Advanced Search (OLGA)

Gene: Lipf (lipase F, gastric type) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Lipf

Name:

lipase F, gastric type

RGD ID:

708441

Description:

Enables malate dehydrogenase activity and triacylglycerol lipase activity. Acts upstream of or within malate metabolic process. Located in mitochondrion. Orthologous to human LIPF (lipase F, gastric type); PARTICIPATES IN glycerolipid metabolic pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

gastric lipase; gastric triacylglycerol lipase; GL; lingual lipase; lipase F; lipase F, gastric; lipase, gastric; prelingual lipase; RNLIP; Rnlp

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LIPF (lipase F, gastric type)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Lipf (lipase, gastric)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Lipf (lipase F, gastric type)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LIPF (lipase F, gastric type)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LIPF (lipase F, gastric type)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Lipf (lipase F, gastric type)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LIPF (lipase F, gastric type)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Lipf (lipase F, gastric type)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	LIPK (lipase family member K)	HGNC	OrthoDB
Homo sapiens (human):	SEPTIN9 (septin 9)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Lipf (lipase, gastric)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	LIPF (lipase F, gastric type)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11406	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	TGL1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lipl-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lipl-2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lipl-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lipl-4	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lipl-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lipl-7	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG11598	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG11600	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG11608	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG17097	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG18284	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG18301	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG18302	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG18530	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG2772	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG31089	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG31091	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG31871	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG3635	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6753	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7329	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8093	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Lip1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Lip2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Lip3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Lip4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	mag	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lipl-6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	240,906,706 - 240,925,053 (+)	NCBI		GRCr8
mRatBN7.2	1	231,493,498 - 231,511,845 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	231,493,498 - 231,511,845 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	239,877,083 - 239,895,430 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	246,806,295 - 246,824,661 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	239,644,366 - 239,662,731 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	252,284,464 - 252,302,811 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	252,284,464 - 252,302,811 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	259,507,653 - 259,526,000 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	237,838,238 - 237,856,579 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	238,005,561 - 238,020,602 (+)	NCBI
Celera	1	228,607,481 - 228,625,828 (+)	NCBI		Celera
Cytogenetic Map	1	q52	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lipf	Rat	autoimmune lymphoproliferative syndrome		ISO	LIPF (Homo sapiens)	8554872	ClinVar Annotator: match by term: AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME more ...	ClinVar	PMID:28492532
Lipf	Rat	PTEN hamartoma tumor syndrome		ISO	LIPF (Homo sapiens)	8554872	ClinVar Annotator: match by term: PTEN hamartoma tumor syndrome	ClinVar	PMID:16287957 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lipf	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Lipf (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of LIPF mRNA]	CTD	PMID:22206623
Lipf	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Lipf (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of LIPF mRNA	CTD	PMID:22206623
Lipf	Rat	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of LIPF mRNA	CTD	PMID:15576828 more ...
Lipf	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[Estradiol co-treated with Plant Preparations] results in increased expression of LIPF mRNA	CTD	PMID:26945725
Lipf	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of LIPF mRNA	CTD	PMID:26945725
Lipf	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of LIPF mRNA	CTD	PMID:16483693
Lipf	Rat	benzo[a]pyrene	increases methylation	ISO	LIPF (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of LIPF promoter	CTD	PMID:27901495
Lipf	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of LIPF mRNA	CTD	PMID:25181051
Lipf	Rat	bisphenol A	increases expression	ISO	Lipf (Mus musculus)	6480464	bisphenol A results in increased expression of LIPF mRNA	CTD	PMID:32156529
Lipf	Rat	buta-1,3-diene	increases expression	ISO	Lipf (Mus musculus)	6480464	1 and 3-butadiene results in increased expression of LIPF mRNA	CTD	PMID:29038090
Lipf	Rat	flavonoids	increases expression	EXP		6480464	Flavonoids results in increased expression of LIPF mRNA	CTD	PMID:18035473
Lipf	Rat	folic acid	multiple interactions	ISO	Lipf (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of LIPF mRNA]	CTD	PMID:22206623
Lipf	Rat	genistein	increases expression	ISO	Lipf (Mus musculus)	6480464	Genistein results in increased expression of LIPF mRNA	CTD	PMID:21810550
Lipf	Rat	genistein	decreases expression	ISO	Lipf (Mus musculus)	6480464	Genistein results in decreased expression of LIPF mRNA	CTD	PMID:32186404
Lipf	Rat	orlistat	decreases activity	ISO	LIPF (Homo sapiens)	6480464	orlistat results in decreased activity of LIPF protein	CTD	PMID:11408251 and PMID:12381337
Lipf	Rat	paracetamol	affects expression	ISO	Lipf (Mus musculus)	6480464	Acetaminophen affects the expression of LIPF mRNA	CTD	PMID:17562736
Lipf	Rat	paracetamol	increases expression	ISO	LIPF (Homo sapiens)	6480464	Acetaminophen results in increased expression of LIPF mRNA	CTD	PMID:22230336
Lipf	Rat	pioglitazone	multiple interactions	ISO	Lipf (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of LIPF mRNA	CTD	PMID:27935865
Lipf	Rat	pregnenolone 16alpha-carbonitrile	increases expression	ISO	Lipf (Mus musculus)	6480464	Pregnenolone Carbonitrile results in increased expression of LIPF mRNA	CTD	PMID:22698814
Lipf	Rat	valproic acid	affects expression	ISO	Lipf (Mus musculus)	6480464	Valproic Acid affects the expression of LIPF mRNA	CTD	PMID:17963808
Lipf	Rat	valproic acid	decreases methylation	ISO	LIPF (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of LIPF gene	CTD	PMID:29154799
Lipf	Rat	XL147	multiple interactions	ISO	Lipf (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with XL147] results in decreased expression of LIPF mRNA	CTD	PMID:27935865
Lipf	Rat	zinc atom	decreases expression	EXP		6480464	Zinc deficiency results in decreased expression of LIPF mRNA	CTD	PMID:16140947
Lipf	Rat	zinc atom	multiple interactions	EXP		6480464	Zinc affects the reaction [Zinc deficiency results in decreased expression of LIPF mRNA]	CTD	PMID:16140947
Lipf	Rat	zinc(0)	decreases expression	EXP		6480464	Zinc deficiency results in decreased expression of LIPF mRNA	CTD	PMID:16140947
Lipf	Rat	zinc(0)	multiple interactions	EXP		6480464	Zinc affects the reaction [Zinc deficiency results in decreased expression of LIPF mRNA]	CTD	PMID:16140947

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lipf	Rat	lipid catabolic process	involved_in	IEA	UniProtKB-KW:KW-0442	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Lipf	Rat	lipid metabolic process	involved_in	IEA	UniProtKB-KW:KW-0443	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Lipf	Rat	lipid metabolic process	involved_in	IEA	InterPro:IPR006693	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Lipf	Rat	malate metabolic process	acts_upstream_of_or_within	IDA		1582471	PMID:15809022	MGI

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lipf	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Lipf	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Lipf	Rat	extracellular region	located_in	ISO	LIPF (Canis lupus familiaris)	1624291	PMID:1568562	RGD	PMID:1568562
Lipf	Rat	mitochondrion	located_in	IDA		1582471	PMID:15809022	MGI

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lipf	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Lipf	Rat	hydrolase activity, acting on ester bonds	enables	IEA	InterPro:IPR025483	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Lipf	Rat	lipase activity		TAS		1299446		RGD
Lipf	Rat	malate dehydrogenase activity	enables	IDA		1582471	PMID:15809022	MGI
Lipf	Rat	protein binding	enables	ISO	LIPF (Homo sapiens)	1624291	UniProtKB:Q6UWE0 and PMID:33961781	RGD	PMID:33961781
Lipf	Rat	protein binding	enables	ISO	LIPF (Homo sapiens) and UniProtKB:P07098-3	1624291	UniProtKB:Q6FHY5 and PMID:32296183	RGD	PMID:32296183
Lipf	Rat	triacylglycerol lipase activity	enables	IBA	PANTHER:PTN001662871 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Lipf	Rat	triacylglycerol lipase activity	enables	IEA	EC:3.1.1.3	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Lipf	Rat	triacylglycerol lipase activity	enables	IEA	RHEA:12044	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Lipf	Rat	triacylglycerol lipase activity	enables	IEA	UniProtKB:P07098 and ensembl:ENSP00000238983	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Lipf	Rat	triacylglycerol lipase activity	enables	ISO	LIPF (Canis lupus familiaris)	1624291	PMID:11689574 more ...	RGD	PMID:11689574 more ...
Lipf	Rat	triacylglycerol lipase activity	enables	ISO	LIPF (Homo sapiens)	1624291	PMID:10358049 and PMID:2243091	RGD	PMID:10358049 and PMID:2243091
Lipf	Rat	triacylglycerol lipase activity	enables	IDA		1299447	PMID:3839077	UniProt

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lipf	Rat	glycerolipid metabolic pathway		IEA		6907045		KEGG	rno:00561

#	Reference Title	Reference Citation
1.	Nardilysin facilitates complex formation between mitochondrial malate dehydrogenase and citrate synthase.	Chow KM, etal., Biochim Biophys Acta. 2005 May 25;1723(1-3):292-301. Epub 2005 Mar 10.
2.	Molecular cloning and nucleotide sequence of rat lingual lipase cDNA.	Docherty AJ, etal., Nucleic Acids Res 1985 Mar 25;13(6):1891-903.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Importance of lipolysis in oral cavity for orosensory detection of fat.	Kawai T and Fushiki T, Am J Physiol Regul Integr Comp Physiol 2003 Aug;285(2):R447-54. Epub 2003 Apr 17.
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:1568562	PMID:1935982	PMID:2243091	PMID:8889548	PMID:10358049	PMID:11689574	PMID:27317984

Lipf
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	240,906,706 - 240,925,053 (+)	NCBI		GRCr8
mRatBN7.2	1	231,493,498 - 231,511,845 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	231,493,498 - 231,511,845 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	239,877,083 - 239,895,430 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	246,806,295 - 246,824,661 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	239,644,366 - 239,662,731 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	252,284,464 - 252,302,811 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	252,284,464 - 252,302,811 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	259,507,653 - 259,526,000 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	237,838,238 - 237,856,579 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	238,005,561 - 238,020,602 (+)	NCBI
Celera	1	228,607,481 - 228,625,828 (+)	NCBI		Celera
Cytogenetic Map	1	q52	NCBI

LIPF
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	88,664,442 - 88,678,814 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	88,664,441 - 88,678,814 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	90,424,199 - 90,438,571 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	90,414,074 - 90,428,552 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	90,414,195 - 90,428,542	NCBI
Celera	10	84,170,927 - 84,185,402 (+)	NCBI		Celera
Cytogenetic Map	10	q23.31	NCBI
HuRef	10	84,058,693 - 84,073,122 (+)	NCBI		HuRef
CHM1_1	10	90,706,220 - 90,720,626 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	89,548,553 - 89,562,923 (+)	NCBI		T2T-CHM13v2.0

Lipf
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	33,938,648 - 33,954,213 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	33,938,587 - 33,954,210 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	33,961,248 - 33,976,813 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	33,961,187 - 33,976,810 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	34,035,738 - 34,051,303 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	34,027,245 - 34,042,810 (+)	NCBI		MGSCv36	mm8
Celera	19	34,737,801 - 34,753,366 (+)	NCBI		Celera
Cytogenetic Map	19	C1	NCBI
cM Map	19	29.29	NCBI

Lipf
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955425	4,267,004 - 4,285,078 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955425	4,267,977 - 4,284,996 (-)	NCBI	ChiLan1.0	ChiLan1.0

LIPF
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	100,682,450 - 100,696,947 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	100,687,930 - 100,702,262 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	85,389,165 - 85,403,492 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	88,892,525 - 88,906,898 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	88,892,525 - 88,906,898 (+)	Ensembl	panpan1.1		panPan2

LIPF
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	38,469,876 - 38,486,881 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	38,424,721 - 38,588,175 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	38,286,752 - 38,303,738 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	40,054,032 - 40,071,028 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	40,054,032 - 40,071,016 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	37,893,844 - 37,910,828 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	37,489,480 - 37,506,494 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	38,759,547 - 38,776,548 (+)	NCBI		UU_Cfam_GSD_1.0

Lipf
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	78,221,590 - 78,239,486 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936735	553,438 - 568,021 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936735	553,438 - 568,021 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LIPF
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	82,095,036 - 82,107,539 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	82,095,601 - 82,106,765 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	42,772,803 - 42,786,976 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lipf
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624791	14,961,557 - 14,972,238 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624791	14,961,554 - 14,972,310 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Lipf
104 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	89
Count of miRNA genes:	74
Interacting mature miRNAs:	78
Transcripts:	ENSRNOT00000027969
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8693637	Alc29	Alcohol consumption QTL 29	2.7	0.258	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	207987464	234238494	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
61455	Niddm7	Non-insulin dependent diabetes mellitus QTL 7	5.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	214537555	238757011	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	216255568	260522016	Rat
1600392	Bw123	Body weight QTL 123		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	223201027	260522016	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	206081677	251081677	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	228581588	259647894	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	224054293	260122809	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	225126575	260522016	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	224054293	260122809	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	221264111	259647894	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	213707201	252085212	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	224569538	260122809	Rat
734768	Niddm59	Non-insulin dependent diabetes mellitus QTL 59			body mass (VT:0001259)	body weight (CMO:0000012)	1	213843987	258843987	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	218753816	256448513	Rat
1358890	Bp259	Blood pressure QTL 259	3.06		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	210702053	260522016	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	214647894	259647894	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	214647894	259647894	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	222363780	260522016	Rat
1357399	Bw45	Body weight QTL 45	3.05		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	1	206329708	251329708	Rat
2316896	Gluco57	Glucose level QTL 57	7.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228985440	245907899	Rat
1357404	Bw42	Body weight QTL 42	4.49	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	206329708	251329708	Rat
10053715	Scort24	Serum corticosterone level QTL 24	2.13	0.0088	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	221414816	260522016	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	210702053	240947965	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	218753689	245907899	Rat
2292216	Bw80	Body weight QTL 80	3.23	0.0019	body mass (VT:0001259)	body weight (CMO:0000012)	1	213533809	243914901	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	224054293	243747962	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	224054293	243747962	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	223262787	260522016	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	203995416	244113296	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	216255568	260522016	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	218748008	257976495	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

appendage	ectoderm	endocrine system	endoderm	hemolymphoid system	integumental system	mesenchyme	mesoderm	nervous system	reproductive system	respiratory system
1	8	10	15	5	5	8	7	1	23	15


RefSeq Transcripts	NM_017341	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271930	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271931	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271932	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	A01157	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AA998080	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC112543	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X02309	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027969 ⟹ ENSRNOP00000027969

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	231,493,498 - 231,511,845 (+)	Ensembl
Rnor_6.0 Ensembl	1	252,284,464 - 252,302,811 (+)	Ensembl

RefSeq Acc Id:

NM_017341 ⟹ NP_059037

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	240,906,706 - 240,925,053 (+)	NCBI
mRatBN7.2	1	231,493,498 - 231,511,845 (+)	NCBI
Rnor_6.0	1	252,284,464 - 252,302,811 (+)	NCBI
Rnor_5.0	1	259,507,653 - 259,526,000 (+)	NCBI
RGSC_v3.4	1	237,838,238 - 237,856,579 (+)	RGD
Celera	1	228,607,481 - 228,625,828 (+)	NCBI

Sequence:

show sequence

CAACCAGAGAAGCAGAATCTTGTTTCTGAGGGCACTAGCAGTACAAGATGTGGCTGTTATTAATAACAAGTGTGATATCAACATTCGGAGGTGCACATGGCCTATTTGGAAAACTGGGTCCTGGAAAC
CCTGAAGCAAATATGAATATTAGTCAGATGATAACTTACTGGGGATATCCATGTCAAGAATATGAAGTTGTTACTGAAGATGGCTACATTCTGGGGGTCTACAGAATTCCTCATGGGAAGAATAATTC
TGAAAATATAGGCAAGAGACCTGTGGTGTATTTGCAGCATGGTTTGATCGCATCAGCCACAAACTGGATTGCAAATCTACCAAACAACAGCCTGGCCTTTATGCTAGCAGACGCTGGCTATGATGTGT
GGCTGGGGAACAGTCGAGGAAATACATGGTCCAGGAAAAATGTATACTACTCACCAGACTCAGTTGAATTCTGGGCTTTCAGCTTTGATGAAATGGCTAAATATGACCTTCCCGCCACAATAAACTTC
ATTGTACAGAAAACTGGACAAGAGAAGATACACTATGTTGGTCATTCTCAGGGCACCACTATTGGTTTCATTGCCTTTTCTACCAATCCTACACTGGCCAAAAAAATCAAGACGTTTTATGCATTAGC
TCCAGTTGCTACCGTGAAGTATACACAAAGTCCCTTGAAAAAGATTTCATTTATTCCTACATTTCTTTTCAAGCTTATGTTTGGCAAGAAAATGTTCCTGCCCCACACCTACTTTGATGACTTTCTTG
GTACCGAAGTGTGCTCACGGGAGGTTCTAGATCTTCTCTGCAGCAACACTTTATTCATCTTCTGTGGATTTGACAAGAAAAACTTAAATGTGAGTCGTTTTGATGTGTATCTAGGGCATAATCCAGCA
GGGACATCTGTTCAAGACTTTCTCCACTGGGCACAGCTTGTTAGATCTGGGAAATTTCAAGCCTTCAACTGGGGAAGCCCATCCCAGAACATGTTACACTACAACCAGAAAACGCCTCCTGAATATGA
TGTGTCAGCCATGACTGTGCCAGTTGCAGTGTGGAACGGTGGCAATGACATCCTGGCTGATCCCCAAGATGTCGCCATGCTGCTTCCCAAACTCTCCAACCTCCTGTTCCATAAGGAGATTCTTGCCT
ACAATCACCTGGACTTCATCTGGGCAATGGATGCCCCTCAAGAGGTTTACAATGAGATGATTTCCATGATGGCAGAAGACTAAAAGAATCAATTATCCACATCCATTCCAAAATCTTTTCCCCTTTCA
TACAGTTTTTCCAGTGTTTAAAAATGTAATACATATTACTGTAATTTTGACTTTAGAAATATATTGGCATCAGCAAAGTTAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063271930 ⟹ XP_063128000

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	240,910,018 - 240,925,053 (+)	NCBI

RefSeq Acc Id:

XM_063271931 ⟹ XP_063128001

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	240,910,111 - 240,925,053 (+)	NCBI

RefSeq Acc Id:

XM_063271932 ⟹ XP_063128002

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	240,910,102 - 240,925,053 (+)	NCBI


Protein RefSeqs	NP_059037	(Get FASTA)	NCBI Sequence Viewer
	XP_063128000	(Get FASTA)	NCBI Sequence Viewer
	XP_063128001	(Get FASTA)	NCBI Sequence Viewer
	XP_063128002	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA00136	(Get FASTA)	NCBI Sequence Viewer
	CAA26179	(Get FASTA)	NCBI Sequence Viewer
	EDM13150	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027969
	ENSRNOP00000027969.2
GenBank Protein	P04634	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_059037 ⟸ NM_017341
- Peptide Label:	precursor
- UniProtKB:	P04634 (UniProtKB/Swiss-Prot), A6I119 (UniProtKB/TrEMBL)
- Sequence:	show sequence MWLLLITSVISTFGGAHGLFGKLGPGNPEANMNISQMITYWGYPCQEYEVVTEDGYILGVYRIPHGKNNSENIGKRPVVYLQHGLIASATNWIANLPNNSLAFMLADAGYDVWLGNSRGNTWSRKNVY YSPDSVEFWAFSFDEMAKYDLPATINFIVQKTGQEKIHYVGHSQGTTIGFIAFSTNPTLAKKIKTFYALAPVATVKYTQSPLKKISFIPTFLFKLMFGKKMFLPHTYFDDFLGTEVCSREVLDLLCSN TLFIFCGFDKKNLNVSRFDVYLGHNPAGTSVQDFLHWAQLVRSGKFQAFNWGSPSQNMLHYNQKTPPEYDVSAMTVPVAVWNGGNDILADPQDVAMLLPKLSNLLFHKEILAYNHLDFIWAMDAPQEV YNEMISMMAED hide sequence

Ensembl Acc Id:

ENSRNOP00000027969 ⟸ ENSRNOT00000027969

RefSeq Acc Id:	XP_063128000 ⟸ XM_063271930
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063128002 ⟸ XM_063271932
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063128001 ⟸ XM_063271931
- Peptide Label:	isoform X2

Protein Domains

AB hydrolase-1 Partial AB-hydrolase lipase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P04634-F1-model_v2	AlphaFold	P04634	1-395	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-55887	BioCyc
Ensembl Genes	ENSRNOG00000019448	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000027969	ENTREZGENE
	ENSRNOT00000027969.5	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.1820	UniProtKB/Swiss-Prot
InterPro	AB_hydrolase	UniProtKB/Swiss-Prot
	AB_hydrolase_lipase	UniProtKB/Swiss-Prot
	Lipase_euk	UniProtKB/Swiss-Prot
KEGG Report	rno:50682	UniProtKB/Swiss-Prot
NCBI Gene	50682	ENTREZGENE
PANTHER	LYSOSOMAL ACID LIPASE-RELATED	UniProtKB/Swiss-Prot
Pfam	Abhydro_lipase	UniProtKB/Swiss-Prot
PhenoGen	Lipf	PhenoGen
PIRSF	Steryl_ester_lip	UniProtKB/Swiss-Prot
PROSITE	LIPASE_SER	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000019448	RatGTEx
Superfamily-SCOP	SSF53474	UniProtKB/Swiss-Prot
UniProt	A6I119	ENTREZGENE, UniProtKB/TrEMBL
	LIPG_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-17	Lipf	lipase F, gastric type	Lipf	lipase F, gastric	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-03	Lipf	lipase F, gastric	Lipf	lipase, gastric	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Lipf	lipase, gastric	Rnlp	lingual lipase	Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)