Advanced Search (OLGA)

Gene: Thop1 (thimet oligopeptidase 1) Rattus norvegicus

Analyze

Symbol:

Thop1

Name:

thimet oligopeptidase 1

RGD ID:

68330

Description:

Enables peptidase activity and peptide binding activity. Involved in peptide catabolic process. Predicted to be located in cytoplasm. Predicted to be active in mitochondrial intermembrane space. Orthologous to human THOP1 (thimet oligopeptidase 1); PARTICIPATES IN renin-angiotensin cascade pathway; sleeping sickness pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

endo-oligopeptidase A; endopeptidase 24.15; EP24.15; metalloendopeptidase; MGC93105; PZ-peptidase; soluble metallo-endopeptidase; Thimet oligopeptidase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	THOP1 (thimet oligopeptidase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Thop1 (thimet oligopeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Thop1 (thimet oligopeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	THOP1 (thimet oligopeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	THOP1 (thimet oligopeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Thop1 (thimet oligopeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	THOP1 (thimet oligopeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	THOP1 (thimet oligopeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Thop1 (thimet oligopeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Thop1 (thimet oligopeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GRM5 (glutamate metabotropic receptor 5)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	THOP1 (thimet oligopeptidase 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Thop1 (thimet oligopeptidase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	thop1 (thimet oligopeptidase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PRD1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PRD1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ZK550.3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ZK550.3	Alliance	DIOPT (InParanoid\|OMA\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	thop1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	thop1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	9,283,617 - 9,295,957 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	9,283,617 - 9,295,957 (-)	Ensembl				GRCr8
mRatBN7.2	7	8,632,911 - 8,645,339 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	8,632,916 - 8,645,275 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	11,517,596 - 11,530,108 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	13,393,093 - 13,405,605 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	11,259,596 - 11,272,104 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	11,501,145 - 11,513,576 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	11,501,146 - 11,513,581 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	11,668,512 - 11,680,946 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	10,116,822 - 10,129,162 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	6,820,402 - 6,832,744 (-)	NCBI		Celera
RGSC_v3.1	7	10,116,821 - 10,129,088 (-)	NCBI
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2,5-hexanedione (EXP)

2,6-dinitrotoluene (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-amino-2,6-dinitrotoluene (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

Benzo[k]fluoranthene (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

bleomycin A2 (ISO)

Brodifacoum (EXP)

Butylbenzyl phthalate (ISO)

capsaicin (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chromium(6+) (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

cocaine (EXP)

copper atom (ISO)

copper(0) (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

fenvalerate (EXP)

flutamide (EXP)

folic acid (ISO)

hydrogen cyanide (ISO)

indole-3-methanol (EXP)

indometacin (ISO)

ivermectin (ISO)

lead(0) (ISO)

lovastatin (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

N-nitrosodiethylamine (EXP)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

potassium cyanide (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trimellitic anhydride (ISO)

tunicamycin (ISO)

valproic acid (ISO)

warfarin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intracellular signal transduction (ISO)

peptide catabolic process (IDA,IEA)

peptide metabolic process (ISO)

proteolysis (IEA,TAS)

Cellular Component

cytoplasm (IEA)

cytosol (ISO)

mitochondrial intermembrane space (IBA)

Molecular Function

hydrolase activity (IEA)

metal ion binding (IEA)

metalloendopeptidase activity (IBA,IEA,ISO,TAS)

metallopeptidase activity (IEA)

peptidase activity (IDA,IEA)

peptide binding (IDA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

renin-angiotensin cascade pathway (IEA)

sleeping sickness pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Expression of the thimet oligopeptidase gene is regulated by positively and negatively acting elements.	McCool S and Pierotti AR, DNA Cell Biol 2000 Dec;19(12):729-38.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Thimet oligopeptidase expression is differentially regulated in neuroendocrine and spermatid cell lines by transcription factor binding to SRY (sex-determining region Y), CAAT and CREB (cAMP-response-element-binding protein) promoter consensus sequences.	Morrison LS and Pierotti AR, Biochem J 2003 Nov 15;376(Pt 1):189-97.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Metalloendopeptidases EC 3.4.24.15/16 regulate bradykinin activity in the cerebral microvasculature.	Norman MU, etal., Am J Physiol Heart Circ Physiol 2003 Jun;284(6):H1942-8. Epub 2003 Feb 13.
8.	Molecular cloning and primary structure of rat testes metalloendopeptidase EC 3.4.24.15.	Pierotti A, etal., Biochemistry 1990 Nov 13;29(45):10323-9.
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	Mapping sequence differences between thimet oligopeptidase and neurolysin implicates key residues in substrate recognition.	Ray K, etal., Protein Sci 2002 Sep;11(9):2237-46.
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Novel natural peptide substrates for endopeptidase 24.15, neurolysin, and angiotensin-converting enzyme.	Rioli V, etal., J Biol Chem. 2003 Mar 7;278(10):8547-55. doi: 10.1074/jbc.M212030200. Epub 2002 Dec 24.
15.	Natural intracellular peptides can modulate the interactions of mouse brain proteins and thimet oligopeptidase with 14-3-3epsilon and calmodulin.	Russo LC, etal., Proteomics. 2012 Aug;12(17):2641-55. doi: 10.1002/pmic.201200032. Epub 2012 Jul 26.
16.	Rat brain contains high levels of mannose-6-phosphorylated glycoproteins including lysosomal enzymes and palmitoyl-protein thioesterase, an enzyme implicated in infantile neuronal lipofuscinosis.	Sleat DE, etal., J Biol Chem. 1996 Aug 9;271(32):19191-8.
17.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
18.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:8216239	PMID:10969067	PMID:15955058	PMID:15985312	PMID:16515556	PMID:18571100	PMID:22082260	PMID:22387539	PMID:24041943	PMID:26653570

Genomics

Comparative Map Data

Thop1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	9,283,617 - 9,295,957 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	9,283,617 - 9,295,957 (-)	Ensembl				GRCr8
mRatBN7.2	7	8,632,911 - 8,645,339 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	8,632,916 - 8,645,275 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	11,517,596 - 11,530,108 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	13,393,093 - 13,405,605 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	11,259,596 - 11,272,104 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	11,501,145 - 11,513,576 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	11,501,146 - 11,513,581 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	11,668,512 - 11,680,946 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	10,116,822 - 10,129,162 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	6,820,402 - 6,832,744 (-)	NCBI		Celera
RGSC_v3.1	7	10,116,821 - 10,129,088 (-)	NCBI
Cytogenetic Map	7	q11	NCBI

THOP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	2,785,503 - 2,815,807 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	2,785,494 - 2,815,807 (+)	Ensembl			hg38	GRCh38
GRCh37	19	2,785,501 - 2,815,805 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	2,736,506 - 2,764,599 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	2,736,505 - 2,764,598	NCBI
Celera	19	2,721,390 - 2,749,643 (+)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	2,554,996 - 2,583,295 (+)	NCBI		HuRef
CHM1_1	19	2,785,096 - 2,813,188 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	2,760,790 - 2,791,094 (+)	NCBI		T2T-CHM13v2.0

Thop1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	80,905,917 - 80,918,194 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	80,905,869 - 80,918,393 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	81,070,083 - 81,082,360 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	81,070,035 - 81,082,559 (+)	Ensembl			mm10	GRCm38
MGSCv37	10	80,532,828 - 80,545,105 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	80,473,279 - 80,485,687 (+)	NCBI		MGSCv36	mm8
Celera	10	82,090,182 - 82,102,459 (+)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

Thop1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	5,054,986 - 5,071,279 (+)	Ensembl
ChiLan1.0	NW_004955495	5,055,389 - 5,070,710 (+)	NCBI	ChiLan1.0	ChiLan1.0

THOP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	7,179,830 - 7,209,333 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	6,412,831 - 6,442,294 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	1,810,316 - 1,839,523 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	2,765,550 - 2,793,235 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	2,765,550 - 2,793,235 (+)	Ensembl			panPan2	panpan1.1

THOP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	56,412,578 - 56,432,480 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	56,412,908 - 56,432,446 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	56,208,964 - 56,228,856 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	57,146,032 - 57,165,932 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	57,146,042 - 57,165,951 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	56,199,077 - 56,218,944 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	56,683,949 - 56,703,847 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	56,884,291 - 56,904,201 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Thop1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	216,196,995 - 216,216,192 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	1,618,541 - 1,637,821 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936588	1,618,585 - 1,637,788 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

THOP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	75,853,429 - 75,877,494 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	75,857,788 - 75,877,430 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	76,370,019 - 76,389,661 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

THOP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	2,564,445 - 2,590,029 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666081	6,013,877 - 6,039,353 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Thop1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	5,857,846 - 5,873,462 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624828	5,857,667 - 5,873,055 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Thop1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	153,807,071 - 153,819,320 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Thop1
50 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	53
Count of miRNA genes:	49
Interacting mature miRNAs:	51
Transcripts:	ENSRNOT00000027045
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1669658	46669658	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	1	23748937	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	7216097	52216097	Rat
2290372	Gluco33	Glucose level QTL 33	2.71		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	1	31777942	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1709527	46709527	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	32612984	Rat
1582260	Bw72	Body weight QTL 72	3.2	0.0043	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
1582261	Bw69	Body weight QTL 69	3.2	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
1582262	Bw75	Body weight QTL 75	3	0.0038	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	29716167	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34650782	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	32612984	Rat

Markers in Region

D7Wox43

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	8,645,666 - 8,645,826 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	11,513,899 - 11,514,058	NCBI	Rnor6.0
Rnor_5.0	7	11,681,263 - 11,681,422	UniSTS	Rnor5.0
RGSC_v3.4	7	10,129,572 - 10,129,731	UniSTS	RGSC3.4
Celera	7	6,833,154 - 6,833,313	UniSTS
Cytogenetic Map	7	q11	UniSTS

UniSTS:236402

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	8,642,216 - 8,642,299 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	11,510,451 - 11,510,533	NCBI	Rnor6.0
Rnor_5.0	7	11,677,815 - 11,677,897	UniSTS	Rnor5.0
RGSC_v3.4	7	10,126,124 - 10,126,206	UniSTS	RGSC3.4
Celera	7	6,829,706 - 6,829,788	UniSTS
Cytogenetic Map	7	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	160	91	90	59	92	59	6	356	192	11	139	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_172075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC103000	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ000066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC081706	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB780843	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M61142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027045 ⟹ ENSRNOP00000027045

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	9,283,617 - 9,295,957 (-)	Ensembl
mRatBN7.2 Ensembl	7	8,632,916 - 8,645,275 (-)	Ensembl
Rnor_6.0 Ensembl	7	11,501,146 - 11,513,581 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000082486 ⟹ ENSRNOP00000075551

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	8,632,916 - 8,645,275 (-)	Ensembl
Rnor_6.0 Ensembl	7	11,501,149 - 11,513,415 (-)	Ensembl

RefSeq Acc Id:

NM_172075 ⟹ NP_742072

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	9,283,617 - 9,295,957 (-)	NCBI
mRatBN7.2	7	8,632,915 - 8,645,257 (-)	NCBI
Rnor_6.0	7	11,501,149 - 11,513,489 (-)	NCBI
Rnor_5.0	7	11,668,512 - 11,680,946 (-)	NCBI
RGSC_v3.4	7	10,116,822 - 10,129,162 (-)	RGD
Celera	7	6,820,402 - 6,832,744 (-)	RGD

Sequence:

show sequence

GGGCGGCAGGCGCCTCAGTCTGAGAGCCGCTGCGGAGGAACCGACTGAGGTGAAGCGAGCTCCC
AAGGAGACCCGGACCGCACAGGCGTGAGGACCAGAGGAGGGCGTGCCCGTCCCGCGCGCAGCCT
GCCGCCATGAAGCCCCCCGCAGCCTGTGCTGGGGACGTGGTGGATACAGTGTCACCATGCTCCA
CCGTGAATCATCTGCGCTGGGACCTGAGCGCACAGCAGATCAGAGCTCTAACCACACAGCTCAT
CGAGCAGACCAAGTGTGTGTACGACCGTGTGGGCGCCCAGGACTTCGAGGACGTGTCCTATGAG
AGCACACTGAAGGCACTGGCTGACGTGGAGGTCACCTACACAGTGCAGAGGAACATTCTCGACT
TCCCCCAGCACGTGTCTCCGAACAAGGACATCCGCGCAGCCAGCACAGAGGCTGACAAGAAGCT
CTCAGAGTTTGATGTGGAGATGAGCATGAGGCAGGACGTGTACCAGAGGGTCGTGTGGCTGCAG
GAGAAAATCCCGAAAGACTCACTGAAGCCTGAGGCAGCTCGCTACCTGGAGCGGCTCATCAAGC
TGGGCCGGAGAAACGGGCTCCACTTACCTCAGGACACACAGGAGAAGATCAAGAACATCAAGAA
GAGGCTGAGCCTGCTGTGCATCGACTTCAACAAGAACCTGAATGAGGACACCACCTTCCTGCCC
TTCACGAGAGAGGAGCTGGGCGGGCTCCCCGAGGACTTCCTGAACTCCCTGGAGAAGACAGAGG
ACGGCAAACTGAAGGTCACCCTCAAGTATCCACACTATTTCCCACTGCTGAAGAAGTGCCACGT
GCCCGAGACACGACGCCTGTTGGAGGAGGCCTTCAACTGTCGCTGCAAGGAGGAGAACTGTGCC
ATCCTGAAGGAGCTAGTGTCCCTGCGGGCGCAGAAGTCCAACCTGCTGGGATTCCGCACACACG
CAGACTACGTCCTGGAGATGAACATGGCCAAGACCAGTCAGACAGTAGCCACCTTCCTAGATGA
ACTGGCCCGGAAGCTGAAGCCGCTGGGTGAGCAGGAGCGTGCGGTGATCCTGGAGCTGAAGGAG
GCAGAGTGCGCCAAGCGCGGGCTCCCATTCGATGGGCGCATCCACGCATGGGACATGCGGTACT
ACATGAACCAGGTGGAGGAGACACGCTACCGCGTAGACCAGAACCTGCTGAAGGAGTACTTCCC
CATGCAGGTGGTCACGCGTGGGCTGCTGGCCATCTACCAAGAGCTGCTGGGGCTGACCTTCACG
CTGGAGGAAGGTGCCGCCGCCTGGCACGAAGACGTGCGGCTGTACTCTGTGCGTGACGCCGCCT
CTGGAGAGGAGATTGGCAAGTTCTACCTCGACCTGTACCCCAGGGAAGGGAAGTATGGCCACGC
GGCCTGCTTCGGCCTGCAGCCTGGCTGCCTACGGCAGGATGGCAGCCGACAGCTGGCCATCGCA
GCCATGGTGGCCAATTTCACCAAGCCCACACCTGACGTGCCTTCCCTGCTGCAGCACGATGAGG
TGGAGACCTACTTCCACGAGTTCGGGCACGTCATGCACCAGCTCTGCTCACAGGCAGAGTTTGC
TATGTTCAGTGGGACCCACGTGGAGCGGGACTTTGTGGAGGCACCGTCACAGATGCTGGAGAAC
TGGGTGTGGGAAAAGGAGCCACTGATGCGCATGTCCCAGCATTACCGCACAGGAGGCGAGGCCC
CTGAGGACCTCCTGGAGAAGCTCATCAAGTCTCGCCAGGCCAATGCAGGTCTCTTCAACCTTCG
GCAGATTGTCCTTGCCAAGGTAGATCAGGTCCTGCACACACAGACAGATGTAGACCCAGCTGAG
GAATATGCCCGGCTCTGCCAGGAGATCCTTGGGGTGCCAGCCACACCAGGTACCAACATGCCAG
CCACTTTTGGCCACCTCGCTGGTGGCTACGACGCTCAGTACTATGGCTACTTGTGGAGTGAGGT
GTACTCCATGGACATGTTCCACACACGCTTCAAGCAGGAGGGTGTGCTTAGCCCCAAGGTTGGC
ATGGATTACCGGACCAGCATCCTGAGGCCGGGGGGCTCTGAGGATGCCAGCACCATGCTGAAGC
AGTTCCTGGGCCGTGACCCCAAGCAAGACGCCTTCCTCCTGAGCAAGGGTCTGCAGGTAGAGGG
CTGCGAGCCACCTGCGTGCTGAGCGGTCCCCAGCTCGCCCTCCTGTGCCTTAGCCTGCCGGGCG
GCAAGGTCAGCAGCCCTTGGGCGTACGGATGAGCCTGGGGCAGTTTCCATCCTCGTCCTCCCCC
CAGCTCCAGGTCCCCGGCTTCAGGCTGCTGTGCTCTCCTTGCACTATCCCCTCCCCAAACTGAT
GTTGGACATTAAATTTCACACAGGGGAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_742072	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41586	(Get FASTA)	NCBI Sequence Viewer
	AAH81706	(Get FASTA)	NCBI Sequence Viewer
	EDL89199	(Get FASTA)	NCBI Sequence Viewer
	EDL89200	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027045
	ENSRNOP00000027045.5
GenBank Protein	P24155	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_742072 ⟸ NM_172075

- UniProtKB:

Q66HS4 (UniProtKB/Swiss-Prot), P24155 (UniProtKB/Swiss-Prot), A6K8C9 (UniProtKB/TrEMBL), A0A0G2KAW4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKPPAACAGDVVDTVSPCSTVNHLRWDLSAQQIRALTTQLIEQTKCVYDRVGAQDFEDVSYEST
LKALADVEVTYTVQRNILDFPQHVSPNKDIRAASTEADKKLSEFDVEMSMRQDVYQRVVWLQEK
IPKDSLKPEAARYLERLIKLGRRNGLHLPQDTQEKIKNIKKRLSLLCIDFNKNLNEDTTFLPFT
REELGGLPEDFLNSLEKTEDGKLKVTLKYPHYFPLLKKCHVPETRRLLEEAFNCRCKEENCAIL
KELVSLRAQKSNLLGFRTHADYVLEMNMAKTSQTVATFLDELARKLKPLGEQERAVILELKEAE
CAKRGLPFDGRIHAWDMRYYMNQVEETRYRVDQNLLKEYFPMQVVTRGLLAIYQELLGLTFTLE
EGAAAWHEDVRLYSVRDAASGEEIGKFYLDLYPREGKYGHAACFGLQPGCLRQDGSRQLAIAAM
VANFTKPTPDVPSLLQHDEVETYFHEFGHVMHQLCSQAEFAMFSGTHVERDFVEAPSQMLENWV
WEKEPLMRMSQHYRTGGEAPEDLLEKLIKSRQANAGLFNLRQIVLAKVDQVLHTQTDVDPAEEY
ARLCQEILGVPATPGTNMPATFGHLAGGYDAQYYGYLWSEVYSMDMFHTRFKQEGVLSPKVGMD
YRTSILRPGGSEDASTMLKQFLGRDPKQDAFLLSKGLQVEGCEPPAC

hide sequence

Ensembl Acc Id:

ENSRNOP00000075551 ⟸ ENSRNOT00000082486

Ensembl Acc Id:

ENSRNOP00000027045 ⟸ ENSRNOT00000027045

Protein Domains

Peptidase M3A/M3B catalytic

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P24155-F1-model_v2	AlphaFold	P24155	1-687	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694996

Promoter ID:

EPDNEW_R5516

Type:

multiple initiation site

Name:

Thop1_1

Description:

thimet oligopeptidase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	11,513,510 - 11,513,570	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68330	AgrOrtholog
BioCyc Gene	G2FUF-34992	BioCyc
Ensembl Genes	ENSRNOG00000019924	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000027045	ENTREZGENE
	ENSRNOT00000027045.7	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.1370.10	UniProtKB/Swiss-Prot
	3.40.390.10	UniProtKB/Swiss-Prot
	Endopeptidase. Chain P, domain 1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7111806	IMAGE-MGC_LOAD
InterPro	MetalloPept_cat_dom_sf	UniProtKB/Swiss-Prot
	Neurolysin/TOP_dom2	UniProtKB/Swiss-Prot
	Neurolysin/TOP_N	UniProtKB/Swiss-Prot
	Pept_M3A_M3B	UniProtKB/Swiss-Prot
	Pept_M3A_M3B	UniProtKB/Swiss-Prot
KEGG Report	rno:64517	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93105	IMAGE-MGC_LOAD
NCBI Gene	64517	ENTREZGENE
PANTHER	PTHR11804	UniProtKB/Swiss-Prot
	THIMET OLIGOPEPTIDASE	UniProtKB/Swiss-Prot
Pfam	Peptidase_M3	UniProtKB/Swiss-Prot
PhenoGen	Thop1	PhenoGen
PROSITE	ZINC_PROTEASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000019924	RatGTEx
Superfamily-SCOP	Metalloproteases ('zincins'), catalytic domain	UniProtKB/Swiss-Prot
TIGR	TC229917
UniProt	A0A0G2KAW4	ENTREZGENE
	A6K8C9	ENTREZGENE, UniProtKB/TrEMBL
	A6K8D0_RAT	UniProtKB/TrEMBL
	P24155	ENTREZGENE
	Q66HS4	ENTREZGENE
	THOP1_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q66HS4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Thop1	thimet oligopeptidase 1			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	highest enzyme activity is detected in testis, also expressed in brain and pituitary	730190
gene_process	involved in the degradation of Bradykinin, a vasoactive peptide	1299146

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)