Slc10a6 (solute carrier family 10 member 6)

Advanced Search (OLGA)

Gene: Slc10a6 (solute carrier family 10 member 6) Rattus norvegicus

Analyze

Symbol:

Slc10a6

Name:

solute carrier family 10 member 6

RGD ID:

727800

Description:

Enables sodium-dependent organic anion transmembrane transporter activity. Involved in sodium-dependent organic anion transport. Predicted to be located in membrane. Orthologous to human SLC10A6 (solute carrier family 10 member 6); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; amphetamine; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Soat; sodium-dependent organic anion transporter; solute carrier family 10 (sodium/bile acid cotransporter family), member 6; solute carrier family 10 (sodium/bile acid cotransporter), member 6

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	6,385,348 - 6,407,532 (+)	NCBI		GRCr8
mRatBN7.2	14	6,080,716 - 6,102,902 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	6,080,717 - 6,103,037 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	6,048,649 - 6,069,672 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	7,348,900 - 7,369,923 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	6,048,316 - 6,069,396 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	7,618,022 - 7,682,377 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	7,618,022 - 7,682,377 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	7,592,605 - 7,656,400 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	7,270,695 - 7,292,036 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	7,270,694 - 7,292,036 (+)	NCBI
Celera	14	6,219,788 - 6,240,844 (+)	NCBI		Celera
Cytogenetic Map	14	p22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Breast Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

4-hydroxyphenyl retinamide (ISO)

aflatoxin B1 (ISO)

amphetamine (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

bromobenzene (EXP)

buta-1,3-diene (ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroprene (ISO)

chlorpyrifos (ISO)

clobetasol (ISO)

Cuprizon (EXP)

daidzein (ISO)

dehydroepiandrosterone sulfate (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diclofenac (ISO)

dimethylarsinic acid (ISO)

doxorubicin (ISO)

endosulfan (EXP)

estrone 3-sulfate (ISO)

Genipin (ISO)

genistein (ISO)

hydrogen cyanide (ISO)

Indeno[1,2,3-cd]pyrene (ISO)

isoprenaline (ISO)

lidocaine (EXP)

lipopolysaccharide (ISO)

methylarsonic acid (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

potassium cyanide (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

pregnenolone sulfate (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium atom (ISO)

sulforaphane (ISO)

tamoxifen (ISO)

Theaflavin 3,3'-digallate (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

tremolite asbestos (ISO)

triptonide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bile acid and bile salt transport (IBA)

sodium ion transport (IEA)

sodium-dependent organic anion transport (IDA)

transmembrane transport (IEA)

Cellular Component

membrane (IEA)

Molecular Function

bile acid:sodium symporter activity (IBA)

protein binding (ISO)

sodium-dependent organic anion transmembrane transporter activity (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Identification of a sodium-dependent organic anion transporter from rat adrenal gland.	Geyer J, etal., Biochem Biophys Res Commun 2004 Apr 2;316(2):300-6.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Slc10a6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	6,385,348 - 6,407,532 (+)	NCBI		GRCr8
mRatBN7.2	14	6,080,716 - 6,102,902 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	6,080,717 - 6,103,037 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	6,048,649 - 6,069,672 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	7,348,900 - 7,369,923 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	6,048,316 - 6,069,396 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	7,618,022 - 7,682,377 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	7,618,022 - 7,682,377 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	7,592,605 - 7,656,400 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	7,270,695 - 7,292,036 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	7,270,694 - 7,292,036 (+)	NCBI
Celera	14	6,219,788 - 6,240,844 (+)	NCBI		Celera
Cytogenetic Map	14	p22	NCBI

SLC10A6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	86,823,468 - 86,849,384 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	86,823,468 - 86,849,384 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	87,744,621 - 87,770,537 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	87,963,865 - 87,989,292 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	4	85,034,180 - 85,059,864 (-)	NCBI		Celera
Cytogenetic Map	4	q21.3	NCBI
HuRef	4	83,489,562 - 83,515,298 (-)	NCBI		HuRef
CHM1_1	4	87,721,091 - 87,746,835 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	90,152,961 - 90,178,806 (-)	NCBI		T2T-CHM13v2.0

Slc10a6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	103,753,583 - 103,777,152 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	103,753,577 - 103,777,269 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	103,605,711 - 103,629,403 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	103,605,711 - 103,629,403 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	104,034,730 - 104,058,422 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	103,846,013 - 103,869,705 (-)	NCBI		MGSCv36	mm8
Celera	5	100,917,865 - 100,940,762 (-)	NCBI		Celera
Cytogenetic Map	5	E5	NCBI
cM Map	5	50.45	NCBI

Slc10a6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955474	2,951,052 - 2,980,980 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955474	2,949,773 - 2,982,458 (+)	NCBI	ChiLan1.0	ChiLan1.0

SLC10A6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	84,841,136 - 84,866,991 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	85,103,155 - 85,128,997 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	79,126,941 - 79,152,786 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	89,855,914 - 89,881,523 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	89,855,914 - 89,881,523 (-)	Ensembl	panpan1.1		panPan2

SLC10A6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	10,334,148 - 10,362,302 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	10,279,831 - 10,386,298 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	32	31,591,788 - 31,619,733 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	32	10,357,252 - 10,385,414 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	32	10,357,112 - 10,385,275 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	32	10,468,259 - 10,496,648 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	10,295,452 - 10,323,394 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	29,631,508 - 29,659,716 (+)	NCBI		UU_Cfam_GSD_1.0

Slc10a6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	267,434 - 295,595 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936920	285,185 - 309,494 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936920	285,185 - 310,395 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC10A6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	131,997,314 - 132,021,981 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	131,997,359 - 132,023,739 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	141,308,101 - 141,336,069 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC10A6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	35,203,853 - 35,230,698 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	35,203,853 - 35,229,199 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	13,899,317 - 13,925,334 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc10a6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624872	3,411,622 - 3,453,627 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624872	3,411,860 - 3,438,525 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc10a6
167 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	105
Count of miRNA genes:	95
Interacting mature miRNAs:	97
Transcripts:	ENSRNOT00000002819
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300114	Srn2	Serum renin concentration QTL 2	3.27		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	3813074	21217635	Rat
70195	Mcs8	Mammary carcinoma susceptibility QTL 8	4.28		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	14	3813074	24531477	Rat
2293089	Iddm31	Insulin dependent diabetes mellitus QTL 31	4.7		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	14	3813074	18274691	Rat
2300183	Bmd60	Bone mineral density QTL 60	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
724541	Niddm53	Non-insulin dependent diabetes mellitus QTL 53		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	3813074	9088978	Rat
1331740	Bw26	Body weight QTL 26	3.028		body mass (VT:0001259)	body weight (CMO:0000012)	14	3813074	30767156	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41131407	Rat
619619	Rf4	Renal disease susceptibility QTL 4	4.1	0.002	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	14	1	32754612	Rat
71115	Niddm15	Non-insulin dependent diabetes mellitus QTL 15	4.8		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	1217606	11030812	Rat
2300159	Bmd61	Bone mineral density QTL 61	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
70204	Niddm20	Non-insulin dependent diabetes mellitus QTL 20	5.1	0.000008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	1217606	16960180	Rat

Markers in Region

AU047970

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	6,069,916 - 6,070,059 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	7,653,017 - 7,653,159	NCBI	Rnor6.0
Rnor_6.0	14	7,640,891 - 7,641,033	NCBI	Rnor6.0
Rnor_5.0	14	7,615,260 - 7,615,402	UniSTS	Rnor5.0
Rnor_5.0	14	7,627,386 - 7,627,528	UniSTS	Rnor5.0
RGSC_v3.4	14	7,234,364 - 7,234,506	UniSTS	RGSC3.4
Celera	14	6,209,620 - 6,209,762	UniSTS
Cytogenetic Map	14	p22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	109	86	85	54	25	54	6	213	97	89	45	59	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_198049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ583503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474022	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002819 ⟹ ENSRNOP00000002819

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	14	7,618,022 - 7,682,377 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000088508 ⟹ ENSRNOP00000072386

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	6,080,717 - 6,103,037 (+)	Ensembl
Rnor_6.0 Ensembl	14	7,618,022 - 7,682,374 (+)	Ensembl

RefSeq Acc Id:

NM_198049 ⟹ NP_932166

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	6,385,575 - 6,407,532 (+)	NCBI
mRatBN7.2	14	6,080,945 - 6,102,902 (+)	NCBI
Rnor_6.0	14	7,618,022 - 7,682,377 (+)	NCBI
Rnor_5.0	14	7,592,605 - 7,656,400 (+)	NCBI
RGSC_v3.4	14	7,270,695 - 7,292,036 (+)	RGD
Celera	14	6,219,788 - 6,240,844 (+)	RGD

Sequence:

show sequence

ATGAGCGCAGACTGCGAGGGCAACTCCACCTGCCCTGCCAACAGCACGGAGGAAGACCCACCCG
TGGGAATGGAGGGACAGGGGAGCCTGAAGCTTGTTTTCACAGTCCTGTCGGCTGTGATGGTGGG
TCTGGTCATGTTCTCCTTTGGATGTTCAGTGGAGAGTCGGAAGCTCTGGCTGCACCTCAGAAGA
CCCTGGGGCATCGCAGTGGGCCTGCTTTGCCAGTTTGGGCTCATGCCTCTGACAGCTTATCTGC
TAGCCATTGGCTTCGGTCTGAAACCATTCCAAGCTATTGCCGTCCTCATCATGGGGAGCTGCCC
TGGGGGCACCGTCTCTAATGTCCTCACCTTCTGGGTTGATGGAGATATGGACCTCAGCATCAGC
ATGACGACCTGCTCCACAGTGGCTGCTCTGGGAATGATGCCCCTCTGCCTCTACGTCTACACCC
GGTCCTGGACTCTTCCACAGAGCCTCACCATCCCGTACCAGAGCATAGGAATTACCCTTGTGTC
CCTGGTTGTTCCTGTGGCCTCCGGCATCTATGTGAATTATAGGTGGCCAAAGCAAGCAACATTC
ATTCTCAAGGTCGGGGCTGCTGTTGGCGGCATGCTCCTCCTGGTGGTGGCAGTTACCGGCGTGG
TCCTGGCAAAGGGCTGGAACATAGATGTCACTCTTCTGGTCATCAGCTGTATTTTTCCCTTGGT
CGGCCATGTCATGGGCTTCCTGCTGGCGTTCCTCACCCACCAGTCTTGGCAAAGGTGCAGGACG
ATTTCCATAGAGACCGGAGCACAGAACATCCAGCTGTGCATTGCCATGATGCAGCTGTCCTTCT
CTGCTGAGTACCTGGTCCAGCTGTTAAACTTCGCCCTGGCCTACGGACTCTTCCAAGTGCTGCA
CGGGCTGCTCATTGTCGCAGCATATCAGGCATACAAGAGGAGGCAGAAGAGTCAATACAGGAGA
CAGCACCCGGAGTGCCAAGACATCAGCTCTGAGAAGCAGCCCAGAGAGACCAGTGCCTTCTTGG
ATAAAGGGGCTGAGGCTGCTGTAACTCTGGGGCTAGAGCAGCACCACAGGACCGCTGAACTGAC
CAGTCACGTTCCTTCATGTGAATAG

hide sequence

RefSeq Acc Id:

XM_039091662 ⟹ XP_038947590

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	6,385,348 - 6,401,280 (+)	NCBI
mRatBN7.2	14	6,080,716 - 6,096,608 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_932166	(Get FASTA)	NCBI Sequence Viewer
	XP_038947590	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAE47478	(Get FASTA)	NCBI Sequence Viewer
	EDL99520	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000072386.1
	ENSRNOP00065014818
GenBank Protein	Q70EX6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_932166 ⟸ NM_198049

- UniProtKB:

Q70EX6 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSADCEGNSTCPANSTEEDPPVGMEGQGSLKLVFTVLSAVMVGLVMFSFGCSVESRKLWLHLRR
PWGIAVGLLCQFGLMPLTAYLLAIGFGLKPFQAIAVLIMGSCPGGTVSNVLTFWVDGDMDLSIS
MTTCSTVAALGMMPLCLYVYTRSWTLPQSLTIPYQSIGITLVSLVVPVASGIYVNYRWPKQATF
ILKVGAAVGGMLLLVVAVTGVVLAKGWNIDVTLLVISCIFPLVGHVMGFLLAFLTHQSWQRCRT
ISIETGAQNIQLCIAMMQLSFSAEYLVQLLNFALAYGLFQVLHGLLIVAAYQAYKRRQKSQYRR
QHPECQDISSEKQPRETSAFLDKGAEAAVTLGLEQHHRTAELTSHVPSCE

hide sequence

Ensembl Acc Id:

ENSRNOP00000002819 ⟸ ENSRNOT00000002819

Ensembl Acc Id:

ENSRNOP00000072386 ⟸ ENSRNOT00000088508

RefSeq Acc Id:	XP_038947590 ⟸ XM_039091662
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q70EX6-F1-model_v2	AlphaFold	Q70EX6	1-370	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699180

Promoter ID:

EPDNEW_R9705

Type:

initiation region

Name:

Slc10a6_1

Description:

solute carrier family 10 member 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	7,617,968 - 7,618,028	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:727800	AgrOrtholog
BioCyc Gene	G2FUF-16483	BioCyc
Ensembl Genes	ENSRNOG00000002057	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00065011928	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000088508.2	UniProtKB/Swiss-Prot
	ENSRNOT00065019376	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.1530.20	UniProtKB/Swiss-Prot
InterPro	BilAc:Na_symport/Acr3	UniProtKB/Swiss-Prot
	Bilac:Na_transpt	UniProtKB/Swiss-Prot
	Na+/solute_symporter_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:289459	UniProtKB/Swiss-Prot
NCBI Gene	289459	ENTREZGENE
PANTHER	PTHR10361	UniProtKB/Swiss-Prot
	PTHR10361:SF55	UniProtKB/Swiss-Prot
Pfam	SBF	UniProtKB/Swiss-Prot
PhenoGen	Slc10a6	PhenoGen
RatGTEx	ENSRNOG00000002057	RatGTEx
	ENSRNOG00065011928	RatGTEx
UniProt	Q70EX6	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-25	Slc10a6	solute carrier family 10 member 6	Slc10a6	solute carrier family 10 (sodium/bile acid cotransporter), member 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-08-02	Slc10a6	solute carrier family 10 (sodium/bile acid cotransporter), member 6	Slc10a6	solute carrier family 10 (sodium/bile acid cotransporter family), member 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Slc10a6	solute carrier family 10 (sodium/bile acid cotransporter family), member 6	Soat	sodium-dependent organic anion transporter	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Soat	sodium-dependent organic anion transporter			Symbol and Name status set to approved	1299863	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	predicted to have nine transmembrane domains	1302411
gene_expression	expressed in rat brain, heart, kidney, lung, muscle, spleen, testis, adrenal gland, small intestine, and colon	1302411
gene_function	transports estrone-3-sulfate and DHEAS but not taurocholate, estradiol-17-glucuronide, or ouabain	1302411

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD