Advanced Search (OLGA)

Gene: Dlgap4 (DLG associated protein 4) Rattus norvegicus

Analyze

Symbol:

Dlgap4

Name:

DLG associated protein 4

RGD ID:

708350

Description:

Enables protein domain specific binding activity. Predicted to be involved in modification of postsynaptic structure; modulation of chemical synaptic transmission; and regulation of synapse maturation. Located in dendrite and neuronal cell body. Orthologous to human DLGAP4 (DLG associated protein 4); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DAP-4; Dap4; discs large homolog associated protein 4; discs, large (Drosophila) homolog-associated protein 4; discs, large homolog-associated protein 4; discs, large homolog-associated protein 4 (Drosophila); disks large-associated protein 4; PSD-95/SAP90-associated protein-4; PSD-95/SAP90-binding protein 4; SAP90/PSD-95-associated protein 4; SAPAP-4; SAPAP4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DLGAP4 (DLG associated protein 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Dlgap4 (DLG associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dlgap4 (DLG associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DLGAP4 (DLG associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DLGAP4 (DLG associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dlgap4 (DLG associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DLGAP4 (DLG associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DLGAP4 (DLG associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dlgap4 (DLG associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Dlgap4 (DLG associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Dlgap4 (DLG associated protein 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DLGAP4 (DLG associated protein 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dlgap4a (discs, large (Drosophila) homolog-associated protein 4a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dlgap4a (discs, large (Drosophila) homolog-associated protein 4a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Danio rerio (zebrafish):	dlgap4b (discs, large (Drosophila) homolog-associated protein 4b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	vlc	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	dlgap4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	165,584,271 - 165,731,868 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	165,584,360 - 165,730,604 (+)	Ensembl				GRCr8
mRatBN7.2	3	145,124,189 - 145,271,791 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	145,175,479 - 145,270,490 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	148,989,758 - 149,135,878 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	157,606,330 - 157,752,709 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	155,345,912 - 155,492,051 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	152,752,091 - 152,846,118 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	152,752,091 - 152,846,118 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	158,850,471 - 158,944,119 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	147,081,222 - 147,176,024 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	143,892,733 - 143,987,531 (+)	NCBI		Celera
RGSC_v3.1	3	146,987,130 - 147,081,933 (+)	NCBI
Cytogenetic Map	3	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-methylcholine (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4-methylenedioxymethamphetamine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (ISO)

Benoxacor (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

choline (ISO)

clobetasol (ISO)

cobalt dichloride (ISO)

cyclosporin A (ISO)

DDE (EXP)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

doxorubicin (ISO)

epoxiconazole (EXP)

ethanol (ISO)

folic acid (ISO)

formaldehyde (ISO)

FR900359 (ISO)

gentamycin (EXP)

hydroquinone O-beta-D-glucopyranoside (ISO)

indometacin (ISO)

kojic acid (ISO)

L-methionine (ISO)

lead(0) (ISO)

linsidomine (EXP)

linuron (EXP)

lithium atom (ISO)

lithium hydride (ISO)

methapyrilene (ISO)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

nitrates (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

phenobarbital (EXP,ISO)

prochloraz (EXP)

procymidone (EXP)

resveratrol (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

topotecan (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

tungsten (ISO)

urethane (ISO)

vinclozolin (EXP)

vorinostat (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

modification of postsynaptic structure (IEA,ISO)

modulation of chemical synaptic transmission (IBA)

regulation of synapse maturation (IEA,ISO)

signaling (IEA)

Cellular Component

cholinergic synapse (IEA,ISO)

dendrite (IDA)

glutamatergic synapse (IBA,IEA,ISO)

membrane (IEA)

neuromuscular junction (IEA,ISO)

neuronal cell body (IDA)

postsynaptic specialization (IBA,IEA,ISO)

synapse (IEA,ISO)

Molecular Function

molecular adaptor activity (IBA)

protein binding (ISO)

protein domain specific binding (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	nArgBP2, a novel neural member of ponsin/ArgBP2/vinexin family that interacts with synapse-associated protein 90/postsynaptic density-95-associated protein (SAPAP).	Kawabe H, etal., J Biol Chem 1999 Oct 22;274(43):30914-8.
3.	Distinct spatiotemporal expression of SAPAP transcripts in the developing rat brain: a novel dendritically localized mRNA.	Kindler S, etal., Brain Res Mol Brain Res 2004 Jul 5;126(1):14-21.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	SAPAPs. A family of PSD-95/SAP90-associated proteins localized at postsynaptic density.	Takeuchi M, etal., J Biol Chem 1997 May 2;272(18):11943-51.

Additional References at PubMed

PMID:15024750	PMID:30053369

Genomics

Comparative Map Data

Dlgap4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	165,584,271 - 165,731,868 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	165,584,360 - 165,730,604 (+)	Ensembl				GRCr8
mRatBN7.2	3	145,124,189 - 145,271,791 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	145,175,479 - 145,270,490 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	148,989,758 - 149,135,878 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	157,606,330 - 157,752,709 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	155,345,912 - 155,492,051 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	152,752,091 - 152,846,118 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	152,752,091 - 152,846,118 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	158,850,471 - 158,944,119 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	147,081,222 - 147,176,024 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	143,892,733 - 143,987,531 (+)	NCBI		Celera
RGSC_v3.1	3	146,987,130 - 147,081,933 (+)	NCBI
Cytogenetic Map	3	q42	NCBI

DLGAP4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	36,306,339 - 36,528,633 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	36,306,302 - 36,528,637 (+)	Ensembl			hg38	GRCh38
GRCh37	20	34,894,261 - 35,157,036 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	34,428,858 - 34,590,454 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	20	31,702,551 - 31,864,100 (+)	NCBI		Celera
Cytogenetic Map	20	q11.23	NCBI
HuRef	20	31,731,640 - 31,893,658 (+)	NCBI		HuRef
CHM1_1	20	34,896,532 - 35,058,753 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	38,027,049 - 38,252,509 (+)	NCBI		T2T-CHM13v2.0

Dlgap4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	156,455,431 - 156,606,283 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	156,455,625 - 156,606,283 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	156,613,633 - 156,764,363 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	156,613,705 - 156,764,363 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	156,486,464 - 156,590,099 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	156,392,120 - 156,455,804 (+)	NCBI		MGSCv36	mm8
Celera	2	162,596,974 - 162,700,157 (+)	NCBI		Celera
Cytogenetic Map	2	H1	NCBI
cM Map	2	77.54	NCBI

Dlgap4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	25,098,914 - 25,221,818 (-)	Ensembl
ChiLan1.0	NW_004955422	25,098,914 - 25,221,238 (-)	NCBI	ChiLan1.0	ChiLan1.0

DLGAP4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	42,040,272 - 42,267,322 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	42,033,372 - 42,260,421 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	32,635,740 - 32,862,252 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	33,790,782 - 33,980,451 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	33,881,703 - 33,980,454 (+)	Ensembl			panPan2	panpan1.1

DLGAP4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	25,171,756 - 25,311,960 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	25,205,641 - 25,310,479 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	24,818,144 - 24,957,634 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	25,864,429 - 26,005,002 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	25,796,352 - 26,003,624 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	25,148,791 - 25,288,003 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	25,243,402 - 25,382,901 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	25,734,119 - 25,873,836 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Dlgap4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	174,131,446 - 174,254,095 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936561	4,495,329 - 4,618,145 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936561	4,495,454 - 4,618,094 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DLGAP4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	39,570,878 - 39,775,928 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	17	39,626,751 - 39,775,927 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	45,198,672 - 45,213,629 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DLGAP4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	57,159,747 - 57,385,636 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	57,286,807 - 57,387,220 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666087	3,647,596 - 3,879,333 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dlgap4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624842	2,991,683 - 3,174,743 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624842	2,993,115 - 3,174,815 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Dlgap4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	135,961,509 - 136,107,807 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Dlgap4
1115 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	114
Count of miRNA genes:	100
Interacting mature miRNAs:	108
Transcripts:	ENSRNOT00000037177
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	141555229	186555229	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141555229	186555229	Rat
1582233	Insul10	Insulin level QTL 10	5.4	0.0015	blood insulin amount (VT:0001560)	serum insulin level times blood glucose level (CMO:0002040)	3	133259579	178259579	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	141555229	186555229	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	141555229	186555229	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	151075912	189428310	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	129154923	182114333	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	141555229	186555229	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	141555229	186555229	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	161492708	189428310	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
61335	Bp20	Blood pressure QTL 20	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	161799493	176036425	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	133134628	178134628	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	161799270	187311134	Rat
1582213	Insul6	Insulin level QTL 6	3.7	0.0009	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	3	155759447	189428310	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	141508991	166376254	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	152055202	189428310	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	142898802	187898802	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	145335553	189428310	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	125116475	170116475	Rat
1582256	Insul9	Insulin level QTL 9	4.4	0.0016	blood insulin amount (VT:0001560)	absolute change in serum insulin level (CMO:0002038)	3	155759447	189428310	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	139299381	184299381	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	122395989	167395989	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	141508991	177728348	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	131036586	176036586	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	137114333	182114333	Rat
1582248	Insul7	Insulin level QTL 7	3.9	0.0041	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	3	155759447	189428310	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	131036586	176036586	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	98651826	167012663	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	151075912	189428310	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	151075912	189428310	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	141555229	186555229	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	144575244	189428310	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	160357340	167835660	Rat

Markers in Region

RH131883

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	145,220,744 - 145,220,946 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	152,797,525 - 152,797,726	NCBI	Rnor6.0
Rnor_5.0	3	158,898,484 - 158,898,685	UniSTS	Rnor5.0
RGSC_v3.4	3	147,126,684 - 147,126,885	UniSTS	RGSC3.4
Celera	3	143,937,961 - 143,938,162	UniSTS
RH 3.4 Map	3	1330.7	UniSTS
Cytogenetic Map	3	q42	UniSTS

N28159

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	145,270,301 - 145,270,459 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	152,845,930 - 152,846,087	NCBI	Rnor6.0
Rnor_5.0	3	158,850,502 - 158,850,659	UniSTS	Rnor5.0
RGSC_v3.4	3	147,175,836 - 147,175,993	UniSTS	RGSC3.4
Celera	3	143,987,343 - 143,987,500	UniSTS
Cytogenetic Map	3	q42	UniSTS

BF387023

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	145,239,322 - 145,239,481 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	152,815,971 - 152,816,129	NCBI	Rnor6.0
Rnor_5.0	3	158,880,460 - 158,880,618	UniSTS	Rnor5.0
RGSC_v3.4	3	147,144,863 - 147,145,021	UniSTS	RGSC3.4
Celera	3	143,956,373 - 143,956,531	UniSTS
RH 3.4 Map	3	1347.7	UniSTS
Cytogenetic Map	3	q42	UniSTS

stSG621614

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	145,263,105 - 145,263,635 (+)	MAPPER	mRatBN7.2
mRatBN7.2	3	145,263,105 - 145,263,653 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	152,838,736 - 152,839,283	NCBI	Rnor6.0
Rnor_6.0	3	152,838,736 - 152,839,265	NCBI	Rnor6.0
Rnor_5.0	3	158,857,323 - 158,857,853	NCBI	Rnor5.0
Rnor_5.0	3	158,857,305 - 158,857,853	NCBI	Rnor5.0
RGSC_v3.4	3	147,168,642 - 147,169,171	UniSTS	RGSC3.4
RGSC_v3.4	3	147,168,642 - 147,169,189	UniSTS	RGSC3.4
Celera	3	143,980,156 - 143,980,703	UniSTS
Celera	3	143,980,156 - 143,980,685	UniSTS
Cytogenetic Map	3	q42	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001429777	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429778	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429780	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429781	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_173145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104402	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104404	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104405	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104407	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104408	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104410	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212717	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U67140	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000037177 ⟹ ENSRNOP00000034166

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	165,584,360 - 165,730,472 (+)	Ensembl
mRatBN7.2 Ensembl	3	145,175,479 - 145,270,490 (+)	Ensembl
Rnor_6.0 Ensembl	3	152,752,091 - 152,846,118 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097466 ⟹ ENSRNOP00000090605

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	165,584,360 - 165,730,472 (+)	Ensembl
mRatBN7.2 Ensembl	3	145,175,479 - 145,270,490 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100071 ⟹ ENSRNOP00000090954

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	165,584,360 - 165,730,604 (+)	Ensembl
mRatBN7.2 Ensembl	3	145,175,479 - 145,270,490 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107369 ⟹ ENSRNOP00000093464

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	145,233,797 - 145,270,327 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116081 ⟹ ENSRNOP00000086332

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	165,693,908 - 165,730,604 (+)	Ensembl
mRatBN7.2 Ensembl	3	145,234,376 - 145,270,391 (+)	Ensembl

RefSeq Acc Id:

NM_173145 ⟹ NP_775168

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	165,584,360 - 165,730,472 (+)	NCBI
mRatBN7.2	3	145,124,269 - 145,270,395 (+)	NCBI
Rnor_6.0	3	152,752,091 - 152,846,118 (+)	NCBI
Rnor_5.0	3	158,850,471 - 158,944,119 (-)	NCBI
RGSC_v3.4	3	147,081,222 - 147,176,024 (+)	RGD
Celera	3	143,892,733 - 143,987,531 (+)	RGD

Sequence:

show sequence

GAATTCGGCACGAGCGGCAGCGTGCTGGAGGGATGTGTGTCGCAGTCCTCAGTCCCACACCCGC
TTCCGAGGTGTCATCTGCAGCATACTTGCCGGCTACCATTTTTCCTGTGCACGCGTCTCCCTGG
TTGGACAGCTGCTGCCTGGGACAGGTGACACCAGTGCCCAACTAGGGCAAAGGCCCCCGCCCCG
TGGGCCAGGATCATGAAAGGCCTCGGTGACAGCCGCCCCCGCCACCTCTCCGACAGCCTGGACC
CACCTCATGAGCCCCTCTTTGCCGGGCCTGACCGCAACCCCTACCTGCTGTCGCCCACCGAGGC
CTTTGCCCGGGAAGCCCGTTTCCCTGGGCAAAACACACTGCCGGGGGATGGGCTCTTCCCACTC
AACAACCAGCTGCCCCCACCAAGCAGCACCTTTCCCCGGATCCACTATAACTCCCACTTTGAGG
TGCCCGAGGAAAGTCCGTTCCCCAGCCATGCCCAAGCCACCAAGATCAACCGGCTGCCTGCCAA
CCTCCTGGACCAGTTTGAGAAACAACTGCCTATCCACCGGGATGGTTTCAGCACCCTCCAGTTC
CCCCGGGGCGAGGCCAAGGCCCGGGGTGAGAGTCCTGGCCGCATTCGCCACCTGGTCCACTCCG
TCCAGCGTCTCTTCTTCACTAAGGCACCCTCGATGGAGGGCACCACGGGCAAGGTGGGTGGCAA
CGGCGGCAAGAAAGGTGTCCTGGAGGACGGGAAAGGCCGGAGGGCCAAAAGCAAGGAACGGGCC
AAGGCTGGGGAGCCCAAACGGCGAAGCCGCTCCAACATCTCGGGCTGGTGGAGTTCCGATGACA
ACCTGGACGGTGAGGGTGGTGCCTTCCGCAGCGGCCCTGCCTCGGGGCTGATGACTCTGGGCCG
CCAGCCAGAACGTACCCAGCCCCGCTACTTCATGCACGCCTACAACACCATCAGCGGACACATG
CTCAAAACCACCAAGAACACTACCACCGAGCTGACTGCCCCACCACCCCCGCCTGCTCCCCCTG
CTACCTGTCCCAGCCTTGGAGTGGGCACTGACACCAACTATGTCAAACGTGGTTCATGGTCCAC
TCTGACCCTCAGCCATGCCCACGAGGTCTGCCAGAAGACCTCAGCCACTTTGGATAAGAGCCTG
CTGAAGTCCAAATCCTGTCACCAGGGTTTGGCCTACCATTACTTGCAGGTGCCCGGCGGAGGGG
GAGAGTGGAGCACCACGCTGCTGTCCCCTCGAGATATGGATAGCACCGCTGAGGGGCCGATCCC
GTGCCGGCGCATGCGCAGTGGCAGCTATATCAAGGCCATGGGCGACGAAGACAGTGATGAGTCT
GGAGGTGGTAGCCCCAAGCCTTCTCCCAAGACTGCGGCACGGCGTCAGAGCTATCTGAGGGCCA
CGCAGCAGTCCCTGGGAGAGCAGAGCAACCCCCGCAGGAGCTTGGACCGCTTGGATTCAGTGGA
CATGCCGCTGCCGTCCAAGTACCCCAGCTGGGAAGAGGACTACAACCCCATCAGTGACAGCCTC
AATGACTCCGGCTGTATCAGCCAGGTTTTTGGACAGGCTTCCCTGATCCCTCAGTTGTTTGGCC
ATGATCAACAGGTCCGGGAGGCAGACCTGAGTGACCAGTATGAGGCAGCCTGTGAGTCGGCCTG
CAGTGAGGCTGAGTCGACAGCCGCAGAGGCGCTCGACTTGTCGCTGCCCAGCTACTTCCGCTCA
CGCAGCCACAGCTACCTGCGAGCCATCCAGGCGGGCTGCTCGCAGGAGGAGGACAGTGTCTCCC
TGCAGTCCCTCTCCCCACCGCCCAGCACCGGCAGCCTCAGCAACAGCCGTACACTTCCAAGTTC
ATCATGCCTAGTGGCATATAAGAAGACCCCACCACCGGTCCCTCCACGTACCACATCGAAACCG
TTCATCTCAGTTACCGTTCAGAGCAGTACTGAGTCTGCTCAGGACACCTACCTGGACAGTCAAG
ACCACAAGAGTGAAGTGACAAGCCAGTCGGGCTTGAGTAACTCATCAGACAGCCTGGACAGCAG
TACCCGGCCACCCAGTGTGACACGGGGTGGAATTACGCCAGGCCCTGAGGCTCCAGAGCCACCC
CCTAAGCATGCAGCTCTGAAGAGTGAACACGGGACACTGACGAGCTCTGAGTCCCACTCCGAGG
CCGTCCCCAAAAGGAAACTGTCATCAATAGGAATACAAGTTGACTGCATTCAGCCAGTGCCAAA
AGAGGAGCCCAGTCCCGCTACCAAATTCCAGTCCATCGGGGTTCAGGTAGAGGACGACTGGCGA
AGCAGCGCCCCCTCTCACAGCATGTCCTCCCGTCGGGACACTGACTCCGATACCCAGGACGCCA
ATGACTCCAGTTGTAAGTCATCTGAGAGGAGTCTCCCAGACTGTACCTCACACCCCAATTCCAT
CAGCATTGATGCTGGCCCCCGACAGGCCCCCAAGATTGCCCAGATCAAGCGCAACCTCTCCTAT
GGAGACAACAGCGACCCTGCCCTGGAGGCATCTTCGCTGCCCCCACCCGACCCTTGGATGGAGA
CTTCCTCCAGCTCCCCAGCAGAGCCAGCTCAGCCAGGGGCCTGCCGCAGGGATGGCTACTGGTT
CCTGAAGCTCCTTCAGGCTGAAACGGAGAGGCTGGAAGGATGGTGCTGTCAGATGGACAAGGAG
ACCAAAGAGAACAACCTCTCTGAAGAAGTCTTAGGAAAAGTTCTCAGTGCTGTGGGCAGCGCCC
AGCTCCTGATGTCCCAGAAATTCCAACAGTTCCGTGGCATTTGTGAGCAGAACTTGAACCCTGA
TGCCAACCCCCGTCCGACAGCCCAGGACCTGGCAGGGTTCTGGGACCTGCTGCAGCTGTCCATT
GAGGACATCAGCATGAAGTTCGATGAGCTCTACCACCTCAAGGCCAACAGCTGGCAGCTGGTGG
AGACCCCCGAGAAGAGGAAGGAAGAGAAGAAACCACCCCCTCCAGTCCCGAAGAAGCCAGCCAA
ATCCAAGGCGGCAGTGAGCCGCGACAAGGCCTCAGATGCGGGGGACAAGCAGCGGCAGGAGGCC
AGAAAGAGACTCCTGGCCGCCAAGCGGGCAGCATCTGTGCGGCAGAACTCGGCCACAGAGAGTG
CAGACAGCATCGAGATTTATGTCCCTGAGGCCCAGACCAGGCTCTAAGGCCACAAAGGAGAAAG
CACTCATTTTAAATCATTAAAAACTCAATGCAAACGGAACAGCGTTTCTCACCCTTTGGTATGG
TTATTATCTCTAGAGACCCTGAGCCAACTTTCCAATTGACACGTACAAGGGCTCACAAGGTGGC
TTTTCTCTCGTGCCGAATTC

hide sequence

RefSeq Acc Id:

XM_039104402 ⟹ XP_038960330

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	165,584,310 - 165,731,868 (+)	NCBI
mRatBN7.2	3	145,124,212 - 145,271,791 (+)	NCBI

RefSeq Acc Id:

XM_039104404 ⟹ XP_038960332

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	165,696,014 - 165,731,868 (+)	NCBI
mRatBN7.2	3	145,247,342 - 145,271,791 (+)	NCBI

RefSeq Acc Id:

XM_039104405 ⟹ XP_038960333

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	165,693,885 - 165,731,868 (+)	NCBI
mRatBN7.2	3	145,233,846 - 145,271,791 (+)	NCBI

RefSeq Acc Id:

XM_039104406 ⟹ XP_038960334

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	165,693,768 - 165,731,868 (+)	NCBI
mRatBN7.2	3	145,233,703 - 145,271,791 (+)	NCBI

RefSeq Acc Id:

XM_039104407 ⟹ XP_038960335

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	165,713,898 - 165,731,868 (+)	NCBI
mRatBN7.2	3	145,253,819 - 145,271,791 (+)	NCBI

RefSeq Acc Id:

XM_039104408 ⟹ XP_038960336

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	165,693,768 - 165,731,868 (+)	NCBI
mRatBN7.2	3	145,233,703 - 145,271,791 (+)	NCBI

RefSeq Acc Id:

XM_039104410 ⟹ XP_038960338

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	165,718,426 - 165,731,868 (+)	NCBI
mRatBN7.2	3	145,258,349 - 145,271,791 (+)	NCBI

RefSeq Acc Id:

XM_063283179 ⟹ XP_063139249

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	165,584,271 - 165,721,483 (+)	NCBI

RefSeq Acc Id:

XM_063283180 ⟹ XP_063139250

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	165,584,271 - 165,721,526 (+)	NCBI

RefSeq Acc Id:

XM_063283181 ⟹ XP_063139251

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	165,693,865 - 165,731,868 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001416706	(Get FASTA)	NCBI Sequence Viewer
	NP_001416707	(Get FASTA)	NCBI Sequence Viewer
	NP_001416708	(Get FASTA)	NCBI Sequence Viewer
	NP_001416709	(Get FASTA)	NCBI Sequence Viewer
	NP_001416710	(Get FASTA)	NCBI Sequence Viewer
	NP_775168	(Get FASTA)	NCBI Sequence Viewer
	XP_038960330	(Get FASTA)	NCBI Sequence Viewer
	XP_038960332	(Get FASTA)	NCBI Sequence Viewer
	XP_038960333	(Get FASTA)	NCBI Sequence Viewer
	XP_038960334	(Get FASTA)	NCBI Sequence Viewer
	XP_038960335	(Get FASTA)	NCBI Sequence Viewer
	XP_038960336	(Get FASTA)	NCBI Sequence Viewer
	XP_038960338	(Get FASTA)	NCBI Sequence Viewer
	XP_063139249	(Get FASTA)	NCBI Sequence Viewer
	XP_063139250	(Get FASTA)	NCBI Sequence Viewer
	XP_063139251	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB48590	(Get FASTA)	NCBI Sequence Viewer
	EDL85839	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000034166
	ENSRNOP00000086332
	ENSRNOP00000090954
GenBank Protein	P97839	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_775168 ⟸ NM_173145

- UniProtKB:

P97839 (UniProtKB/Swiss-Prot), G3V927 (UniProtKB/TrEMBL), A6KIB5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKGLGDSRPRHLSDSLDPPHEPLFAGPDRNPYLLSPTEAFAREARFPGQNTLPGDGLFPLNNQL
PPPSSTFPRIHYNSHFEVPEESPFPSHAQATKINRLPANLLDQFEKQLPIHRDGFSTLQFPRGE
AKARGESPGRIRHLVHSVQRLFFTKAPSMEGTTGKVGGNGGKKGVLEDGKGRRAKSKERAKAGE
PKRRSRSNISGWWSSDDNLDGEGGAFRSGPASGLMTLGRQPERTQPRYFMHAYNTISGHMLKTT
KNTTTELTAPPPPPAPPATCPSLGVGTDTNYVKRGSWSTLTLSHAHEVCQKTSATLDKSLLKSK
SCHQGLAYHYLQVPGGGGEWSTTLLSPRDMDSTAEGPIPCRRMRSGSYIKAMGDEDSDESGGGS
PKPSPKTAARRQSYLRATQQSLGEQSNPRRSLDRLDSVDMPLPSKYPSWEEDYNPISDSLNDSG
CISQVFGQASLIPQLFGHDQQVREADLSDQYEAACESACSEAESTAAEALDLSLPSYFRSRSHS
YLRAIQAGCSQEEDSVSLQSLSPPPSTGSLSNSRTLPSSSCLVAYKKTPPPVPPRTTSKPFISV
TVQSSTESAQDTYLDSQDHKSEVTSQSGLSNSSDSLDSSTRPPSVTRGGITPGPEAPEPPPKHA
ALKSEHGTLTSSESHSEAVPKRKLSSIGIQVDCIQPVPKEEPSPATKFQSIGVQVEDDWRSSAP
SHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTSHPNSISIDAGPRQAPKIAQIKRNLSYGDNS
DPALEASSLPPPDPWMETSSSSPAEPAQPGACRRDGYWFLKLLQAETERLEGWCCQMDKETKEN
NLSEEVLGKVLSAVGSAQLLMSQKFQQFRGICEQNLNPDANPRPTAQDLAGFWDLLQLSIEDIS
MKFDELYHLKANSWQLVETPEKRKEEKKPPPPVPKKPAKSKAAVSRDKASDAGDKQRQEARKRL
LAAKRAASVRQNSATESADSIEIYVPEAQTRL

hide sequence

Ensembl Acc Id:

ENSRNOP00000034166 ⟸ ENSRNOT00000037177

RefSeq Acc Id:	XP_038960330 ⟸ XM_039104402
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038960334 ⟸ XM_039104406
- Peptide Label:	isoform X7

RefSeq Acc Id:	XP_038960336 ⟸ XM_039104408
- Peptide Label:	isoform X8

RefSeq Acc Id:	XP_038960333 ⟸ XM_039104405
- Peptide Label:	isoform X5
- UniProtKB:	A0A8I6A541 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038960332 ⟸ XM_039104404
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038960335 ⟸ XM_039104407
- Peptide Label:	isoform X7

RefSeq Acc Id:	XP_038960338 ⟸ XM_039104410
- Peptide Label:	isoform X8

Ensembl Acc Id:

ENSRNOP00000090954 ⟸ ENSRNOT00000100071

Ensembl Acc Id:

ENSRNOP00000090605 ⟸ ENSRNOT00000097466

Ensembl Acc Id:

ENSRNOP00000086332 ⟸ ENSRNOT00000116081

Ensembl Acc Id:

ENSRNOP00000093464 ⟸ ENSRNOT00000107369

RefSeq Acc Id:	XP_063139250 ⟸ XM_063283180
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063139249 ⟸ XM_063283179
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063139251 ⟸ XM_063283181
- Peptide Label:	isoform X6

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P97839-F1-model_v2	AlphaFold	P97839	1-992	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:708350	AgrOrtholog
BioCyc Gene	G2FUF-47087	BioCyc
Ensembl Genes	ENSRNOG00000020225	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000037177	ENTREZGENE
	ENSRNOT00000100071	ENTREZGENE
	ENSRNOT00000116081	ENTREZGENE
InterPro	SAPAP	UniProtKB/Swiss-Prot
KEGG Report	rno:286930	UniProtKB/Swiss-Prot
NCBI Gene	286930	ENTREZGENE
PANTHER	PTHR12353	UniProtKB/Swiss-Prot
	PTHR12353:SF19	UniProtKB/Swiss-Prot
Pfam	GKAP	UniProtKB/Swiss-Prot
PhenoGen	Dlgap4	PhenoGen
RatGTEx	ENSRNOG00000020225	RatGTEx
UniProt	A0A8I6A541	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ACV4	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GIC7_RAT	UniProtKB/TrEMBL
	A6KIB5	ENTREZGENE, UniProtKB/TrEMBL
	DLGP4_RAT	UniProtKB/Swiss-Prot
	G3V927	ENTREZGENE, UniProtKB/TrEMBL
	P97839	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-01	Dlgap4	DLG associated protein 4	Dlgap4	discs large homolog associated protein 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-01-27	Dlgap4	discs large homolog associated protein 4	Dlgap4	discs, large (Drosophila) homolog-associated protein 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-01-10	Dlgap4	discs, large (Drosophila) homolog-associated protein 4	Dlgap4	discs, large homolog-associated protein 4 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	Dlgap4	discs, large homolog-associated protein 4 (Drosophila)	Dap4	disks large-associated protein 4	Symbol and Name updated	1299863	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_physical_interaction	binds guanylate kinase domain of PSD-95/SAP90	68237

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - MGI