Advanced Search (OLGA)

Gene: Rem2 (RRAD and GEM like GTPase 2) Rattus norvegicus

Analyze

Symbol:

Rem2

Name:

RRAD and GEM like GTPase 2

RGD ID:

69081

Description:

Enables GTP binding activity and GTPase activity. Predicted to be located in membrane. Predicted to be active in plasma membrane. Orthologous to human REM2 (RRAD and GEM like GTPase 2); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GEM, REM, Kir family small G-protein; GTP-binding protein REM 2; GTP-binding protein REM2; MGC156645; rad and gem related GTP binding protein 2; rad and Gem-like GTP-binding protein 2; RAS (RAD and GEM) like GTP binding 2; Ras-related GTP-binding protein of the Rad/Gem/Kir family; Ras-related GTP-binding protein of the Rad/Gem/Kir family member 2; Ras-related GTP-binding protein of the Rad/Gem/Kir family, member 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	REM2 (RRAD and GEM like GTPase 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rem2 (rad and gem related GTP binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rem2 (RRAD and GEM like GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	REM2 (RRAD and GEM like GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	REM2 (RRAD and GEM like GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rem2 (RRAD and GEM like GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	REM2 (RRAD and GEM like GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	REM2 (RRAD and GEM like GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rem2 (RRAD and GEM like GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rem2 (RRAD and GEM like GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	BLZF1 (basic leucine zipper nuclear factor 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	REM2 (RRAD and GEM like GTPase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rem2 (rad and gem related GTP binding protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rem2 (RAS (RAD and GEM)-like GTP binding 2)	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	Y52B11A.4	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	Y52B11A.4	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG42541	Alliance	DIOPT (OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Rgk1	Alliance	DIOPT (OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Rgk2	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rgk2	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rgk3	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rem2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	31,903,972 - 31,908,451 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	31,903,965 - 31,908,445 (+)	Ensembl				GRCr8
mRatBN7.2	15	27,933,950 - 27,938,429 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	27,933,950 - 27,938,429 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	29,773,309 - 29,777,787 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	30,920,530 - 30,925,008 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	29,170,864 - 29,175,344 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	33,121,273 - 33,125,752 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	33,121,273 - 33,125,752 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	37,006,429 - 37,010,908 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	32,539,996 - 32,544,475 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	27,516,641 - 27,521,120 (+)	NCBI		Celera
RGSC_v3.1	15	32,555,820 - 32,559,500 (+)	NCBI
Cytogenetic Map	15	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

15-acetyldeoxynivalenol (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

cisplatin (EXP,ISO)

clofibric acid (EXP)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

endosulfan (EXP)

ethanol (ISO)

folic acid (ISO)

gentamycin (EXP)

ketamine (EXP)

methamphetamine (EXP)

methotrexate (ISO)

Methylazoxymethanol acetate (EXP)

methylisothiazolinone (ISO)

mono(2-ethylhexyl) phthalate (ISO)

morphine (ISO)

N-nitrosodiethylamine (EXP)

nicotine (ISO)

okadaic acid (ISO)

ozone (ISO)

perfluorooctanoic acid (EXP)

phenethyl caffeate (EXP)

scopolamine (EXP)

silver atom (ISO)

silver(0) (ISO)

Soman (EXP)

sotorasib (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trametinib (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

plasma membrane (IBA,IEA)

Molecular Function

calcium channel regulator activity (IBA)

GTP binding (IBA,IDA,IEA)

GTPase activity (IDA,IEA)

nucleotide binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Rem2, a new member of the Rem/Rad/Gem/Kir family of Ras-related GTPases.	Finlin BS, etal., Biochem J 2000 Apr 1;347 Pt 1:223-31.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Localization of 54 rat genes, and definition of new synteny groups conserved in the human and the rat.	Szpirer C, etal., Mamm Genome 2000 Sep;11(9):729-35

Additional References at PubMed

PMID:12477932	PMID:16237180	PMID:18068949	PMID:21485012	PMID:21980534	PMID:22684057	PMID:22815963	PMID:24403140	PMID:28259675	PMID:29809135

Genomics

Comparative Map Data

Rem2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	31,903,972 - 31,908,451 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	31,903,965 - 31,908,445 (+)	Ensembl				GRCr8
mRatBN7.2	15	27,933,950 - 27,938,429 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	27,933,950 - 27,938,429 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	29,773,309 - 29,777,787 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	30,920,530 - 30,925,008 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	29,170,864 - 29,175,344 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	33,121,273 - 33,125,752 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	33,121,273 - 33,125,752 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	37,006,429 - 37,010,908 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	32,539,996 - 32,544,475 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	27,516,641 - 27,521,120 (+)	NCBI		Celera
RGSC_v3.1	15	32,555,820 - 32,559,500 (+)	NCBI
Cytogenetic Map	15	p13	NCBI

REM2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	22,883,222 - 22,887,678 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	22,883,136 - 22,887,686 (+)	Ensembl			hg38	GRCh38
GRCh37	14	23,352,431 - 23,356,887 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	22,422,272 - 22,426,729 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	22,422,280 - 22,426,729	NCBI
Celera	14	3,215,328 - 3,219,787 (+)	NCBI		Celera
Cytogenetic Map	14	q11.2	NCBI
HuRef	14	3,469,552 - 3,474,011 (+)	NCBI		HuRef
CHM1_1	14	23,351,095 - 23,355,552 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	17,081,280 - 17,085,738 (+)	NCBI		T2T-CHM13v2.0

Rem2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	54,713,676 - 54,717,889 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	54,713,557 - 54,717,888 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	54,476,100 - 54,480,434 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	54,476,100 - 54,480,431 (+)	Ensembl			mm10	GRCm38
MGSCv37	14	55,094,937 - 55,099,271 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	53,430,305 - 53,434,639 (+)	NCBI		MGSCv36	mm8
Celera	14	52,269,483 - 52,273,799 (+)	NCBI		Celera
Cytogenetic Map	14	C2	NCBI
cM Map	14	27.8	NCBI

Rem2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	37,402,212 - 37,408,312 (-)	Ensembl
ChiLan1.0	NW_004955409	37,403,758 - 37,408,312 (-)	NCBI	ChiLan1.0	ChiLan1.0

REM2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	24,312,623 - 24,319,212 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	23,529,111 - 23,533,681 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	3,700,397 - 3,704,897 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	21,800,155 - 21,804,692 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	21,800,155 - 21,804,692 (+)	Ensembl			panPan2	panpan1.1

REM2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	3,215,023 - 3,223,470 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	3,208,269 - 3,382,311 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	3,163,373 - 3,171,150 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	3,322,753 - 3,330,535 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	3,315,969 - 3,330,486 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	3,014,093 - 3,021,870 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	3,075,874 - 3,083,649 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	3,337,852 - 3,345,634 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rem2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	34,971,438 - 34,976,785 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936722	1,410,731 - 1,416,991 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936722	1,412,068 - 1,416,967 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

REM2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	76,143,726 - 76,150,147 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	76,141,015 - 76,149,162 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

REM2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	23,249,170 - 23,254,732 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	23,250,334 - 23,253,988 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666059	23,168,745 - 23,173,245 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rem2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624820	9,635,552 - 9,640,482 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624820	9,635,971 - 9,640,321 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rem2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	12	70,518,872 - 70,523,118 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rem2
45 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	332
Count of miRNA genes:	192
Interacting mature miRNAs:	225
Transcripts:	ENSRNOT00000016020
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1641913	Colcr2	Colorectal carcinoma resistance QTL 2	6.57	0.0197	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	15	2315759	47315759	Rat
5684946	Bss98	Bone structure and strength QTL 98	3.9	0.0026	tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	15	1	39411584	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	44836456	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2315759	53331089	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	31855803	92671517	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	22728353	42072050	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	28527732	73527732	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	25285835	104695021	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	22336351	52597086	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	25285835	104695021	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	19155762	87086765	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	2785923	47785923	Rat
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	32342855	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	14926594	71614418	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	22336351	67336351	Rat
5685002	Bss103	Bone structure and strength QTL 103	2.8		tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	15	16911521	32439851	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	25285835	104695021	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	6	55	163	91	90	59	80	59	6	322	161	11	142	81	91	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022685	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC114835	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF084464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY916790	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC127495	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB706504	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016020 ⟹ ENSRNOP00000016020

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	31,903,965 - 31,908,445 (+)	Ensembl
mRatBN7.2 Ensembl	15	27,933,950 - 27,938,429 (+)	Ensembl
Rnor_6.0 Ensembl	15	33,121,273 - 33,125,752 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099430 ⟹ ENSRNOP00000079606

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	31,903,965 - 31,907,034 (+)	Ensembl
mRatBN7.2 Ensembl	15	27,933,950 - 27,937,012 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108963 ⟹ ENSRNOP00000096841

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	27,934,570 - 27,938,429 (+)	Ensembl

RefSeq Acc Id:

NM_022685 ⟹ NP_073176

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	31,903,972 - 31,908,451 (+)	NCBI
mRatBN7.2	15	27,933,950 - 27,938,429 (+)	NCBI
Rnor_6.0	15	33,121,273 - 33,125,752 (+)	NCBI
Rnor_5.0	15	37,006,429 - 37,010,908 (+)	NCBI
RGSC_v3.4	15	32,539,996 - 32,544,475 (+)	RGD
Celera	15	27,516,641 - 27,521,120 (+)	RGD

Sequence:

show sequence

GTATTTAAAGGGAAAAGCTGACAGTGCTGCTGAGTGAGGATCCGGTGCTGTGAGCCGCCGGGCT
GCACTCGCACATGCACGTCAATGCACACGGACCTTGACACCGACATGGACGCGGACACCGAAAC
CGTAGCACTTTGTTCTTCTAGCAGCCGCCAGGCCTCCCCATCAGGGACACCCACACCAGAAGCC
GATACGACACTTCTGAAGCAGAAGCCAGAGAAACTGTTGGCAGAGTTGGACAGAGGTGGGCCAC
CTCCTGCTCCTGGGGTCCCCAGACGAAGAGGAAGTATGCCTGTGCCCTACAAACACCAGCTGCG
GCGGGCTCAAGCTGTGGATGAGCTTGACTGGCCACCTCAGGCCTCTTCCTCTGGCTCCTCTGAC
TCGTTGGGCTCAGGGGAGGCAGCCCTGGCCCAAAAAGATGGTGTCTTTAAGGTCATGCTCCTGG
GAGAGAGTGGCGTGGGCAAGAGCACTCTAGCAGGCACTTTCGGAGGTCTCCAGGGAGACAATGC
TCACGAGATGGAGAACTCAGAGGACACCTATGAGAGACGGATCATGGTGGACAAAGAAGAAGTG
ACTTTAATTGTTTATGACATCTGGGAACAGGGAGACGCAGGAGGATGGCTGCAGGACCACTGCC
TTCAGACGGGGGACGCCTTTCTCATCGTCTTTTCAGTCACAGATCGACGAAGCTTCTCCAAAGT
TCCTGAAACCCTTCTTCGACTCCGGGCTGGGAGGCCCCACCACGACCTACCTGTCATCCTTGTT
GGAAATAAGAGTGACCTGGCCCGTTCCCGGGAGGTGTCACTGGAGGAGGGTCGCCATCTGGCCG
GGACGCTGAGCTGCAAGCACATAGAGACATCAGCCGCTCTCCACCACAACACTCGTGAGCTCTT
CGAGGGCGCTGTGCGTCAGATCAGGCTGCGGCGGGGCCGGGGTCATGCCGGGGGCCAGCGGCCG
GAACCTAGCAGCCCGGACGGCCCCGCGCCGCCTACGCGCCGCGAGAGCCTCACCAAGAAAGCTA
AGCGCTTCCTCGCCAACCTGGTGCCGCGCAACGCCAAGTTCTTCAAGCAACGCTCCAGGTCGTG
TCACGACCTCTCTGTGCTCTGAGCCACGGTCGCCATGGTCACTGCAGTCGCCATGGTCACCGTG
CCCTCCGCTCGCCCCCTCACCCCACTCCAGTCCGTCTAGGAAACCAAAAATACCCAGGATGCCC
TGGTGTGATGGGGAGGCGGGGCCGGGTAGCTGGTAGGTCCACCACCACCACCTCGCCTGGTCTG
AACAGCCAACCCCACACTGCGCCTCAAGACCTGCAAGACAGGGAAGAAATCCGTGCTGCAAGGT
ATTTTTTTATTGTTATTATTAACTTGCAAGAAACCACCTCTCCCGGAAGAGACTCCAACAGCTA
GAACTGGAAAAGTGCTTTGTAAGCCTCCTGGATGGAGTTGACCTCCTCAGTACTCTGAACATGC
CTTACCTTTAAGCAAGTTTTAAAGGTAGAAACCCAGAGATGACTCTTCCAGAGATGACTGAAAA
TATTTCTCTTGTCCTCTGTCCTGGTCCACTTTGCCCTTAAGACGTTCTTAAAAGAAAGGGCTGG
AAGTTATTCTTGAAATTGGACTCTGACTTAGCAATCTACGATAGCATGTTTCGTTTAAGGTTAC
TGAAGTGAAGATGTGGGCAGACTCTCGACATTTAGATACCCTAAGGTAGAGCTGAGCGCTAGAA
ACCCCTGTGGCCAGGGACTAGGAGGCACCAGCAAGGGCCACCCTTTCCCCTTTCCAATAAATTT
TTTTTCTATTGCACTGTGAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_073176	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD34238	(Get FASTA)	NCBI Sequence Viewer
	AAI27496	(Get FASTA)	NCBI Sequence Viewer
	AAX13958	(Get FASTA)	NCBI Sequence Viewer
	EDM14173	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016020
	ENSRNOP00000016020.4
GenBank Protein	Q9WTY2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_073176 ⟸ NM_022685

- UniProtKB:

Q5D202 (UniProtKB/Swiss-Prot), Q9WTY2 (UniProtKB/Swiss-Prot), A6KGU4 (UniProtKB/TrEMBL), A0A8I6GM97 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MHTDLDTDMDADTETVALCSSSSRQASPSGTPTPEADTTLLKQKPEKLLAELDRGGPPPAPGVP
RRRGSMPVPYKHQLRRAQAVDELDWPPQASSSGSSDSLGSGEAALAQKDGVFKVMLLGESGVGK
STLAGTFGGLQGDNAHEMENSEDTYERRIMVDKEEVTLIVYDIWEQGDAGGWLQDHCLQTGDAF
LIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKH
IETSAALHHNTRELFEGAVRQIRLRRGRGHAGGQRPEPSSPDGPAPPTRRESLTKKAKRFLANL
VPRNAKFFKQRSRSCHDLSVL

hide sequence

Ensembl Acc Id:

ENSRNOP00000016020 ⟸ ENSRNOT00000016020

Ensembl Acc Id:

ENSRNOP00000096841 ⟸ ENSRNOT00000108963

Ensembl Acc Id:

ENSRNOP00000079606 ⟸ ENSRNOT00000099430

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9WTY2-F1-model_v2	AlphaFold	Q9WTY2	1-341	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69081	AgrOrtholog
BioCyc Gene	G2FUF-13798	BioCyc
Ensembl Genes	ENSRNOG00000011646	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000016020	ENTREZGENE
	ENSRNOT00000016020.7	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:8371030	IMAGE-MGC_LOAD
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot
	RGK_GTP-binding_reg	UniProtKB/Swiss-Prot
	Sigma_54_int_dom_ATP-bd_1	UniProtKB/Swiss-Prot
	Small_GTPase	UniProtKB/Swiss-Prot
KEGG Report	rno:64626	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:156645	IMAGE-MGC_LOAD
NCBI Gene	64626	ENTREZGENE
PANTHER	GTP-BINDING PROTEIN REM 2	UniProtKB/Swiss-Prot
	RAD, GEM/KIR FAMILY MEMBER 2, ISOFORM C	UniProtKB/Swiss-Prot
Pfam	Ras	UniProtKB/Swiss-Prot
PhenoGen	Rem2	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot
PROSITE	RAS	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011646	RatGTEx
SMART	RAB	UniProtKB/Swiss-Prot
	RAS	UniProtKB/Swiss-Prot
	RHO	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZNX7_RAT	UniProtKB/TrEMBL
	A0A8I6GM97	ENTREZGENE
	A0JPL9_RAT	UniProtKB/TrEMBL
	A6KGU4	ENTREZGENE, UniProtKB/TrEMBL
	Q5D202	ENTREZGENE
	Q9WTY2	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q5D202	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-12	Rem2	RRAD and GEM like GTPase 2	Rem2	RAS (RAD and GEM) like GTP binding 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-24	Rem2	RAS (RAD and GEM) like GTP binding 2	Rem2	rad and gem related GTP binding protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2003-04-09	Rem2	rad and gem related GTP binding protein 2		Ras-related GTP-binding protein of the Rad/Gem/Kir family, member 2	Name updated	629478	APPROVED
2002-06-10	Rem2	Ras-related GTP-binding protein of the Rad/Gem/Kir family, member 2			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_other	has a higher dissociation rate for GTP than GDP	68879

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message