Advanced Search (OLGA)

Gene: Gstt2 (glutathione S-transferase theta 2) Rattus norvegicus

Analyze

Symbol:

Gstt2

Name:

glutathione S-transferase theta 2

RGD ID:

69362

Description:

Enables glutathione peroxidase activity and glutathione transferase activity. Involved in response to salicylic acid. Acts upstream of or within glutathione metabolic process. Predicted to be located in cytosol. Predicted to be active in cytoplasm. Biomarker of Charcot-Marie-Tooth disease. Orthologous to several human genes including GSTT2 (glutathione S-transferase theta 2 (gene/pseudogene)); PARTICIPATES IN glutathione conjugation pathway; glutathione metabolic pathway; phase I biotransformation pathway via cytochrome P450; INTERACTS WITH (+)-schisandrin B; 1-chloro-2,4-dinitrobenzene; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

glutathione S-transferase 12; glutathione S-transferase theta-2; glutathione S-transferase theta-2-like; glutathione S-transferase Yrs-Yrs; glutathione S-transferase, theta 2; GST 12-12; GST class-theta-2; LOC103694878

RGD Orthologs

Human

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GSTT2 (glutathione S-transferase theta 2 (gene/pseudogene))	HGNC	Ensembl, HomoloGene, Inparanoid, Panther, PhylomeDB
Other homologs ²
Homo sapiens (human):	GSTT2B (glutathione S-transferase theta 2B)	HGNC	Ensembl, HomoloGene, Panther
Homo sapiens (human):	PDLIM7 (PDZ and LIM domain 7)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Gstt2 (glutathione S-transferase, theta 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GSTT2 (glutathione S-transferase theta 2 (gene/pseudogene))	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GSTT2B (glutathione S-transferase theta 2B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gstt1b (glutathione S-transferase theta 1b)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	gstt1b (glutathione S-transferase theta 1b)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	gstt1a (glutathione S-transferase theta 1a)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	gstt1a (glutathione S-transferase theta 1a)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	GstT1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	GstT1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	GstT2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	GstT2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	GstT3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	GstT3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	GstT4	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	GstT4	Alliance	DIOPT (InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gstt1	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	gstt1l.2	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	12,819,053 - 12,822,724 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	12,818,540 - 12,822,718 (+)	Ensembl				GRCr8
mRatBN7.2	20	12,819,617 - 12,823,288 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	12,819,170 - 12,823,288 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	13,525,875 - 13,529,553 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	12,886,803 - 12,890,480 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	13,358,708 - 13,362,283 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	13,760,810 - 13,764,481 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	13,760,810 - 13,764,475 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	15,913,944 - 15,917,615 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	13,221,696 - 13,225,367 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	14,311,251 - 14,314,818 (+)	NCBI		Celera
RGSC_v3.1	20	13,221,934 - 13,225,575 (+)	NCBI
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

Charcot-Marie-Tooth disease (IEP,ISO)

facioscapulohumeral muscular dystrophy (ISO)

hypertension (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1-chloro-2,4-dinitrobenzene (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

3H-1,2-dithiole-3-thione (EXP)

6-propyl-2-thiouracil (EXP)

acetylsalicylic acid (EXP)

aflatoxin B1 (EXP,ISO)

amitrole (EXP)

ammonium chloride (EXP)

artesunate (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bosentan (ISO)

buspirone (EXP)

chlorpyrifos (EXP)

cisplatin (EXP)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

cumene hydroperoxide (EXP)

Deoxycorticosterone acetate (EXP)

diazinon (EXP)

dichlorine (EXP)

doxorubicin (EXP)

etacrynic acid (EXP)

etoposide (ISO)

fipronil (EXP)

flavonoids (EXP)

flutamide (EXP)

glafenine (EXP)

herbicide (EXP)

hydralazine (ISO)

ibuprofen (EXP)

indometacin (EXP)

luteolin (EXP)

methimazole (EXP)

microcystin (EXP)

microcystin-LR (EXP)

mifepristone (ISO)

N-acetyl-beta-D-glucosamine (ISO)

N-acetyl-D-glucosamine (ISO)

N-nitrosodiethylamine (EXP)

niclosamide (ISO)

ochratoxin A (EXP)

oxybenzone (EXP)

ozone (EXP)

paracetamol (ISO)

paraoxon (ISO)

paraquat (EXP)

parathion (ISO)

phenethyl caffeate (EXP)

phenobarbital (EXP)

potassium chloride (EXP)

progesterone (EXP)

quercetin (EXP)

rac-lactic acid (ISO)

sarin (ISO)

sunitinib (ISO)

T-2 toxin (EXP)

tetrachloromethane (EXP)

Tributyltin oxide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular oxidant detoxification (IEA)

glutathione metabolic process (IBA,IDA)

response to salicylic acid (IEA,IEP)

Cellular Component

cytoplasm (IBA)

cytosol (IEA,ISO)

nucleus (IEA)

Molecular Function

glutathione peroxidase activity (IDA,IEA)

glutathione transferase activity (IBA,IDA,IEA,ISO)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

glutathione conjugation pathway (ISS)

glutathione metabolic pathway (IEA)

phase I biotransformation pathway via cytochrome P450 (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification and characterization of GSTT3, a third murine Theta class glutathione transferase.	Coggan M, etal., Biochem J. 2002 Aug 15;366(Pt 1):323-32.
2.	A rat model of Charcot-Marie-Tooth disease 1A recapitulates disease variability and supplies biomarkers of axonal loss in patients.	Fledrich R, etal., Brain. 2012 Jan;135(Pt 1):72-87. doi: 10.1093/brain/awr322. Epub 2011 Dec 20.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Combined genealogical, mapping, and expression approaches to identify spontaneously hypertensive rat hypertension candidate genes.	Hinojos CA, etal., Hypertension 2005 Apr;45(4):698-704. Epub 2005 Feb 14.
5.	Rat liver theta-class glutathione S-transferases T1-1 and T2-2: their chromatographic, electrophoretic, immunochemical, and functional properties.	Hiratsuka A, etal., Anal Biochem. 1997 Oct 15;252(2):229-37.
6.	A new class of rat glutathione S-transferase Yrs-Yrs inactivating reactive sulfate esters as metabolites of carcinogenic arylmethanols.	Hiratsuka A, etal., J Biol Chem. 1990 Jul 15;265(20):11973-81.
7.	The distribution of theta-class glutathione S-transferases in the liver and lung of mouse, rat and human.	Mainwaring GW, etal., Biochem J. 1996 Aug 15;318 ( Pt 1):297-303.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Molecular cloning and amino acid sequencing of rat liver class theta glutathione S-transferase Yrs-Yrs inactivating reactive sulfate esters of carcinogenic arylmethanols.	Ogura K, etal., Biochem Biophys Res Commun 1991 Dec 31;181(3):1294-300.
10.	Isolation and characterization of the gene encoding rat class theta glutathione S-transferase subunit yrs.	Ogura K, etal., Biochem Biophys Res Commun 1994 Dec 15;205(2):1250-6.
11.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Glutathione S-transferase: genetics and role in toxicology.	Strange RC, etal., Toxicol Lett 2000 Mar 15;112-113:357-63.
15.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
16.	Nonsteroidal anti-inflammatory drugs enhance glutathione S-transferase theta levels in rat colon.	Van Lieshout EM, etal., Biochim Biophys Acta. 1998 Aug 24;1381(3):305-11.

Additional References at PubMed

PMID:1848757	PMID:15489334	PMID:20439489	PMID:23533145	PMID:34758158

Genomics

Comparative Map Data

Gstt2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	12,819,053 - 12,822,724 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	12,818,540 - 12,822,718 (+)	Ensembl				GRCr8
mRatBN7.2	20	12,819,617 - 12,823,288 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	12,819,170 - 12,823,288 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	13,525,875 - 13,529,553 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	12,886,803 - 12,890,480 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	13,358,708 - 13,362,283 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	13,760,810 - 13,764,481 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	13,760,810 - 13,764,475 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	15,913,944 - 15,917,615 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	13,221,696 - 13,225,367 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	14,311,251 - 14,314,818 (+)	NCBI		Celera
RGSC_v3.1	20	13,221,934 - 13,225,575 (+)	NCBI
Cytogenetic Map	20	p12	NCBI

GSTT2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	23,980,134 - 23,983,915 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	23,980,058 - 23,983,915 (+)	Ensembl			hg38	GRCh38
GRCh37	22	24,322,325 - 24,326,106 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	22,652,314 - 22,656,106 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	22	22,646,877 - 22,650,652	NCBI
Celera	22	8,122,880 - 8,126,672 (+)	NCBI		Celera
Cytogenetic Map	22	q11.23	ENTREZGENE
HuRef	22	7,270,458 - 7,274,250 (+)	NCBI		HuRef
CHM1_1	22	24,334,832 - 24,338,624 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	24,387,435 - 24,391,322 (+)	NCBI		T2T-CHM13v2.0

Variants

Variants in Gstt2
32 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889610	Pancm3	Pancreatic morphology QTL 3	3.75	0.001	pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	20	4189476	49189476	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	1	26925056	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1	33724594	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26128279	Rat
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8043920	29865039	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600300	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1533083	46533083	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24164241	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	1	34066551	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29193376	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	1	27341128	Rat
1598870	Bp289	Blood pressure QTL 289	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	8216359	53216359	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29193376	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29193376	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29193376	Rat
1581577	Pur15	Proteinuria QTL 15	4.38	0.0002	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	20	8043920	15089182	Rat
1598858	Cm61	Cardiac mass QTL 61	3.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	20	8216359	53216359	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29193376	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1	14100378	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	12243242	49189476	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578510	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600300	Rat

Markers in Region

D20Wox21

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	12,819,004 - 12,819,241 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	13,760,198 - 13,760,434	NCBI	Rnor6.0
Rnor_5.0	20	15,913,332 - 15,913,568	UniSTS	Rnor5.0
RGSC_v3.4	20	13,220,415 - 13,220,651	UniSTS	RGSC3.4
Celera	20	14,310,617 - 14,310,875	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH130215

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	12,823,059 - 12,823,266 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	13,764,253 - 13,764,459	NCBI	Rnor6.0
Rnor_5.0	20	15,950,369 - 15,950,575	UniSTS	Rnor5.0
Rnor_5.0	20	15,917,387 - 15,917,593	UniSTS	Rnor5.0
RGSC_v3.4	20	13,225,139 - 13,225,345	UniSTS	RGSC3.4
Celera	20	14,314,593 - 14,314,796	UniSTS
Cytogenetic Map	20	p12	UniSTS

BF415458

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	12,820,134 - 12,820,257 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	13,761,328 - 13,761,450	NCBI	Rnor6.0
Rnor_5.0	20	15,914,462 - 15,914,584	UniSTS	Rnor5.0
RGSC_v3.4	20	13,222,214 - 13,222,336	UniSTS	RGSC3.4
Celera	20	14,311,769 - 14,311,891	UniSTS
RH 3.4 Map	20	179.22	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012796	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC091362	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061856	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK473092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D10026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D38556	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FJ179409	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000080203 ⟹ ENSRNOP00000074436

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	12,818,540 - 12,822,718 (+)	Ensembl
mRatBN7.2 Ensembl	20	12,819,500 - 12,823,288 (+)	Ensembl
Rnor_6.0 Ensembl	20	13,760,822 - 13,764,467 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000081140 ⟹ ENSRNOP00000071112

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	12,818,540 - 12,822,718 (+)	Ensembl
mRatBN7.2 Ensembl	20	12,819,170 - 12,823,287 (+)	Ensembl
Rnor_6.0 Ensembl	20	13,760,810 - 13,764,475 (+)	Ensembl

RefSeq Acc Id:

NM_012796 ⟹ NP_036928

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	12,819,053 - 12,822,724 (+)	NCBI
mRatBN7.2	20	12,819,617 - 12,823,288 (+)	NCBI
Rnor_6.0	20	13,760,810 - 13,764,481 (+)	NCBI
Rnor_5.0	20	15,913,944 - 15,917,615 (+)	NCBI
RGSC_v3.4	20	13,221,696 - 13,225,367 (+)	RGD
Celera	20	14,311,251 - 14,314,818 (+)	RGD

Sequence:

show sequence

AGCTGTCCAGAAGGGGGAACGCGTCAGACTTGGCCAACTGAGGCTGGGCTGGACCCCTATTGTG
GAATCGCGGACACTTCCTACAGTTGTCGAACGCAATCCGTCTACACCACCTTGTGTCACTACCT
ACCACCATGGGTTTGGAGCTCTACCTGGACCTGCTGTCGCAGCCCAGCCGCGCGGTCTACATCT
TCGCCAAGAAGAATGGCATCCCCTTTCAGTTGCGTACCGTGGATTTACTCAAAGGGCAGCACTT
GAGCGAGCAATTCTCCCAGGTGAACTGCTTAAAGAAAGTGCCTGTCCTCAAAGACGGAAGCTTC
GTGTTGACCGAAAGCACTGCCATCTTGATTTACCTGAGTTCCAAGTACCAGGTGGCAGACCACT
GGTACCCGGCCGACCTACAGGCCCGTGCCCAAGTCCACGAATACCTGGGTTGGCATGCCGACAA
CATCCGTGGCACCTTTGGAGTACTCCTGTGGACCAAGGTGTTGGGGCCACTCATTGGGGTCCAG
GTTCCCGAGGAAAAGGTGGAACGGAACAGAAATAGTATGGTCTTGGCTCTGCAACGTCTGGAGG
ACAAGTTCCTCAGGGACAGGGCCTTCATTGCTGGCCAGCAGGTGACGCTAGCGGATCTCATGTC
TCTAGAGGAGTTGATACAGCCGGTGGCTCTTGGCTGTAATCTGTTTGAGGGGCGGCCTCAACTG
ACAGCGTGGCGAGAGAGGGTGGAGGCGTTCTTGGGTGCTGAGCTATGTCAGGAGGCGCACAACC
CCATCATGAGCGTCCTGGGACAGGCAGCCAAGAAAACATTACCAGTACCCCCTCCGGAGGCCCA
TGCCAGCATGATGCTTCGAATTGCCAGGATTCCCTGAGTGGTTTTTTTTCCCTGAGTATTTTTA
TTGCTATAAAGACTCATTTTGTATTTTGCCTCTTTGTTTTGTTTTGTTTTTGTTTCTTCTTGTC
CCAACCTTTTTTTTTTTTTTTTTTTTTTTTCGGAGCTGGGGACCGAACCCAGGGCCTTGCGCTT
CCTAGGCAAGCGCTCTACCACTGAGCTAAATCCCCAACCCCCCCCTTTTTTTTTTTCTGGCTCC
TTTTCTGGCTCTGGGAGGAGCTTTGCTCAAAAGGGACACCACCTATCCTTAGCATGCTTCTCTT
GAGGTACAGTATGCACAACCAATAGGAGACCCAAGTCAATAATATATAAAAGGTGCTTAAAAAA
AAAAAAAAAGCAAACAGTAACACACACGAAGAAATCAACCAAAAGTTGGTGAACATCTGTTTTT
TATTATAATATAGATTCTGAATATTTTAAGGAATAAAGAGTTATTGTTTTATTACATTGCCCTC
TAATCTGTATGGAATAAAATTATGACTTTGTAAAACA

hide sequence

Protein Sequences


Protein RefSeqs	NP_036928	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61856	(Get FASTA)	NCBI Sequence Viewer
	ACI32126	(Get FASTA)	NCBI Sequence Viewer
	BAA00916	(Get FASTA)	NCBI Sequence Viewer
	BAA07559	(Get FASTA)	NCBI Sequence Viewer
	EDL97181	(Get FASTA)	NCBI Sequence Viewer
	EDL97182	(Get FASTA)	NCBI Sequence Viewer
	P30713	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_036928 ⟸ NM_012796

- UniProtKB:

P36971 (UniProtKB/Swiss-Prot), P30713 (UniProtKB/Swiss-Prot), B6DYQ9 (UniProtKB/TrEMBL), A0A8L2R9M6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGLELYLDLLSQPSRAVYIFAKKNGIPFQLRTVDLLKGQHLSEQFSQVNCLKKVPVLKDGSFVL
TESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQVP
EEKVERNRNSMVLALQRLEDKFLRDRAFIAGQQVTLADLMSLEELIQPVALGCNLFEGRPQLTA
WRERVEAFLGAELCQEAHNPIMSVLGQAAKKTLPVPPPEAHASMMLRIARIP

hide sequence

Ensembl Acc Id:

ENSRNOP00000074436 ⟸ ENSRNOT00000080203

Ensembl Acc Id:

ENSRNOP00000071112 ⟸ ENSRNOT00000081140

Protein Domains

GST C-terminal GST N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2JZV9-F1-model_v2	AlphaFold	A0A0G2JZV9	1-68	view protein structure
AF-P30713-F1-model_v2	AlphaFold	P30713	1-244	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701532

Promoter ID:

EPDNEW_R12056

Type:

initiation region

Name:

Gstt2_1

Description:

glutathione S-transferase, theta 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	13,760,794 - 13,760,854	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69362	AgrOrtholog
BioCyc Gene	G2FUF-4162	BioCyc
Ensembl Genes	ENSRNOG00000052415	Ensembl
Gene3D-CATH	1.20.1050.10	UniProtKB/Swiss-Prot
	Glutaredoxin	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5623709	IMAGE-MGC_LOAD
InterPro	Glutathione-S-Trfase_C-like	UniProtKB/Swiss-Prot
	Glutathione-S-Trfase_C_sf	UniProtKB/Swiss-Prot
	Glutathione_S-Trfase	UniProtKB/Swiss-Prot
	Glutathione_S-Trfase_N	UniProtKB/Swiss-Prot
	GST_C	UniProtKB/Swiss-Prot
	GST_C_Theta	UniProtKB/Swiss-Prot
	GST_N_Theta	UniProtKB/Swiss-Prot
	GST_Theta	UniProtKB/Swiss-Prot
	Thioredoxin-like_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:29487	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72535	IMAGE-MGC_LOAD
NCBI Gene	29487	ENTREZGENE
PANTHER	GLUTATHIONE S-TRANSFERASE THETA-2-RELATED	UniProtKB/Swiss-Prot
	PTHR43917	UniProtKB/Swiss-Prot
Pfam	GST_C	UniProtKB/Swiss-Prot
	GST_N	UniProtKB/Swiss-Prot
PhenoGen	Gstt2	PhenoGen
PROSITE	GST_CTER	UniProtKB/Swiss-Prot
	GST_NTER	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000052415	RatGTEx
Superfamily-SCOP	SSF47616	UniProtKB/Swiss-Prot
	SSF52833	UniProtKB/Swiss-Prot
UniProt	A0A8L2R9M6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2UQ98_RAT	UniProtKB/TrEMBL
	A6JKG6_RAT	UniProtKB/TrEMBL
	B6DYQ9	ENTREZGENE, UniProtKB/TrEMBL
	GSTT2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	P36971	ENTREZGENE
UniProt Secondary	P36971	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-12-20	Gstt2	glutathione S-transferase theta 2	Gstt2	glutathione S-transferase, theta 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2021-03-09	Gstt2	glutathione S-transferase, theta 2	LOC103694878	glutathione S-transferase theta-2-like	Data merged from RGD:9417129	737654	PROVISIONAL
2014-08-25	LOC103694878	glutathione S-transferase theta-2-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2002-06-10	Gstt2	glutathione S-transferase, theta 2			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expression is decreased 2.1 fold in SHR compared with WKY rats	1357414

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)