319,554...69,373,250 		JBrowse link
G Il18 interleukin 18 increases expression
multiple interactions		 ISO Melitten results in increased expression of IL18 protein
AIM2 protein promotes the reaction [Melitten results in increased expression of IL18 protein]		 CTD PMID:22973906 NCBI chr 8:50,904,630...50,932,887
Ensembl chr 8:50,906,960...50,932,887 		JBrowse link
G Il1b interleukin 1 beta multiple interactions
increases expression		 ISO
EXP		 AIM2 protein promotes the reaction [Melitten results in increased expression of IL1B protein]
Melitten inhibits the reaction [TNF protein results in increased expression of IL1B protein]
Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of IL1B mRNA]		 CTD PMID:17570326 PMID:21969711 PMID:22973906 NCBI chr 3:116,577,005...116,583,386
Ensembl chr 3:116,577,010...116,583,415 		JBrowse link
G Il6 interleukin 6 multiple interactions EXP
ISO		 Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of IL6STP1 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]; Melitten inhibits the reaction [TNF protein results in increased expression of IL6 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein]
Melitten inhibits the reaction [Acetic Acid results in increased expression of IL6 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 mRNA]; Melitten inhibits the reaction [Thioacetamide results in increased expression of IL6 protein]		 CTD PMID:17570326 PMID:21354845 PMID:21969711 PMID:33002459 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178 		JBrowse link
G Il6r interleukin 6 receptor multiple interactions EXP Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of IL6STP1 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein] CTD PMID:21354845 NCBI chr 2:175,289,157...175,347,719
Ensembl chr 2:175,298,686...175,347,536 		JBrowse link
G Jak2 Janus kinase 2 decreases phosphorylation ISO Melitten results in decreased phosphorylation of JAK2 protein CTD PMID:22027265 NCBI chr 1:226,995,334...227,054,381
Ensembl chr 1:226,995,334...227,054,189 		JBrowse link
G Jun Jun proto-oncogene, AP-1 transcription factor subunit multiple interactions
decreases expression		 ISO Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased localization of JUN protein]
Melitten results in decreased expression of JUN mRNA		 CTD PMID:20082219 PMID:37678661 NCBI chr 5:109,894,175...109,897,268
Ensembl chr 5:109,893,145...109,897,656 		JBrowse link
G Kdr kinase insert domain receptor decreases expression ISO Melitten results in decreased expression of KDR protein CTD PMID:23110475 NCBI chr14:32,217,871...32,261,018
Ensembl chr14:32,217,871...32,261,018 		JBrowse link
G Lhcgr luteinizing hormone/choriogonadotropin receptor multiple interactions ISO LHCGR protein results in increased susceptibility to [Melitten binds to CGB3 protein] CTD PMID:19261682 NCBI chr 6:5,661,871...5,728,109
Ensembl chr 6:5,661,871...5,724,521 		JBrowse link
G Map2 microtubule-associated protein 2 decreases expression ISO Melitten results in decreased expression of MAP2 protein CTD PMID:37678661 NCBI chr 9:67,723,422...67,981,886
Ensembl chr 9:67,723,371...67,979,809 		JBrowse link
G Mapk1 mitogen activated protein kinase 1 decreases phosphorylation
increases phosphorylation
multiple interactions		 ISO
EXP		 Melitten results in decreased phosphorylation of MAPK1 protein
Melitten results in increased phosphorylation of MAPK1 protein
Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of MAPK1 protein]
Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of and results in increased activity of MAPK1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK1 protein]; Melitten results in increased phosphorylation of and results in increased activity of MAPK1 protein		 CTD PMID:17570326 PMID:17579088 PMID:17654254 PMID:20082219 PMID:22613720 More... NCBI chr11:83,957,813...84,023,629
Ensembl chr11:83,957,813...84,023,616 		JBrowse link
G Mapk3 mitogen activated protein kinase 3 multiple interactions
decreases phosphorylation
increases phosphorylation		 ISO
EXP		 Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of and results in increased activity of MAPK3 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK3 protein]; Melitten results in increased phosphorylation of and results in increased activity of MAPK3 protein
Melitten results in decreased phosphorylation of MAPK3 protein
Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of MAPK3 protein]
Melitten results in increased phosphorylation of MAPK3 protein		 CTD PMID:17570326 PMID:17579088 PMID:17654254 PMID:20082219 PMID:22613720 More... NCBI chr 1:181,366,646...181,372,863
Ensembl chr 1:181,366,637...181,372,863 		JBrowse link
G Mecp2 methyl CpG binding protein 2 decreases expression ISO Melitten results in decreased expression of MECP2 mRNA; Melitten results in decreased expression of MECP2 protein CTD PMID:26189965 NCBI chr  X:151,781,177...151,844,687
Ensembl chr  X:151,789,930...151,844,689 		JBrowse link
G Mmp2 matrix metallopeptidase 2 multiple interactions ISO Melitten inhibits the reaction [TNF protein results in increased secretion of MMP2 protein] CTD PMID:22926441 NCBI chr19:14,154,657...14,182,870
Ensembl chr19:14,154,657...14,182,870 		JBrowse link
G Mmp3 matrix metallopeptidase 3 multiple interactions ISO Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of MMP3 protein] CTD PMID:17303203 NCBI chr 8:4,640,397...4,653,963
Ensembl chr 8:4,640,416...4,653,961 		JBrowse link
G Mmp9 matrix metallopeptidase 9 multiple interactions ISO Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of and results in increased activity of MMP9 protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of and results in increased secretion of MMP9 protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP9 protein] CTD PMID:19969058 PMID:20082219 PMID:22926441 NCBI chr 3:153,684,158...153,692,118
Ensembl chr 3:153,683,858...153,692,120 		JBrowse link
G Mt-atp6 mitochondrially encoded ATP synthase membrane subunit 6 increases expression ISO Melitten results in increased expression of ATP6 mRNA CTD PMID:37678661 NCBI chr MT:7,919...8,599
NCBI chr MT:7,919...8,599
NCBI chr MT:7,919...8,599
Ensembl chr MT:7,919...8,599 		JBrowse link
G Mt-nd1 mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 1 increases expression ISO Melitten results in increased expression of ND1 mRNA CTD PMID:37678661 NCBI chr MT:2,740...3,694
NCBI chr MT:2,740...3,694
NCBI chr MT:2,740...3,694
Ensembl chr MT:2,740...3,694 		JBrowse link
G Mt-nd2 mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 2 increases expression ISO Melitten results in increased expression of ND2 mRNA CTD PMID:37678661 NCBI chr MT:3,904...4,942
NCBI chr MT:3,904...4,942
NCBI chr MT:3,904...4,942
Ensembl chr MT:3,904...4,942 		JBrowse link
G Mt-nd4 mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 4 increases expression ISO Melitten results in increased expression of ND4 mRNA CTD PMID:37678661 NCBI chr MT:10,160...11,537
NCBI chr MT:10,160...11,537
NCBI chr MT:10,160...11,537
Ensembl chr MT:10,160...11,537 		JBrowse link
G Mt-nd4l mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 4L increases expression ISO Melitten results in increased expression of ND4L mRNA CTD PMID:37678661 NCBI chr MT:9,870...10,166
NCBI chr MT:9,870...10,166
NCBI chr MT:9,870...10,166
Ensembl chr MT:9,870...10,166 		JBrowse link
G Mt-nd5 mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 5 increases expression ISO Melitten results in increased expression of ND5 mRNA CTD PMID:37678661 NCBI chr MT:11,736...13,565
NCBI chr MT:11,736...13,565
NCBI chr MT:11,736...13,565
Ensembl chr MT:11,736...13,565 		JBrowse link
G Ndufa2 NADH:ubiquinone oxidoreductase subunit A2 decreases expression ISO Melitten results in decreased expression of NDUFA2 mRNA CTD PMID:37678661 NCBI chr18:28,355,774...28,357,863
Ensembl chr18:28,355,774...28,358,076 		JBrowse link
G Ndufb10 NADH:ubiquinone oxidoreductase subunit B10 decreases expression ISO Melitten results in decreased expression of NDUFB10 mRNA CTD PMID:37678661 NCBI chr10:13,749,273...13,751,434
Ensembl chr10:13,749,275...13,751,442 		JBrowse link
G Nfkb1 nuclear factor kappa B subunit 1 multiple interactions
decreases localization		 ISO [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of and results in increased activity of NFKB1 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of NFKB1 protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of NFKB1 protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of NFKB1 protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of NFKB1 protein]]
Melitten results in decreased localization of NFKB1 protein		 CTD PMID:15529353 PMID:17067557 PMID:18507870 PMID:21456063 NCBI chr 2:224,016,214...224,132,135
Ensembl chr 2:224,016,214...224,110,404 		JBrowse link
G Nfkbia NFKB inhibitor alpha multiple interactions ISO [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]		 CTD PMID:15529353 PMID:17067557 PMID:17570326 PMID:18507870 PMID:22926441 NCBI chr 6:72,858,713...72,861,941
Ensembl chr 6:72,858,712...72,861,941 		JBrowse link
G Nos1 nitric oxide synthase 1 decreases activity EXP Melitten results in decreased activity of NOS1 protein CTD PMID:17098364 NCBI chr12:38,615,111...38,795,492
Ensembl chr12:38,626,714...38,710,945 		JBrowse link
G Nos2 nitric oxide synthase 2 decreases expression
multiple interactions		 ISO Melitten results in decreased expression of NOS2 protein
Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[TNF protein results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of NOS2 mRNA]		 CTD PMID:15529353 PMID:17067557 PMID:17570326 PMID:21456063 NCBI chr10:63,815,308...63,851,208
Ensembl chr10:63,815,308...63,851,210 		JBrowse link
G Ntrk2 neurotrophic receptor tyrosine kinase 2 decreases phosphorylation ISO Melitten results in decreased phosphorylation of NTRK2 protein CTD PMID:37678661 NCBI chr17:5,558,992...5,870,299
Ensembl chr17:5,559,043...5,869,136 		JBrowse link
G P2rx7 purinergic receptor P2X 7 increases activity
increases response to substance		 ISO Melitten results in increased activity of P2RX7 protein
P2RX7 protein results in increased susceptibility to Melitten		 CTD PMID:22613720 NCBI chr12:33,889,709...33,934,168
Ensembl chr12:33,879,745...33,934,619 		JBrowse link
G Parp1 poly (ADP-ribose) polymerase 1 multiple interactions ISO Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of PARP1 protein] CTD PMID:21871910 NCBI chr13:92,307,593...92,339,406
Ensembl chr13:92,307,586...92,339,404 		JBrowse link
G Pdgfrb platelet derived growth factor receptor beta multiple interactions EXP Melitten results in decreased phosphorylation of and results in decreased activity of PDGFRB protein CTD PMID:17654254 NCBI chr18:54,499,962...54,538,840
Ensembl chr18:54,499,964...54,538,843 		JBrowse link
G Pla2g2a phospholipase A2 group IIA multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of PLA2G2A protein] CTD PMID:33002459 NCBI chr 5:151,076,442...151,079,019
Ensembl chr 5:151,076,442...151,079,014 		JBrowse link
G Pla2g4a phospholipase A2 group IVA decreases expression ISO Melitten results in decreased expression of PLA2G4A protein CTD PMID:21456063 NCBI chr13:61,877,818...62,022,261
Ensembl chr13:61,877,813...62,022,266 		JBrowse link
G Plcg1 phospholipase C, gamma 1 decreases phosphorylation EXP Melitten results in decreased phosphorylation of PLCG1 protein CTD PMID:17654254 NCBI chr 3:149,385,587...149,416,330
Ensembl chr 3:149,385,587...149,416,330 		JBrowse link
G Ptch1 patched 1 increases expression ISO Melitten results in increased expression of PTCH1 protein CTD PMID:26189965 NCBI chr17:1,542,705...1,607,730
Ensembl chr17:1,542,877...1,607,333 		JBrowse link
G Ptgs2 prostaglandin-endoperoxide synthase 2 multiple interactions
increases expression
decreases expression		 ISO [Melitten results in decreased expression of PTGS2 protein] which results in decreased chemical synthesis of Dinoprostone; Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; SB 203580 inhibits the reaction [Melitten results in decreased expression of PTGS2 protein]
Melitten results in increased expression of PTGS2 mRNA; Melitten results in increased expression of PTGS2 protein
[Melitten results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone; Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[TNF protein results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [Acetic Acid results in increased expression of PTGS2 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of PTGS2 mRNA]		 CTD PMID:11094054 PMID:11821123 PMID:15529353 PMID:17067557 PMID:17570326 More... NCBI chr13:62,163,936...62,172,193
Ensembl chr13:62,163,932...62,172,188 		JBrowse link
G Rab11a RAB11a, member RAS oncogene family multiple interactions ISO Melitten results in decreased localization of [RAB11A protein co-treated with RAB5A protein] CTD PMID:22683840 NCBI chr 8:65,223,698...65,246,461
Ensembl chr 8:65,222,949...65,246,525 		JBrowse link
G Rab5a RAB5A, member RAS oncogene family multiple interactions ISO Melitten results in decreased localization of [RAB11A protein co-treated with RAB5A protein]; Melitten results in increased localization of [SLC6A3 protein co-treated with RAB5A protein] CTD PMID:22683840 NCBI chr 9:6,483,906...6,512,877
Ensembl chr 9:6,484,469...6,512,873 		JBrowse link
G Rac1 Rac family small GTPase 1 decreases activity ISO Melitten results in decreased activity of RAC1 protein CTD PMID:18506888 NCBI chr12:11,037,028...11,057,251
Ensembl chr12:11,036,698...11,057,251 		JBrowse link
G Rela RELA proto-oncogene, NF-kB subunit multiple interactions
decreases localization		 ISO
EXP		 Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased localization of RELA protein]; Melitten inhibits the reaction [TNF protein affects the localization of RELA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]]
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]
Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]]
Melitten results in decreased localization of RELA protein		 CTD PMID:17570326 PMID:18507870 PMID:20082219 PMID:21354845 PMID:21456063 More... NCBI chr 1:202,925,001...202,935,484
Ensembl chr 1:202,924,945...202,935,484 		JBrowse link
G Scn10a sodium voltage-gated channel alpha subunit 10 increases expression
multiple interactions		 EXP Melitten results in increased expression of SCN10A mRNA; Melitten results in increased expression of SCN10A protein
[Melitten results in increased expression of SCN10A protein] which results in increased transport of Sodium		 CTD PMID:23264124 NCBI chr 8:119,350,723...119,462,882
Ensembl chr 8:119,350,724...119,462,614 		JBrowse link
G Scn11a sodium voltage-gated channel alpha subunit 11 increases expression
multiple interactions
increases response to substance		 EXP Melitten results in increased expression of SCN11A mRNA; Melitten results in increased expression of SCN11A protein
[Melitten results in increased expression of SCN11A protein] which results in increased transport of Sodium
SCN11A protein results in increased susceptibility to Melitten		 CTD PMID:23264124 NCBI chr 8:119,495,550...119,567,044
Ensembl chr 8:119,496,769...119,567,044 		JBrowse link
G Sdhc succinate dehydrogenase complex subunit C decreases expression ISO Melitten results in decreased expression of SDHC mRNA CTD PMID:37678661 NCBI chr13:83,544,652...83,565,560
Ensembl chr13:83,544,652...83,566,253 		JBrowse link
G Shh sonic hedgehog signaling molecule decreases expression ISO Melitten results in decreased expression of SHH protein CTD PMID:26189965 NCBI chr 4:6,954,017...6,963,170
Ensembl chr 4:6,954,017...6,963,170 		JBrowse link
G Slc6a3 solute carrier family 6 member 3 increases localization
multiple interactions		 ISO Melitten results in increased localization of SLC6A3 protein
Cocaine inhibits the reaction [Melitten results in increased localization of SLC6A3 protein]; Melitten inhibits the reaction [2beta-carbomethoxy-3beta-(4-iodophenyl)tropane binds to SLC6A3 protein]; Melitten inhibits the reaction [SLC6A3 protein results in increased uptake of Dopamine]; Melitten results in increased localization of [SLC6A3 protein co-treated with RAB5A protein]		 CTD PMID:20969853 PMID:22683840 NCBI chr 1:29,709,443...29,750,413
Ensembl chr 1:29,709,443...29,750,413 		JBrowse link
G Socs3 suppressor of cytokine signaling 3 decreases expression ISO Melitten results in decreased expression of SOCS3 mRNA CTD PMID:37678661 NCBI chr10:103,193,909...103,197,322
Ensembl chr10:103,193,537...103,197,787 		JBrowse link
G Stat3 signal transducer and activator of transcription 3 decreases phosphorylation
multiple interactions		 ISO
EXP		 Melitten results in decreased phosphorylation of STAT3 protein
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]
TNFRSF10A protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]; TNFRSF21 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]; TNFRSF25 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]		 CTD PMID:21354845 PMID:22027265 NCBI chr10:85,811,206...85,863,057
Ensembl chr10:85,811,218...85,863,057 		JBrowse link
G Syp synaptophysin decreases expression ISO Melitten results in decreased expression of SYP protein CTD PMID:37678661 NCBI chr  X:14,849,444...14,864,553
Ensembl chr  X:14,849,444...14,864,745 		JBrowse link
G Tbxa2r thromboxane A2 receptor increases response to substance EXP TBXA2R protein results in increased susceptibility to Melitten CTD PMID:16524625 NCBI chr 7:8,383,347...8,390,753
Ensembl chr 7:8,383,378...8,388,176 		JBrowse link
G Tgfa transforming growth factor alpha increases secretion ISO Melitten results in increased secretion of TGFA protein CTD PMID:22613720 NCBI chr 4:118,618,043...118,700,897
Ensembl chr 4:118,618,269...118,700,894 		JBrowse link
G Tgfb1 transforming growth factor, beta 1 multiple interactions
decreases activity		 ISO Melitten affects the reaction [TGFB1 protein affects the localization of APAF1 protein]; Melitten affects the reaction [TGFB1 protein affects the localization of BAX protein]; Melitten affects the reaction [TGFB1 protein affects the localization of BCL2 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP3 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP9 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of PARP1 protein]; Melitten inhibits the reaction [Thioacetamide results in increased expression of TGFB1 protein]
Melitten results in decreased activity of TGFB1 protein		 CTD PMID:21871910 PMID:21969711 NCBI chr 1:81,196,532...81,212,848
Ensembl chr 1:81,196,532...81,212,847 		JBrowse link
G Tlr4 toll-like receptor 4 multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of TLR4 protein] CTD PMID:33002459 NCBI chr 5:80,145,867...80,159,501
Ensembl chr 5:80,145,826...80,159,628 		JBrowse link
G Tnf tumor necrosis factor multiple interactions
decreases secretion
increases expression		 ISO
EXP		 Melitten inhibits the reaction [TNF protein affects the localization of RELA protein]; Melitten inhibits the reaction [TNF protein results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of AKT1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK3 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP2 protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP9 protein]
Melitten results in decreased secretion of TNF protein
Melitten inhibits the reaction [TNF protein results in increased expression of IL1B protein]; Melitten inhibits the reaction [TNF protein results in increased expression of IL6 protein]
Melitten results in increased expression of TNF mRNA
Melitten inhibits the reaction [[TNF protein results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[TNF protein results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [Acetic Acid results in increased expression of TNF protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of TNF mRNA]; Melitten inhibits the reaction [Thioacetamide results in increased expression of TNF protein]; Melitten inhibits the reaction [TNF protein results in increased activity of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased activity of IKBKB protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]		 CTD PMID:11094054 PMID:11821123 PMID:17067557 PMID:17570326 PMID:21969711 More... NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629 		JBrowse link
G Tnfrsf10b TNF receptor superfamily member 10b multiple interactions
increases expression
affects response to substance		 ISO TNFRSF10A protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
Melitten results in increased expression of TNFRSF10A mRNA
TNFRSF10A protein affects the susceptibility to Melitten		 CTD PMID:22027265 NCBI chr15:44,840,386...44,868,318
Ensembl chr15:44,840,386...44,867,467 		JBrowse link
G Tnfrsf21 TNF receptor superfamily member 21 increases expression
affects response to substance
multiple interactions		 ISO Melitten results in increased expression of TNFRSF21 mRNA
TNFRSF21 protein affects the susceptibility to Melitten
TNFRSF21 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]		 CTD PMID:22027265 NCBI chr 9:17,879,156...17,954,085
Ensembl chr 9:17,879,156...17,954,085 		JBrowse link
G Tnfrsf25 TNF receptor superfamily member 25 increases expression
multiple interactions
affects response to substance		 ISO Melitten results in increased expression of TNFRSF25 mRNA
TNFRSF25 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
TNFRSF25 protein affects the susceptibility to Melitten		 CTD PMID:22027265 NCBI chr 5:162,621,669...162,626,341
Ensembl chr 5:162,622,075...162,626,341 		JBrowse link
G Traf6 TNF receptor associated factor 6 multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of TRAF6 protein] CTD PMID:33002459 NCBI chr 3:87,963,517...87,988,316
Ensembl chr 3:87,963,514...87,983,507 		JBrowse link
G Trpv1 transient receptor potential cation channel, subfamily V, member 1 multiple interactions
increases response to substance
increases activity		 EXP [Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium; capsazepine inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; capsazepine inhibits the reaction [TRPV1 protein results in increased susceptibility to Melitten]; Indomethacin inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; Masoprocol inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium] CTD PMID:16446039 PMID:21453681 NCBI chr10:57,851,428...57,876,513
Ensembl chr10:57,851,428...57,876,513 		JBrowse link
G Uqcrfs1 ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 decreases expression ISO Melitten results in decreased expression of UQCRFS1 mRNA CTD PMID:37678661 NCBI chr17:33,977,908...33,982,478
Ensembl chr17:33,977,921...33,982,479 		JBrowse link
G Vcam1 vascular cell adhesion molecule 1 multiple interactions ISO Melitten inhibits the reaction [Thioacetamide results in increased expression of VCAM1 protein] CTD PMID:21969711 NCBI chr 2:204,038,120...204,057,852
Ensembl chr 2:204,038,114...204,057,958 		JBrowse link
G Vdac1 voltage-dependent anion channel 1 increases expression ISO Melitten results in increased expression of VDAC1 protein CTD PMID:34375656 NCBI chr10:36,532,306...36,559,642
Ensembl chr10:36,532,244...36,559,640 		JBrowse link
G Vegfa vascular endothelial growth factor A multiple interactions
decreases expression		 ISO SB 203580 inhibits the reaction [Melitten results in decreased expression of VEGFA protein]
Melitten results in decreased expression of VEGFA mRNA; Melitten results in decreased expression of VEGFA protein		 CTD PMID:18076793 PMID:23110475 NCBI chr 9:14,955,300...14,970,641
Ensembl chr 9:14,955,300...14,970,641 		JBrowse link
G Xiap X-linked inhibitor of apoptosis decreases expression ISO Melitten results in decreased expression of XIAP protein CTD PMID:21456063 NCBI chr  X:120,890,537...120,938,413
Ensembl chr  X:120,897,907...120,934,700 		JBrowse link
G Xist X inactive specific transcript increases expression ISO Melitten results in increased expression of XIST mRNA CTD PMID:34375656 NCBI chr  X:68,474,987...68,492,500 JBrowse link
omega-conotoxin GVIA term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Clu clusterin multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [methoxyacetic acid results in increased expression of and results in increased secretion of CLU protein] CTD PMID:14656996 NCBI chr15:40,161,068...40,200,315
Ensembl chr15:40,174,617...40,200,315 		JBrowse link
G Fos Fos proto-oncogene, AP-1 transcription factor subunit multiple interactions EXP [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] inhibits the reaction [Potassium Chloride affects the expression of FOS mRNA] CTD PMID:20211981 NCBI chr 6:105,121,170...105,124,036
Ensembl chr 6:105,121,170...105,124,036 		JBrowse link
G Kcna1 potassium voltage-gated channel subfamily A member 1 multiple interactions EXP [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] promotes the reaction [Potassium Chloride results in increased expression of KCNA1 mRNA] CTD PMID:20211981 NCBI chr 4:159,464,223...159,472,905
Ensembl chr 4:159,464,188...159,472,682 		JBrowse link
G Kcnc3 potassium voltage-gated channel subfamily C member 3 multiple interactions EXP [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] inhibits the reaction [Potassium Chloride results in increased expression of KCNC3 mRNA] CTD PMID:20211981 NCBI chr 1:95,080,960...95,095,165
Ensembl chr 1:95,080,960...95,095,160 		JBrowse link
G Sct secretin multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [Potassium Chloride results in increased secretion of SCT protein] CTD PMID:16888165 NCBI chr 1:196,382,857...196,383,668
Ensembl chr 1:196,382,856...196,383,658 		JBrowse link
G Snca synuclein alpha multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [SNCA protein results in increased uptake of Calcium] CTD PMID:17179863 NCBI chr 4:89,696,420...89,797,240
Ensembl chr 4:89,696,420...89,796,262 		JBrowse link
G Tac1 tachykinin, precursor 1 multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [Potassium results in increased secretion of TAC1 protein modified form] CTD PMID:2325850 NCBI chr 4:35,679,183...35,687,180
Ensembl chr 4:35,679,704...35,687,178 		JBrowse link
Term paths to the root
Path 1
Term Annotations click to browse term
  CHEBI ontology 19831
    chemical entity 19829
      group 19788
        organic group 18944
          amino-acid residue 11125
            peptide 11125
              peptidyl amide 114
                Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 0
                JNK inhibitor I 0
                QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
                corticotropin-releasing hormone (human) 0
                corticotropin-releasing hormone (ovine) 0
                dermaseptin s3(1-16)-NH2 0
                gastrin-14 0
                kisspeptin-54 0
                lixisenatide 0
                mastoparan 5
                mastoparan-A 0
                mastoparan-AF 0
                mastoparan-B 0
                mastoparan-D 0
                mastoparan-M 0
                mastoparan-V 0
                melittin 105
                omega-conotoxin GVIA 7
                peptide YY 0
                tetragastrin 0
Path 2
Term Annotations click to browse term
  CHEBI ontology 19831
    subatomic particle 19829
      composite particle 19829
        hadron 19829
          baryon 19829
            nucleon 19829
              atomic nucleus 19829
                atom 19829
                  main group element atom 19779
                    p-block element atom 19779
                      carbon group element atom 19728
                        carbon atom 19724
                          organic molecular entity 19724
                            heteroorganic entity 19477
                              organochalcogen compound 19240
                                organooxygen compound 19155
                                  carbon oxoacid 18613
                                    carboxylic acid 18610
                                      carboacyl group 17699
                                        univalent carboacyl group 17699
                                          carbamoyl group 17549
                                            carboxamide 17549
                                              peptide 11125
                                                peptidyl amide 114
                                                  Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 0
                                                  JNK inhibitor I 0
                                                  QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
                                                  corticotropin-releasing hormone (human) 0
                                                  corticotropin-releasing hormone (ovine) 0
                                                  dermaseptin s3(1-16)-NH2 0
                                                  gastrin-14 0
                                                  kisspeptin-54 0
                                                  lixisenatide 0
                                                  mastoparan 5
                                                  mastoparan-A 0
                                                  mastoparan-AF 0
                                                  mastoparan-B 0
                                                  mastoparan-D 0
                                                  mastoparan-M 0
                                                  mastoparan-V 0
                                                  melittin 105
                                                  omega-conotoxin GVIA 7
                                                  peptide YY 0
                                                  tetragastrin 0
paths to the root