Symbol:
Nfkbie
Name:
NFKB inhibitor epsilon
RGD ID:
735070
Description:
Involved in D-serine transmembrane transport. Located in perinuclear region of cytoplasm. Orthologous to human NFKBIE (NFKB inhibitor epsilon); PARTICIPATES IN nuclear factor kappa B signaling pathway; B cell receptor signaling pathway; neurotrophic factor signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-diaminodiphenylmethane.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC72568; NF-kappa-B inhibitor epsilon; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon; Slc35b2; solute carrier family 35, member B2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NFKBIE (NFKB inhibitor epsilon)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Nfkbie (nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, epsilon)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nfkbie (NFKB inhibitor epsilon)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NFKBIE (NFKB inhibitor epsilon)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NFKBIE (NFKB inhibitor epsilon)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nfkbie (NFKB inhibitor epsilon)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NFKBIE (NFKB inhibitor epsilon)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NFKBIE (NFKB inhibitor epsilon)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nfkbie (NFKB inhibitor epsilon)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SYT17 (synaptotagmin 17)
HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
NFKBIE (NFKB inhibitor epsilon)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nfkbie (nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, epsilon)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nfkbie (nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nfkbie
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 22,941,037 - 22,947,872 (-) NCBI GRCr8 mRatBN7.2 9 15,443,600 - 15,450,437 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 15,436,941 - 15,450,437 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 24,030,126 - 24,036,913 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 29,092,803 - 29,099,590 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 27,393,565 - 27,400,352 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 17,828,405 - 17,835,240 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 17,828,408 - 17,835,240 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 16,717,126 - 16,723,961 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 11,044,112 - 11,050,948 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 11,041,436 - 11,048,270 (-) NCBI Celera 9 13,186,838 - 13,193,673 (-) NCBI Celera Cytogenetic Map 9 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nfkbie Rat (S)-nicotine decreases expression ISO NFKBIE (Homo sapiens) 6480464 Nicotine results in decreased expression of NFKBIE mRNA CTD PMID:18247414 Nfkbie Rat 1,1-dichloroethene increases expression ISO Nfkbie (Mus musculus) 6480464 vinylidene chloride results in increased expression of NFKBIE mRNA CTD PMID:26682919 Nfkbie Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of NFKBIE mRNA CTD PMID:25380136 Nfkbie Rat 17beta-estradiol increases expression ISO NFKBIE (Homo sapiens) 6480464 Estradiol results in increased expression of NFKBIE mRNA CTD PMID:31614463 Nfkbie Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Nfkbie (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NFKBIE mRNA CTD PMID:19770486 Nfkbie Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NFKBIE mRNA CTD PMID:33387578 Nfkbie Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nfkbie (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NFKBIE mRNA CTD PMID:21570461 Nfkbie Rat 2-hydroxypropanoic acid increases expression ISO NFKBIE (Homo sapiens) 6480464 Lactic Acid results in increased expression of NFKBIE mRNA CTD PMID:30851411 Nfkbie Rat 2-naphthylamine decreases expression ISO NFKBIE (Homo sapiens) 6480464 2-Naphthylamine results in decreased expression of NFKBIE mRNA CTD PMID:18247414 Nfkbie Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of NFKBIE mRNA CTD PMID:25380136 Nfkbie Rat 4-hydroxynon-2-enal increases expression ISO Nfkbie (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of NFKBIE mRNA CTD PMID:19191707 Nfkbie Rat 4-hydroxyphenyl retinamide increases expression ISO Nfkbie (Mus musculus) 6480464 Fenretinide results in increased expression of NFKBIE mRNA CTD PMID:28973697 Nfkbie Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NFKBIE mRNA CTD PMID:24780913 Nfkbie Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of NFKBIE mRNA CTD PMID:31881176 Nfkbie Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of NFKBIE mRNA CTD PMID:28959563 Nfkbie Rat aflatoxin B1 increases expression ISO Nfkbie (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of NFKBIE mRNA CTD PMID:19770486 Nfkbie Rat aflatoxin B1 affects expression ISO NFKBIE (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of NFKBIE protein CTD PMID:20106945 Nfkbie Rat all-trans-retinoic acid increases expression ISO NFKBIE (Homo sapiens) 6480464 Tretinoin results in increased expression of NFKBIE mRNA CTD PMID:33167477 Nfkbie Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of NFKBIE mRNA CTD PMID:35163327 Nfkbie Rat andrographolide increases expression ISO NFKBIE (Homo sapiens) 6480464 andrographolide results in increased expression of NFKBIE mRNA CTD PMID:35724838 Nfkbie Rat antirheumatic drug increases expression ISO NFKBIE (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of NFKBIE mRNA CTD PMID:17696278 Nfkbie Rat aristolochic acid A increases expression ISO NFKBIE (Homo sapiens) 6480464 aristolochic acid I results in increased expression of NFKBIE mRNA CTD PMID:33212167 Nfkbie Rat arsane decreases response to substance ISO NFKBIE (Homo sapiens) 6480464 NFKBIE mRNA results in decreased susceptibility to Arsenic CTD PMID:17976673 Nfkbie Rat arsenic atom decreases response to substance ISO NFKBIE (Homo sapiens) 6480464 NFKBIE mRNA results in decreased susceptibility to Arsenic CTD PMID:17976673 Nfkbie Rat arsenite(3-) decreases expression ISO Nfkbie (Mus musculus) 6480464 arsenite results in decreased expression of NFKBIE mRNA CTD PMID:18929588 Nfkbie Rat arsenite(3-) multiple interactions ISO Nfkbie (Mus musculus) 6480464 TRP53 protein affects the reaction [arsenite results in decreased expression of NFKBIE mRNA] CTD PMID:18929588 Nfkbie Rat arsenous acid multiple interactions ISO NFKBIE (Homo sapiens) 6480464 Arsenic Trioxide results in decreased degradation of and results in increased stability of NFKBIE protein and Bortezomib inhibits the reaction [Arsenic Trioxide results in decreased expression of NFKBIE mRNA] CTD PMID:12560223 and PMID:20471514 Nfkbie Rat arsenous acid decreases expression ISO NFKBIE (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of NFKBIE mRNA CTD PMID:20471514 Nfkbie Rat Bardoxolone methyl increases expression ISO NFKBIE (Homo sapiens) 6480464 bardoxolone methyl results in increased expression of NFKBIE mRNA CTD PMID:35724838 Nfkbie Rat benzo[a]pyrene decreases expression ISO NFKBIE (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of NFKBIE mRNA CTD PMID:18247414 Nfkbie Rat benzo[a]pyrene decreases expression ISO Nfkbie (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of NFKBIE mRNA CTD PMID:19770486 Nfkbie Rat benzo[a]pyrene increases expression ISO NFKBIE (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of NFKBIE mRNA CTD PMID:20106945 and PMID:32234424 Nfkbie Rat beta-naphthoflavone increases expression ISO NFKBIE (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of NFKBIE mRNA CTD PMID:32151702 Nfkbie Rat bis(2-chloroethyl) sulfide increases expression ISO Nfkbie (Mus musculus) 6480464 Mustard Gas results in increased expression of NFKBIE mRNA CTD PMID:18955075 Nfkbie Rat bis(2-ethylhexyl) phthalate increases expression ISO NFKBIE (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of NFKBIE mRNA CTD PMID:31163220 Nfkbie Rat bisphenol A decreases expression ISO NFKBIE (Homo sapiens) 6480464 bisphenol A results in decreased expression of NFKBIE mRNA CTD PMID:29275510 Nfkbie Rat bisphenol A increases expression ISO Nfkbie (Mus musculus) 6480464 bisphenol A results in increased expression of NFKBIE mRNA CTD PMID:32156529 Nfkbie Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NFKBIE mRNA CTD PMID:34947998 Nfkbie Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of NFKBIE mRNA CTD PMID:25181051 Nfkbie Rat bortezomib multiple interactions ISO NFKBIE (Homo sapiens) 6480464 Bortezomib inhibits the reaction [arsenic trioxide results in decreased expression of NFKBIE mRNA] CTD PMID:20471514 Nfkbie Rat bortezomib increases stability ISO NFKBIE (Homo sapiens) 6480464 Bortezomib results in increased stability of NFKBIE protein CTD PMID:15543232 Nfkbie Rat buta-1,3-diene decreases expression ISO Nfkbie (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of NFKBIE mRNA CTD PMID:29038090 Nfkbie Rat butanal increases expression ISO NFKBIE (Homo sapiens) 6480464 butyraldehyde results in increased expression of NFKBIE mRNA CTD PMID:26079696 Nfkbie Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of NFKBIE promoter CTD PMID:22457795 Nfkbie Rat caffeine affects phosphorylation ISO NFKBIE (Homo sapiens) 6480464 Caffeine affects the phosphorylation of NFKBIE protein CTD PMID:35688186 Nfkbie Rat carbon nanotube increases expression ISO Nfkbie (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Nfkbie Rat casticin decreases expression ISO NFKBIE (Homo sapiens) 6480464 casticin results in decreased expression of NFKBIE mRNA CTD PMID:27862857 Nfkbie Rat CGP 52608 multiple interactions ISO NFKBIE (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to NFKBIE gene] CTD PMID:28238834 Nfkbie Rat chloroprene decreases expression EXP 6480464 Chloroprene results in decreased expression of NFKBIE mRNA CTD PMID:23125180 Nfkbie Rat choline multiple interactions ISO Nfkbie (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NFKBIE gene CTD PMID:20938992 Nfkbie Rat chromium(6+) affects expression ISO Nfkbie (Mus musculus) 6480464 chromium hexavalent ion affects the expression of NFKBIE mRNA CTD PMID:28472532 Nfkbie Rat ciguatoxin CTX1B affects expression ISO Nfkbie (Mus musculus) 6480464 Ciguatoxins affects the expression of NFKBIE mRNA CTD PMID:18353800 Nfkbie Rat crocidolite asbestos increases expression ISO NFKBIE (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of NFKBIE mRNA CTD PMID:18687144 more ... Nfkbie Rat cyclosporin A increases expression ISO NFKBIE (Homo sapiens) 6480464 Cyclosporine results in increased expression of NFKBIE mRNA CTD PMID:20106945 Nfkbie Rat cyclosporin A increases expression ISO Nfkbie (Mus musculus) 6480464 Cyclosporine results in increased expression of NFKBIE mRNA CTD PMID:23958496 Nfkbie Rat diarsenic trioxide decreases expression ISO NFKBIE (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of NFKBIE mRNA CTD PMID:20471514 Nfkbie Rat diarsenic trioxide multiple interactions ISO NFKBIE (Homo sapiens) 6480464 Arsenic Trioxide results in decreased degradation of and results in increased stability of NFKBIE protein and Bortezomib inhibits the reaction [Arsenic Trioxide results in decreased expression of NFKBIE mRNA] CTD PMID:12560223 and PMID:20471514 Nfkbie Rat Dibutyl phosphate affects expression ISO NFKBIE (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of NFKBIE mRNA CTD PMID:37042841 Nfkbie Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of NFKBIE mRNA CTD PMID:21266533 Nfkbie Rat dibutyl phthalate increases expression ISO Nfkbie (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of NFKBIE mRNA CTD PMID:17361019 and PMID:21266533 Nfkbie Rat dioxygen multiple interactions ISO Nfkbie (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of NFKBIE mRNA CTD PMID:30529165 Nfkbie Rat doxorubicin decreases expression ISO NFKBIE (Homo sapiens) 6480464 Doxorubicin results in decreased expression of NFKBIE mRNA CTD PMID:29803840 Nfkbie Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of NFKBIE mRNA CTD PMID:29391264 Nfkbie Rat enzyme inhibitor multiple interactions ISO NFKBIE (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of NFKBIE protein CTD PMID:23301498 Nfkbie Rat fluoranthene multiple interactions ISO Nfkbie (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of NFKBIE mRNA CTD PMID:28329830 Nfkbie Rat folic acid multiple interactions ISO Nfkbie (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NFKBIE gene CTD PMID:20938992 Nfkbie Rat Fusarenone X increases expression ISO Nfkbie (Mus musculus) 6480464 fusarenon-X results in increased expression of NFKBIE mRNA CTD PMID:24983900 Nfkbie Rat gemcitabine affects expression ISO NFKBIE (Homo sapiens) 6480464 Gemcitabine affects the expression of NFKBIE mRNA CTD PMID:17039268 Nfkbie Rat genistein increases expression ISO Nfkbie (Mus musculus) 6480464 Genistein results in increased expression of NFKBIE mRNA CTD PMID:32186404 Nfkbie Rat hydrogen peroxide affects expression ISO NFKBIE (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of NFKBIE mRNA CTD PMID:20044591 Nfkbie Rat ivermectin decreases expression ISO NFKBIE (Homo sapiens) 6480464 Ivermectin results in decreased expression of NFKBIE protein CTD PMID:32959892 Nfkbie Rat kojic acid increases expression ISO NFKBIE (Homo sapiens) 6480464 kojic acid results in increased expression of NFKBIE mRNA CTD PMID:16595896 Nfkbie Rat L-methionine multiple interactions ISO Nfkbie (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NFKBIE gene CTD PMID:20938992 Nfkbie Rat leflunomide decreases expression ISO Nfkbie (Mus musculus) 6480464 leflunomide results in decreased expression of NFKBIE mRNA CTD PMID:19751817 Nfkbie Rat lipopolysaccharide multiple interactions ISO Nfkbie (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Lipopolysaccharides results in decreased expression of NFKBIE protein] CTD PMID:12185005 Nfkbie Rat lipopolysaccharide increases expression ISO Nfkbie (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of NFKBIE mRNA CTD PMID:25890327 and PMID:26582142 Nfkbie Rat lipopolysaccharide increases degradation ISO Nfkbie (Mus musculus) 6480464 Lipopolysaccharides results in increased degradation of NFKBIE protein CTD PMID:17855110 Nfkbie Rat lipopolysaccharide decreases expression ISO Nfkbie (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of NFKBIE protein CTD PMID:12185005 Nfkbie Rat mangiferin decreases expression ISO Nfkbie (Mus musculus) 6480464 mangiferin results in decreased expression of NFKBIE mRNA CTD PMID:15135318 Nfkbie Rat menadione affects expression ISO NFKBIE (Homo sapiens) 6480464 Vitamin K 3 affects the expression of NFKBIE mRNA CTD PMID:20044591 Nfkbie Rat methidathion decreases expression ISO Nfkbie (Mus musculus) 6480464 methidathion results in decreased expression of NFKBIE mRNA CTD PMID:34813904 Nfkbie Rat methotrexate decreases expression ISO NFKBIE (Homo sapiens) 6480464 Methotrexate results in decreased expression of NFKBIE mRNA CTD PMID:17696278 Nfkbie Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Nfkbie (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Lipopolysaccharides results in decreased expression of NFKBIE protein] CTD PMID:12185005 Nfkbie Rat N-methyl-4-phenylpyridinium increases expression ISO NFKBIE (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of NFKBIE mRNA CTD PMID:25234470 Nfkbie Rat N-Nitrosopyrrolidine increases expression ISO NFKBIE (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of NFKBIE mRNA CTD PMID:32234424 Nfkbie Rat nickel atom increases expression ISO NFKBIE (Homo sapiens) 6480464 Nickel results in increased expression of NFKBIE mRNA CTD PMID:24768652 and PMID:25583101 Nfkbie Rat nicotine decreases expression ISO NFKBIE (Homo sapiens) 6480464 Nicotine results in decreased expression of NFKBIE mRNA CTD PMID:18247414 Nfkbie Rat nitrates multiple interactions ISO Nfkbie (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of NFKBIE mRNA CTD PMID:35964746 Nfkbie Rat o-anisidine affects expression ISO NFKBIE (Homo sapiens) 6480464 2-anisidine affects the expression of NFKBIE mRNA CTD PMID:28089782 Nfkbie Rat paracetamol affects expression ISO Nfkbie (Mus musculus) 6480464 Acetaminophen affects the expression of NFKBIE mRNA CTD PMID:17562736 Nfkbie Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NFKBIE mRNA CTD PMID:33387578 Nfkbie Rat paracetamol affects expression ISO NFKBIE (Homo sapiens) 6480464 Acetaminophen affects the expression of NFKBIE mRNA CTD PMID:25458485 Nfkbie Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of NFKBIE mRNA CTD PMID:32680482 Nfkbie Rat pentanal increases expression ISO NFKBIE (Homo sapiens) 6480464 pentanal results in increased expression of NFKBIE mRNA CTD PMID:26079696 Nfkbie Rat perfluorohexanesulfonic acid decreases expression ISO NFKBIE (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in decreased expression of NFKBIE mRNA CTD PMID:25812627 Nfkbie Rat perfluorooctane-1-sulfonic acid decreases expression ISO NFKBIE (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of NFKBIE mRNA CTD PMID:25812627 Nfkbie Rat perfluorooctanoic acid decreases expression ISO NFKBIE (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of NFKBIE mRNA CTD PMID:25812627 Nfkbie Rat phenobarbital affects expression ISO NFKBIE (Homo sapiens) 6480464 Phenobarbital affects the expression of NFKBIE mRNA CTD PMID:19159669 Nfkbie Rat phenobarbital affects expression ISO Nfkbie (Mus musculus) 6480464 Phenobarbital affects the expression of NFKBIE mRNA CTD PMID:23091169 Nfkbie Rat pirinixic acid increases expression ISO Nfkbie (Mus musculus) 6480464 pirinixic acid results in increased expression of NFKBIE mRNA CTD PMID:20059764 Nfkbie Rat pirinixic acid multiple interactions ISO Nfkbie (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of NFKBIE mRNA and PPARA protein promotes the reaction [pirinixic acid results in increased expression of NFKBIE mRNA] CTD PMID:19710929 and PMID:20059764 Nfkbie Rat rac-lactic acid increases expression ISO NFKBIE (Homo sapiens) 6480464 Lactic Acid results in increased expression of NFKBIE mRNA CTD PMID:30851411 Nfkbie Rat raloxifene multiple interactions ISO NFKBIE (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR2 protein] results in increased expression of NFKBIE mRNA CTD PMID:19059307 Nfkbie Rat silicon dioxide increases expression ISO NFKBIE (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of NFKBIE mRNA and Silicon Dioxide results in increased expression of NFKBIE mRNA CTD PMID:25351596 and PMID:25895662 Nfkbie Rat silicon dioxide increases expression ISO Nfkbie (Mus musculus) 6480464 Silicon Dioxide results in increased expression of NFKBIE mRNA CTD PMID:23221170 and PMID:29341224 Nfkbie Rat silicon dioxide decreases expression ISO Nfkbie (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of NFKBIE mRNA CTD PMID:19073995 Nfkbie Rat succimer multiple interactions ISO Nfkbie (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of NFKBIE mRNA CTD PMID:21641980 Nfkbie Rat sulforaphane decreases expression ISO NFKBIE (Homo sapiens) 6480464 sulforaphane results in decreased expression of NFKBIE mRNA CTD PMID:35724838 Nfkbie Rat sunitinib increases expression ISO NFKBIE (Homo sapiens) 6480464 Sunitinib results in increased expression of NFKBIE mRNA CTD PMID:31533062 Nfkbie Rat tacrolimus hydrate increases expression ISO Nfkbie (Mus musculus) 6480464 Tacrolimus results in increased expression of NFKBIE mRNA CTD PMID:23958496 Nfkbie Rat tamoxifen multiple interactions ISO NFKBIE (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR2 protein] results in increased expression of NFKBIE mRNA CTD PMID:19059307 Nfkbie Rat tert-butyl hydroperoxide increases expression ISO NFKBIE (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of NFKBIE mRNA CTD PMID:15336504 Nfkbie Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of NFKBIE protein CTD PMID:17544377 Nfkbie Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NFKBIE mRNA CTD PMID:34492290 Nfkbie Rat titanium dioxide increases expression ISO Nfkbie (Mus musculus) 6480464 titanium dioxide results in increased expression of NFKBIE mRNA CTD PMID:23557971 and PMID:27760801 Nfkbie Rat titanium dioxide increases methylation ISO Nfkbie (Mus musculus) 6480464 titanium dioxide results in increased methylation of NFKBIE promoter alternative form CTD PMID:35295148 Nfkbie Rat titanium dioxide decreases methylation ISO Nfkbie (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NFKBIE gene CTD PMID:35295148 Nfkbie Rat triphenyl phosphate affects expression ISO NFKBIE (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NFKBIE mRNA CTD PMID:37042841 Nfkbie Rat Triptolide increases expression ISO Nfkbie (Mus musculus) 6480464 triptolide results in increased expression of NFKBIE mRNA CTD PMID:32835833 Nfkbie Rat urethane increases expression ISO NFKBIE (Homo sapiens) 6480464 Urethane results in increased expression of NFKBIE mRNA CTD PMID:28818685 Nfkbie Rat valproic acid affects expression ISO Nfkbie (Mus musculus) 6480464 Valproic Acid affects the expression of NFKBIE mRNA CTD PMID:17292431 Nfkbie Rat valproic acid increases expression ISO NFKBIE (Homo sapiens) 6480464 Valproic Acid results in increased expression of NFKBIE mRNA CTD PMID:22083351 Nfkbie Rat vancomycin decreases expression ISO Nfkbie (Mus musculus) 6480464 Vancomycin results in decreased expression of NFKBIE mRNA CTD PMID:18930951 Nfkbie Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of NFKBIE promoter CTD PMID:22570695 Nfkbie Rat zinc atom multiple interactions ISO NFKBIE (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of NFKBIE mRNA CTD PMID:18593933 Nfkbie Rat zinc(0) multiple interactions ISO NFKBIE (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of NFKBIE mRNA CTD PMID:18593933
Imported Annotations - KEGG (archival)
(S)-nicotine (ISO) 1,1-dichloroethene (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 2-naphthylamine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) andrographolide (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) Bardoxolone methyl (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bortezomib (ISO) buta-1,3-diene (ISO) butanal (ISO) cadmium dichloride (EXP) caffeine (ISO) carbon nanotube (ISO) casticin (ISO) CGP 52608 (ISO) chloroprene (EXP) choline (ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dioxygen (ISO) doxorubicin (ISO) endosulfan (EXP) enzyme inhibitor (ISO) fluoranthene (ISO) folic acid (ISO) Fusarenone X (ISO) gemcitabine (ISO) genistein (ISO) hydrogen peroxide (ISO) ivermectin (ISO) kojic acid (ISO) L-methionine (ISO) leflunomide (ISO) lipopolysaccharide (ISO) mangiferin (ISO) menadione (ISO) methidathion (ISO) methotrexate (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-4-phenylpyridinium (ISO) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) nicotine (ISO) nitrates (ISO) o-anisidine (ISO) paracetamol (EXP,ISO) paraquat (EXP) pentanal (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) rac-lactic acid (ISO) raloxifene (ISO) silicon dioxide (ISO) succimer (ISO) sulforaphane (ISO) sunitinib (ISO) tacrolimus hydrate (ISO) tamoxifen (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) Triptolide (ISO) urethane (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Shared principles in NF-kappaB signaling.
Hayden MS and Ghosh S, Cell. 2008 Feb 8;132(3):344-62.
4.
Molecular physiology and pathology of the nucleotide sugar transporter family (SLC35).
Ishida N and Kawakita M, Pflugers Arch 2004 Feb;447(5):768-75. Epub 2003 May 21.
5.
Molecular cloning and identification of 3'-phosphoadenosine 5'-phosphosulfate transporter.
Kamiyama S, etal., J Biol Chem 2003 Jul 11;278(28):25958-63. Epub 2003 Apr 25.
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Comprehensive gene review and curation
RGD comprehensive gene curation
9.
Inhibition of D-serine accumulation in the Xenopus oocyte by expression of the rat ortholog of human 3'-phosphoadenosine 5'-phosphosulfate transporter gene isolated from the neocortex as D-serine modulator-1.
Shimazu D, etal., J Neurochem. 2006 Jan;96(1):30-42. Epub 2005 Nov 8.
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Nfkbie (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 22,941,037 - 22,947,872 (-) NCBI GRCr8 mRatBN7.2 9 15,443,600 - 15,450,437 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 15,436,941 - 15,450,437 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 24,030,126 - 24,036,913 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 29,092,803 - 29,099,590 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 27,393,565 - 27,400,352 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 17,828,405 - 17,835,240 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 17,828,408 - 17,835,240 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 16,717,126 - 16,723,961 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 11,044,112 - 11,050,948 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 11,041,436 - 11,048,270 (-) NCBI Celera 9 13,186,838 - 13,193,673 (-) NCBI Celera Cytogenetic Map 9 q12 NCBI
NFKBIE (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 44,258,166 - 44,265,551 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 44,258,166 - 44,265,788 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 44,225,903 - 44,233,288 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 44,333,881 - 44,341,503 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 44,334,404 - 44,341,503 NCBI Celera 6 45,779,052 - 45,786,678 (-) NCBI Celera Cytogenetic Map 6 p21.1 NCBI HuRef 6 43,947,918 - 43,955,542 (-) NCBI HuRef CHM1_1 6 44,229,610 - 44,237,246 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 44,092,317 - 44,099,688 (-) NCBI T2T-CHM13v2.0
Nfkbie (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 45,866,626 - 45,874,095 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 45,866,629 - 45,874,095 (+) Ensembl GRCm39 Ensembl GRCm38 17 45,555,700 - 45,563,169 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 45,555,703 - 45,563,169 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 45,692,665 - 45,700,118 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 45,019,297 - 45,026,750 (+) NCBI MGSCv36 mm8 Celera 17 48,988,415 - 48,995,813 (+) NCBI Celera Cytogenetic Map 17 B3 NCBI cM Map 17 22.58 NCBI
Nfkbie (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 9,882,460 - 9,888,952 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 9,882,460 - 9,888,848 (-) NCBI ChiLan1.0 ChiLan1.0
NFKBIE (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 58,762,193 - 58,772,393 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 54,632,285 - 54,642,475 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 43,853,921 - 43,861,686 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 45,137,160 - 45,144,699 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 45,138,209 - 45,144,680 (-) Ensembl panpan1.1 panPan2
NFKBIE (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 12,668,664 - 12,674,146 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 12,694,054 - 12,702,366 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 13,151,713 - 13,160,030 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 13,151,717 - 13,160,137 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 12,677,143 - 12,685,399 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 12,764,624 - 12,772,929 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 12,858,827 - 12,867,147 (-) NCBI UU_Cfam_GSD_1.0
Nfkbie (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 48,134,122 - 48,141,644 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936476 15,818,554 - 15,826,327 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936476 15,818,605 - 15,825,558 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NFKBIE (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 39,255,075 - 39,263,339 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 39,255,078 - 39,266,085 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 45,124,531 - 45,133,184 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NFKBIE (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 27,901,990 - 27,909,983 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 27,902,389 - 27,910,440 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 44,312,243 - 44,319,949 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nfkbie (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 65 Count of miRNA genes: 58 Interacting mature miRNAs: 61 Transcripts: ENSRNOT00000026988 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631211 Bw4 Body weight QTL4 5.31 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 9 5109826 50109826 Rat 2303559 Gluco54 Glucose level QTL 54 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 9 1254084 46254084 Rat 7411609 Foco16 Food consumption QTL 16 25.6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 8952560 53952560 Rat 61450 Ciaa3 CIA Autoantibody QTL 3 6.5 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 9 7954720 22071169 Rat 9589055 Scfw5 Subcutaneous fat weight QTL 5 5.55 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 9 1 37999212 Rat 1641911 Alcrsp13 Alcohol response QTL 13 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 1 43718459 Rat 1354650 Despr5 Despair related QTL 5 4.01 0.0017 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 9 1254084 46254084 Rat 1300124 Cm4 Cardiac mass QTL 4 3.55 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 9 1 40594091 Rat 61425 Cia15 Collagen induced arthritis QTL 15 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 9 5109826 42921101 Rat 70226 Eae4 Experimental allergic encephalomyelitis QTL 4 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 9 1 25661317 Rat 9589158 Gluco65 Glucose level QTL 65 6.82 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 9 1 37999212 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 1600365 Mcs20 Mammary carcinoma susceptibility QTL 20 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 9 13533770 42791750 Rat 11353947 Bp392 Blood pressure QTL 392 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 7283252 52283252 Rat 7411592 Foco8 Food consumption QTL 8 7.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 1 37999212 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 1298088 Edpm11 Estrogen-dependent pituitary mass QTL 11 2.5 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 1 43718459 Rat 9589133 Insul26 Insulin level QTL 26 17.96 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 9 8952560 53952560 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026988 ⟹ ENSRNOP00000026988
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 15,443,603 - 15,450,437 (-) Ensembl Rnor_6.0 Ensembl 9 17,828,408 - 17,835,240 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114315 ⟹ ENSRNOP00000096074
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 15,436,941 - 15,450,437 (-) Ensembl
RefSeq Acc Id:
NM_199111 ⟹ NP_954542
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 22,941,037 - 22,947,872 (-) NCBI mRatBN7.2 9 15,443,600 - 15,450,437 (-) NCBI Rnor_6.0 9 17,828,405 - 17,835,240 (-) NCBI Rnor_5.0 9 16,717,126 - 16,723,961 (-) NCBI RGSC_v3.4 9 11,044,112 - 11,050,948 (-) RGD Celera 9 13,186,838 - 13,193,673 (-) RGD
Sequence:
CGCCGGCGCCCTGGACCTCTCGCTTTTCTCGTCCGCTCCCCGCGCCTGCACAGCCAGGTAATGAACCCGCTCGCAGAGGGACTCTGGTTCTGTTAGGCGGACACACAAACCCGGAAAAGCGCGCCGCA CACCTCAGAGTTAGATCCCGCTGGACCCTGGATCCCGGGCTGGCGCGGCCGGCATGTCGGATGCGCGGAAGGGGCCGGACGAGGCGGACGACAGCCAGTGCGATTCCGGCATAGAGTCGCTGCGCTCT CTGCGCTCCCTGCCCGACCCTGCTGCGGCCCCAGTCTCTGGATCATCGCACAGCGGCTGCCCACAGCCTTGGAGCCATGCTCCGAAGACGGACAAGGAACCAGAGGGGAAGGAAGATGCGGATGGAGA GCGAGCGGACTCCACCTATGCCTCCTCCTCTCTCACAGAGTCTTTGCCCTTGCTGGAGAGACCCGAGGCCAAGGATCCAAACCCTCCCACCCCAAGCTCGCCGGTGTCCCCCGCGGGGGTGCTGAGCC CTCAGCAACTCGAAGCGCTCACGTACATCTCTGAAGATGGAGACACGCTGCTCCACCTGGCAGTAATCCATGAAGCCCCATCGGTACTATTCTGTTGCTTGGCTTTCCTGCCCCAGGAAGTCCTGGAT ATTCAGAACAACCTTTACCAGACAGCGCTGCATCTGGCCGTTCATCTGGATCAGCCAGATGTAGTCCGGGCCCTGGTGCTGAAGGGAGCCAGCCGAATACTGCAGGACCAACACGGCGACACAGCCCT GCATGTAGCCTGTCAGCGCCAGAATCTGGCCTGTGCGTGCTGCCTGCTGGAGGAGCAGCCAGAGCCGGGCAGACAGCCATCTCATCCCCTGGACCTCCAACTGAAGAACTGGCAAGGTCTGGCCTGTC TCCACATCGCCACATTGCAGAGGAACCAACCACTCATAGAACTGCTGCTTCAGAATGGAGCCGACATCGATGCACAGGAGGGCACCAGTGGAAAGACTGCCCTGCACCTGGCTGTGGAAACCCAGGAG CGCAGCCTGGTGCAGTTCCTGCTCCAGGCTGGTGCCCGAGTAGATGCCCGCATGCTGAATGGGTGTACACCTTTGCACCTGGCAGCTGGCCGGGGCCTCAACAGCATCTCGTCCACTCTGTGTGAGGC CGGTGCCGACTCACTGCTGCTGAACGTGGAAGATGAGACACCCCAGGACCTGGCCGAGGATCTCCTTTCTTACTTGCCCTTCGATGACCTGAAAATCTCCGGGAAGCCACTGCTATGTACTGACTGAA GCTTGGATGGGCCCCCACCTCTTCCAATTGGAAGCTGGAGCCACAGATGCTGCCGTTGGGACCCAAGCAGTGTTGCTCCTCTGCTGATGCCAGAGTCTGGGGCTAGCATCGTCCTAAAATGAGATGAA GGATTGCAAATGAGGAAGAGCCGATCTGGACAGAAGAACTTCCCAGGTGGACTGGATGGAGATTCTTGAAAGACCCTCTAAGCCGCTGGTGTCCTGAGGGAAGCCTCCTTGCTTCTGTTGGAGATGGC GTGGGCTGACATTACCAGCCACCAGGAAAACAGGAATGAGCGAACTGACCCCTGAGGGTCTTACCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAA
hide sequence
RefSeq Acc Id:
NP_954542 ⟸ NM_199111
- UniProtKB:
Q6P780 (UniProtKB/TrEMBL), F7FL44 (UniProtKB/TrEMBL), A0A8I6ASQ1 (UniProtKB/TrEMBL)
- Sequence:
MSDARKGPDEADDSQCDSGIESLRSLRSLPDPAAAPVSGSSHSGCPQPWSHAPKTDKEPEGKEDADGERADSTYASSSLTESLPLLERPEAKDPNPPTPSSPVSPAGVLSPQQLEALTYISEDGDTLL HLAVIHEAPSVLFCCLAFLPQEVLDIQNNLYQTALHLAVHLDQPDVVRALVLKGASRILQDQHGDTALHVACQRQNLACACCLLEEQPEPGRQPSHPLDLQLKNWQGLACLHIATLQRNQPLIELLLQ NGADIDAQEGTSGKTALHLAVETQERSLVQFLLQAGARVDARMLNGCTPLHLAAGRGLNSISSTLCEAGADSLLLNVEDETPQDLAEDLLSYLPFDDLKISGKPLLCTD
hide sequence
Ensembl Acc Id:
ENSRNOP00000026988 ⟸ ENSRNOT00000026988
Ensembl Acc Id:
ENSRNOP00000096074 ⟸ ENSRNOT00000114315
RGD ID: 13696542
Promoter ID: EPDNEW_R7067
Type: initiation region
Name: Nfkbie_1
Description: NFKB inhibitor epsilon
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 9 17,835,258 - 17,835,318 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-01
Nfkbie
NFKB inhibitor epsilon
Nfkbie
nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-03-07
Nfkbie
nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon
Slc35b2
solute carrier family 35, member B2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2005-07-08
Slc35b2
solute carrier family 35, member B2
Symbol and Name status set to approved
1299863
APPROVED