Advanced Search (OLGA)

Gene: Ddx25 (DEAD-box helicase 25) Rattus norvegicus

Analyze

Symbol:

Ddx25

Name:

DEAD-box helicase 25

RGD ID:

68381

Description:

Enables ATP hydrolysis activity; RNA binding activity; and RNA helicase activity. Predicted to be involved in poly(A)+ mRNA export from nucleus; regulation of translation; and spermatid development. Located in cytoplasm and nucleus. Orthologous to human DDX25 (DEAD-box helicase 25); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ATP-dependent RNA helicase DDX25; DEAD (Asp-Glu-Ala-Asp) box helicase 25; DEAD (Asp-Glu-Ala-Asp) box polypeptide 25; DEAD (aspartate-glutamate-alanine-aspartate) box polypeptide 25; DEAD box protein 25; gonadotropin-regulated testicular RNA helicase; GRTH

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DDX25 (DEAD-box helicase 25)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ddx25 (DEAD box helicase 25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ddx25 (DEAD-box helicase 25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DDX25 (DEAD-box helicase 25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DDX25 (DEAD-box helicase 25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ddx25 (DEAD-box helicase 25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DDX25 (DEAD-box helicase 25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DDX25 (DEAD-box helicase 25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ddx25 (DEAD-box helicase 25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ddx25 (DEAD-box helicase 25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Ddx25 (DEAD box helicase 25)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DDX25 (DEAD-box helicase 25)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DBP5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Dbp80	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ddx-19	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ddx25	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ddx25	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	42,152,046 - 42,168,635 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	42,152,047 - 42,168,080 (-)	Ensembl				GRCr8
mRatBN7.2	8	33,894,224 - 33,910,377 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	33,894,232 - 33,921,764 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	37,970,852 - 37,986,873 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	36,253,902 - 36,269,922 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	34,116,733 - 34,132,752 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	36,744,686 - 36,760,720 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	36,744,667 - 36,760,742 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	36,761,172 - 36,777,206 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	35,326,939 - 35,342,973 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	35,315,323 - 35,331,357 (-)	NCBI		Celera
RGSC_v3.1	8	35,335,705 - 35,351,739 (-)	NCBI
Cytogenetic Map	8	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

azoospermia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

5-aza-2'-deoxycytidine (ISO)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

allethrin (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chrysene (ISO)

cisplatin (ISO)

cyhalothrin (EXP)

cypermethrin (EXP)

dorsomorphin (ISO)

endosulfan (EXP)

ethanol (ISO)

fenvalerate (EXP)

flavonoids (EXP)

gentamycin (EXP)

lead(0) (ISO)

maneb (ISO)

Methylazoxymethanol acetate (EXP)

methylmercury chloride (ISO)

paracetamol (ISO)

paraquat (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

pyrethrins (EXP)

SB 431542 (ISO)

sodium arsenite (ISO)

Soman (EXP)

testosterone (ISO)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP,ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IEA)

mRNA export from nucleus (IEA,ISO,ISS)

mRNA transport (IEA)

poly(A)+ mRNA export from nucleus (IBA)

regulation of translation (IEA,ISO,ISS)

spermatid development (IEA,ISO,ISS)

spermatogenesis (IEA)

Cellular Component

chromatoid body (IEA,ISO,ISS)

cytoplasm (IDA,IEA,ISO)

cytoplasmic stress granule (IBA)

cytosol (IEA,ISO)

nucleus (IBA,IDA,IEA,ISO)

Molecular Function

ATP binding (IEA,ISO,ISS)

ATP hydrolysis activity (IDA,IEA)

helicase activity (IEA)

hydrolase activity (IEA)

mRNA binding (IBA)

nucleic acid binding (IEA)

nucleotide binding (IEA)

protein binding (ISO)

RNA binding (IDA,IEA)

RNA helicase activity (IBA,IDA,IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Cell-specific and hormone-regulated expression of gonadotropin-regulated testicular RNA helicase gene (GRTH/Ddx25) resulting from alternative utilization of translation initiation codons in the rat testis.	Sheng Y, etal., J Biol Chem 2003 Jul 25;278(30):27796-803. Epub 2003 May 6.
7.	Gonadotropin-regulated testicular RNA helicase (GRTH/Ddx25) is a transport protein involved in gene-specific mRNA export and protein translation during spermatogenesis.	Sheng Y, etal., J Biol Chem. 2006 Nov 17;281(46):35048-56. Epub 2006 Sep 12.
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.	A novel gonadotropin-regulated testicular RNA helicase. A new member of the dead-box family.	Tang PZ, etal., J Biol Chem 1999 Dec 31;274(53):37932-40.
10.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:15096601	PMID:21691948	PMID:22038044

Genomics

Comparative Map Data

Ddx25
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	42,152,046 - 42,168,635 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	42,152,047 - 42,168,080 (-)	Ensembl				GRCr8
mRatBN7.2	8	33,894,224 - 33,910,377 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	33,894,232 - 33,921,764 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	37,970,852 - 37,986,873 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	36,253,902 - 36,269,922 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	34,116,733 - 34,132,752 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	36,744,686 - 36,760,720 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	36,744,667 - 36,760,742 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	36,761,172 - 36,777,206 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	35,326,939 - 35,342,973 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	35,315,323 - 35,331,357 (-)	NCBI		Celera
RGSC_v3.1	8	35,335,705 - 35,351,739 (-)	NCBI
Cytogenetic Map	8	q21	NCBI

DDX25
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	125,903,328 - 125,928,843 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	125,903,348 - 125,943,702 (+)	Ensembl			hg38	GRCh38
GRCh37	11	125,773,223 - 125,798,738 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	125,279,613 - 125,298,215 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	11	125,279,612 - 125,298,213	NCBI
Celera	11	122,934,293 - 122,953,028 (+)	NCBI		Celera
Cytogenetic Map	11	q24.2	NCBI
HuRef	11	121,716,218 - 121,734,969 (+)	NCBI		HuRef
CHM1_1	11	125,661,010 - 125,679,757 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	125,932,197 - 125,957,695 (+)	NCBI		T2T-CHM13v2.0

Ddx25
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	35,453,144 - 35,469,766 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	35,447,943 - 35,469,824 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	35,541,848 - 35,558,470 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	35,536,647 - 35,558,528 (-)	Ensembl			mm10	GRCm38
MGSCv37	9	35,349,433 - 35,366,055 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	35,291,496 - 35,308,135 (-)	NCBI		MGSCv36	mm8
Celera	9	32,778,916 - 32,795,591 (-)	NCBI		Celera
Cytogenetic Map	9	A4	NCBI
cM Map	9	20.31	NCBI

Ddx25
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	26,952,239 - 26,972,100 (+)	Ensembl
ChiLan1.0	NW_004955412	26,952,655 - 26,973,758 (+)	NCBI	ChiLan1.0	ChiLan1.0

DDX25
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	126,587,696 - 126,607,452 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	127,695,274 - 127,715,018 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	120,718,758 - 120,738,527 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	124,632,841 - 124,651,525 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	124,632,841 - 124,667,585 (+)	Ensembl			panPan2	panpan1.1

DDX25
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	8,566,748 - 8,585,965 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	8,566,754 - 8,586,020 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	8,627,271 - 8,647,444 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	8,523,128 - 8,543,524 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	8,523,136 - 8,543,526 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	8,591,262 - 8,611,439 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	8,565,502 - 8,585,675 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	8,599,553 - 8,619,741 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ddx25
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	108,128,868 - 108,149,009 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936572	6,301,347 - 6,321,542 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936572	6,301,347 - 6,322,640 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DDX25
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	53,029,790 - 53,044,383 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	53,029,450 - 53,044,088 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	58,760,963 - 58,772,124 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DDX25
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	117,035,171 - 117,053,726 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	117,035,310 - 117,053,494 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666043	9,017,831 - 9,037,268 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ddx25
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624812	52,368 - 74,149 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624812	53,129 - 74,073 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ddx25
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	31,080,742 - 31,097,315 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ddx25
49 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	50
Count of miRNA genes:	43
Interacting mature miRNAs:	49
Transcripts:	ENSRNOT00000017307
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357398	Slep3	Serum leptin concentration QTL 3	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	17994105	50763951	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	39106258	91341052	Rat
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39752803	84752803	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	16994642	61994642	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	39106258	91341052	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	39106363	103375781	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	12964165	57964165	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	15952279	60952279	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	39106258	84106258	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	12964165	57964165	Rat
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	10382540	55382540	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	39106363	103375781	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	10382540	55382540	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	16994642	61994642	Rat
61337	Bp22	Blood pressure QTL 22	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	51589833	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	12964165	57964165	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	39106258	103375958	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	10382540	55382540	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	39106258	91341052	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
2302278	Gluco36	Glucose level QTL 36	4.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	37760859	58991895	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	10382540	55382540	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	35464071	71842899	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	37760859	61459705	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	39106258	84106258	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	31543661	76543661	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	84106258	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	17993862	62252873	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	67378345	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	39106258	91341052	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	39106258	103375958	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
1359021	Bp271	Blood pressure QTL 271	1.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	34125902	55607752	Rat
2302367	Slep5	Serum leptin concentration QTL 5	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	17994105	50763951	Rat
70206	Alc20	Alcohol consumption QTL 20	2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	8	39106258	49610361	Rat

Markers in Region

RH132914

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	33,894,403 - 33,895,835 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	36,744,859 - 36,746,290	NCBI	Rnor6.0
Rnor_5.0	8	36,761,345 - 36,762,776	UniSTS	Rnor5.0
RGSC_v3.4	8	35,327,112 - 35,328,543	UniSTS	RGSC3.4
Celera	8	35,315,496 - 35,316,927	UniSTS
RH 3.4 Map	8	301.2	UniSTS
Cytogenetic Map	8	q21	UniSTS

AW047046

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	33,894,339 - 33,894,424 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	36,744,795 - 36,744,879	NCBI	Rnor6.0
Rnor_5.0	8	36,761,281 - 36,761,365	UniSTS	Rnor5.0
RGSC_v3.4	8	35,327,048 - 35,327,132	UniSTS	RGSC3.4
Celera	8	35,315,432 - 35,315,516	UniSTS
Cytogenetic Map	8	q21	UniSTS

BQ201435

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	33,901,568 - 33,901,753 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	36,752,024 - 36,752,208	NCBI	Rnor6.0
Rnor_5.0	8	36,768,510 - 36,768,694	UniSTS	Rnor5.0
RGSC_v3.4	8	35,334,277 - 35,334,461	UniSTS	RGSC3.4
Celera	8	35,322,661 - 35,322,845	UniSTS
RH 3.4 Map	8	300.4	UniSTS
Cytogenetic Map	8	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	66	163	91	90	59	87	59	6	343	186	11	142	74	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031630	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082035	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082036	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266048	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC132671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF142629	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017307 ⟹ ENSRNOP00000017307

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	42,152,047 - 42,168,080 (-)	Ensembl
mRatBN7.2 Ensembl	8	33,894,232 - 33,910,267 (-)	Ensembl
Rnor_6.0 Ensembl	8	36,744,667 - 36,760,742 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096268 ⟹ ENSRNOP00000088320

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	42,152,047 - 42,168,080 (-)	Ensembl
mRatBN7.2 Ensembl	8	33,894,234 - 33,921,764 (-)	Ensembl

RefSeq Acc Id:

NM_031630 ⟹ NP_113818

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	42,152,046 - 42,168,080 (-)	NCBI
mRatBN7.2	8	33,894,231 - 33,910,267 (-)	NCBI
Rnor_6.0	8	36,744,686 - 36,760,720 (-)	NCBI
Rnor_5.0	8	36,761,172 - 36,777,206 (-)	NCBI
RGSC_v3.4	8	35,326,939 - 35,342,973 (-)	RGD
Celera	8	35,315,323 - 35,331,357 (-)	RGD

Sequence:

show sequence

GGGGGCGAGAGCAGAGACCGCAGCTATGGCGTCGTTACTTTGGGGAGGCGACGCTGGGGCGGCG
GAGAGCGAGCGGCTGAACAGCCACTTTTCAAATCTCGTCCACCCCAGGAAGAACCTTCGTGGTA
TTAGGAGTACCACAGTCCCAAACATAGACGGCTCTCTTAACACGGAAGAAGATGATGACGAAGA
CGATGTAGTGGATTTGGCAGCCAATTCACTCTTAAACAAGTTAATCCGCCAGTCCTTAGTAGAA
TCCAGCCACCGAGTGGAAGTCTTACAAAAGGATCCCAGCTCTCCACTCTACTCGGTGAAAACAT
TTGAAGAGCTACGACTAAAGGAAGAGTTACTAAAAGGGATTTATGCAATGGGATTTAACCGACC
ATCCAAAATCCAAGAGATGGCCCTCCCCATGATGCTCGCACATCCTCCCCAGAACCTCATAGCA
CAGAGCCAGTCCGGCACAGGAAAAACCGCTGCCTTTGTCTTAGCGATGCTAAACAGAGTGAATG
CCTTGGAATTGTTTCCACAGTGCCTCTGCCTGGCTCCCACCTATGAACTGGCTCTGCAGACCGG
CCGCGTGGTTGAAAGAATGGGGAAATTCTGTGTGGATGTTGAAGTGATGTACGCCATTCGAGGA
AACCGAATTCCTAGGGGCACCGACGTCACCAAACAGATTGTCATCGGCACTCCTGGGACTGTCC
TAGACTGGTGCTTCAAGCGGAAACTGATTGACTTGACAAAGATCCGTGTGTTTGTCCTGGATGA
AGCAGATGTGATGATTGACACCCAAGGATTCTCCGATCAGAGCATCCGTATCCAAAGAGCTTTA
CCCTCTGAATGCCAGATGCTCCTCTTTTCAGCAACCTTTGAGGACTCTGTGTGGCAGTTTGCTG
AACGAATCATTCCTGACCCCAATGTTATCAAGTTGCGAAAAGAGGAACTGACCCTGAACAACAT
CCGGCAGTATTACGTGTTGTGTGAGAACAGGAAAGACAAATACCAAGCCCTCTGTAATATCTAC
GGTGGCATCACCATTGGCCAAGCCATCATCTTCTGCCAGACGCGTCGGAATGCCAAGTGGCTGA
CAGTGGAGATGATGCAGGATGGCCACCAGGTGTCCCTGCTAAGTGGAGAACTCACGGTGGAGCA
GCGGGCTTCCATCATTCAGAGGTTCCGAGATGGCAAAGAGAAGGTTCTCATAACAACCAATGTC
TGTGCTCGAGGAATCGATGTGAAGCAGGTCACCATCGTTGTGAACTTTGACCTCCCTGTAAACC
AGTCAGAAGAGCCAGACTATGAGACCTACCTCCACCGTATAGGGCGGACGGGACGCTTTGGGAA
AAAAGGTCTCGCCTTCAACATGATTGAAGTGGATAAGCTGCCCCTGCTCATGAAAATACAAGAC
CACTTCAATAGCAGTATTAAGCAGCTGGACCCAGAAGACATGGATGAGATTGAAAAGATCGAAT
ATTGAAGAGAGAGAGGCCTTTGTTGTTTGTGGGCTGTCCTAGTTGATGTGAGAATGTTTGAGCA
GAGTTTGAAGATAATGGTCTATGTTGAGGCTCTGTCACGTGAAACTGTCACAGATAACAAATAA
ATGCCATGGCTCTCCTCAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039082034 ⟹ XP_038937962

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	42,152,046 - 42,168,103 (-)	NCBI
mRatBN7.2	8	33,894,231 - 33,910,316 (-)	NCBI

RefSeq Acc Id:

XM_039082035 ⟹ XP_038937963

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	42,159,216 - 42,168,125 (-)	NCBI
mRatBN7.2	8	33,901,401 - 33,910,377 (-)	NCBI

RefSeq Acc Id:

XM_039082036 ⟹ XP_038937964

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	42,152,046 - 42,168,120 (-)	NCBI
mRatBN7.2	8	33,894,224 - 33,910,282 (-)	NCBI

RefSeq Acc Id:

XM_063266048 ⟹ XP_063122118

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	42,152,046 - 42,168,635 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_113818	(Get FASTA)	NCBI Sequence Viewer
	XP_038937962	(Get FASTA)	NCBI Sequence Viewer
	XP_038937963	(Get FASTA)	NCBI Sequence Viewer
	XP_038937964	(Get FASTA)	NCBI Sequence Viewer
	XP_063122118	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF21360	(Get FASTA)	NCBI Sequence Viewer
	AAH78791	(Get FASTA)	NCBI Sequence Viewer
	EDL83267	(Get FASTA)	NCBI Sequence Viewer
	EDL83268	(Get FASTA)	NCBI Sequence Viewer
	EDL83269	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017307
GenBank Protein	Q9QY16	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113818 ⟸ NM_031630

- UniProtKB:

Q9QY16 (UniProtKB/Swiss-Prot), A6JYK6 (UniProtKB/TrEMBL), Q68G14 (UniProtKB/TrEMBL), F7ER47 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASLLWGGDAGAAESERLNSHFSNLVHPRKNLRGIRSTTVPNIDGSLNTEEDDDEDDVVDLAAN
SLLNKLIRQSLVESSHRVEVLQKDPSSPLYSVKTFEELRLKEELLKGIYAMGFNRPSKIQEMAL
PMMLAHPPQNLIAQSQSGTGKTAAFVLAMLNRVNALELFPQCLCLAPTYELALQTGRVVERMGK
FCVDVEVMYAIRGNRIPRGTDVTKQIVIGTPGTVLDWCFKRKLIDLTKIRVFVLDEADVMIDTQ
GFSDQSIRIQRALPSECQMLLFSATFEDSVWQFAERIIPDPNVIKLRKEELTLNNIRQYYVLCE
NRKDKYQALCNIYGGITIGQAIIFCQTRRNAKWLTVEMMQDGHQVSLLSGELTVEQRASIIQRF
RDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVNQSEEPDYETYLHRIGRTGRFGKKGLAFNMI
EVDKLPLLMKIQDHFNSSIKQLDPEDMDEIEKIEY

hide sequence

Ensembl Acc Id:

ENSRNOP00000017307 ⟸ ENSRNOT00000017307

RefSeq Acc Id:	XP_038937964 ⟸ XM_039082036
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6GG37 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038937962 ⟸ XM_039082034
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6GG37 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038937963 ⟸ XM_039082035
- Peptide Label:	isoform X2
- UniProtKB:	A6JYK8 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000088320 ⟸ ENSRNOT00000096268

RefSeq Acc Id:	XP_063122118 ⟸ XM_063266048
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6GG37 (UniProtKB/TrEMBL)

Protein Domains

DEAD-box RNA helicase Q Helicase ATP-binding Helicase C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QY16-F1-model_v2	AlphaFold	Q9QY16	1-483	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695839

Promoter ID:

EPDNEW_R6364

Type:

multiple initiation site

Name:

Ddx25_1

Description:

DEAD-box helicase 25

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	36,760,708 - 36,760,768	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68381	AgrOrtholog
BioCyc Gene	G2FUF-31167	BioCyc
Ensembl Genes	ENSRNOG00000012260	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000017307	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
	6.10.250.2170	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7112991	IMAGE-MGC_LOAD
InterPro	DEAD/DEAH_box_helicase_dom	UniProtKB/Swiss-Prot
	Helicase_ATP-bd	UniProtKB/Swiss-Prot
	Helicase_C	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
	RNA_helicase_DEAD_Q_motif	UniProtKB/Swiss-Prot
KEGG Report	rno:58856	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93350	IMAGE-MGC_LOAD
NCBI Gene	58856	ENTREZGENE
PANTHER	ATP-DEPENDENT RNA HELICASE DBP3	UniProtKB/Swiss-Prot
Pfam	DEAD	UniProtKB/Swiss-Prot
	Helicase_C	UniProtKB/Swiss-Prot
PhenoGen	Ddx25	PhenoGen
PROSITE	HELICASE_ATP_BIND_1	UniProtKB/Swiss-Prot
	HELICASE_CTER	UniProtKB/Swiss-Prot
	Q_MOTIF	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000012260	RatGTEx
SMART	DEXDc	UniProtKB/Swiss-Prot
	HELICc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
TIGR	TC233449
UniProt	A0A8I6GG37	ENTREZGENE, UniProtKB/TrEMBL
	A6JYK6	ENTREZGENE, UniProtKB/TrEMBL
	A6JYK7_RAT	UniProtKB/TrEMBL
	A6JYK8	ENTREZGENE, UniProtKB/TrEMBL
	DDX25_RAT	UniProtKB/Swiss-Prot
	F7ER47	ENTREZGENE, UniProtKB/TrEMBL
	Q68G14	ENTREZGENE
	Q9QY16	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-13	Ddx25	DEAD-box helicase 25	Ddx25	DEAD (Asp-Glu-Ala-Asp) box helicase 25	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-16	Ddx25	DEAD (Asp-Glu-Ala-Asp) box helicase 25	Ddx25	DEAD (Asp-Glu-Ala-Asp) box polypeptide 25	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Ddx25	DEAD (Asp-Glu-Ala-Asp) box polypeptide 25		DEAD (aspartate-glutamate-alanine-aspartate) box polypeptide 25	Name updated	1299863	APPROVED
2002-06-10	Ddx25	DEAD (aspartate-glutamate-alanine-aspartate) box polypeptide 25			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	enriched in testes, weakly expressed in the pituitary and hypothalamus; produced in both somatic (Leydig cells) and germinal (meiotic spermatocytes and round haploid spermatids) cells	68232
gene_product	member of the DEAD-box protein family	68232
gene_regulation	induced by chorionic gonadotropin via cyclic AMP-induced androgen formation in the Leydig cells; developmentally regulated	68232

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar