Advanced Search (OLGA)

Gene: Msi1 (musashi RNA-binding protein 1) Rattus norvegicus

Analyze

Symbol:

Msi1

Name:

musashi RNA-binding protein 1

RGD ID:

628778

Description:

Predicted to enable RNA binding activity; molecular condensate scaffold activity; and protein homodimerization activity. Involved in epithelial cell differentiation and response to hormone. Predicted to be located in nucleus. Predicted to be active in cytoplasm. Biomarker of brain infarction and brain ischemia. Orthologous to human MSI1 (musashi RNA binding protein 1); PARTICIPATES IN mRNA decay pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Msi1h; Musashi homolog 1(Drosophila); musashi-1; RNA-binding protein Musashi homolog 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MSI1 (musashi RNA binding protein 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Treefam
Mus musculus (house mouse):	Msi1 (musashi RNA-binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Msi1 (musashi RNA binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MSI1 (musashi RNA binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MSI1 (musashi RNA binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Msi1 (musashi RNA binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MSI1 (musashi RNA binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MSI1 (musashi RNA binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Msi1 (musashi RNA binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Msi1 (musashi RNA binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MSI2 (musashi RNA binding protein 2)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	MSI1 (musashi RNA binding protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Msi1 (musashi RNA-binding protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	msi1 (musashi RNA-binding protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	msi1 (musashi RNA-binding protein 1)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	HRP1	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rbp6	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rbp6	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	msi-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	msi-1	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	msi1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	46,815,225 - 46,911,852 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	46,819,039 - 46,845,425 (-)	Ensembl				GRCr8
mRatBN7.2	12	41,158,301 - 41,251,134 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	41,158,599 - 41,191,076 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	42,329,615 - 42,351,639 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	42,943,282 - 42,965,305 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	42,003,827 - 42,025,850 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	46,899,835 - 46,935,335 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	46,895,447 - 46,920,952 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	48,696,700 - 48,731,989 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	42,425,957 - 42,462,517 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	42,786,001 - 42,821,164 (-)	NCBI		Celera
RGSC_v3.1	12	42,289,344 - 42,310,487 (-)	NCBI
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

brain infarction (IEP)

brain ischemia (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3,3',5-triiodo-L-thyronine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

calcitriol (ISO)

choline (ISO)

cisplatin (ISO)

D-glucose (ISO)

diarsenic trioxide (ISO)

doxorubicin (ISO)

eckol (ISO)

ethanol (ISO)

folic acid (ISO)

FR900359 (ISO)

fulvestrant (ISO)

genistein (ISO)

gentamycin (EXP)

glucose (ISO)

L-methionine (ISO)

lead(0) (ISO)

lithium chloride (ISO)

Moniliformin (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N,N-diethyl-m-toluamide (EXP)

paracetamol (EXP,ISO)

perfluorooctanoic acid (EXP)

permethrin (EXP)

poly(I:C) (ISO)

pyriproxyfen (ISO)

resveratrol (ISO)

rotenone (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

tamibarotene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

central nervous system development (IBA)

epithelial cell differentiation (IEP)

regulation of translation (IBA)

response to hormone (IMP)

Cellular Component

cytoplasm (IBA,IEA,ISO)

nucleus (IEA,ISO)

Molecular Function

identical protein binding (IEA,ISO)

molecular condensate scaffold activity (IEA,ISO)

mRNA binding (IBA)

nucleic acid binding (IEA)

poly(U) RNA binding (IEA,ISO)

protein binding (ISO)

protein homodimerization activity (IEA,ISO)

RNA binding (IEA,NAS)

single-stranded RNA binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

mRNA decay pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Regulation of tau RNA maturation by thyroid hormone is mediated by the neural RNA-binding protein musashi-1.	Cuadrado A, etal., Mol Cell Neurosci. 2002 Jun;20(2):198-210.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Expression of Musashi-1 in the rat stomach and changes during mucosal injury and restitution.	Nagata H, etal., FEBS Lett. 2006 Jan 9;580(1):27-33. Epub 2005 Dec 6.
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Differential expression of Musashi1 and nestin in the adult rat hippocampus after ischemia.	Yagita Y, etal., J Neurosci Res 2002 Sep 15;69(6):750-6.
10.	Proliferation and differentiation of neural stem cells in adult rats after cerebral infarction.	Zhang B, etal., Chin Med Sci J. 2004 Jun;19(2):73-7.

Additional References at PubMed

PMID:11588182	PMID:15076722	PMID:22681889	PMID:23236886	PMID:23374535	PMID:25888190	PMID:26197342	PMID:30367664	PMID:33810326	PMID:33843023

Genomics

Comparative Map Data

Msi1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	46,815,225 - 46,911,852 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	46,819,039 - 46,845,425 (-)	Ensembl				GRCr8
mRatBN7.2	12	41,158,301 - 41,251,134 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	41,158,599 - 41,191,076 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	42,329,615 - 42,351,639 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	42,943,282 - 42,965,305 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	42,003,827 - 42,025,850 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	46,899,835 - 46,935,335 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	46,895,447 - 46,920,952 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	48,696,700 - 48,731,989 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	42,425,957 - 42,462,517 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	42,786,001 - 42,821,164 (-)	NCBI		Celera
RGSC_v3.1	12	42,289,344 - 42,310,487 (-)	NCBI
Cytogenetic Map	12	q16	NCBI

MSI1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	120,339,662 - 120,369,164 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	120,341,329 - 120,369,437 (-)	Ensembl			hg38	GRCh38
GRCh37	12	120,779,133 - 120,806,967 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	119,263,516 - 119,291,341 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	119,241,852 - 119,269,678	NCBI
Celera	12	120,412,237 - 120,440,052 (-)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	117,787,331 - 117,814,272 (-)	NCBI		HuRef
CHM1_1	12	120,747,072 - 120,774,927 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	120,326,839 - 120,356,341 (-)	NCBI		T2T-CHM13v2.0

Msi1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	115,567,734 - 115,593,757 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	115,567,658 - 115,593,757 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	115,359,059 - 115,455,698 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	115,429,599 - 115,455,698 (+)	Ensembl			mm10	GRCm38
MGSCv37	5	115,879,694 - 115,904,211 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	115,690,684 - 115,715,201 (+)	NCBI		MGSCv36	mm8
Celera	5	112,528,152 - 112,553,235 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	56.09	NCBI

Msi1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	11,268,650 - 11,298,378 (+)	Ensembl
ChiLan1.0	NW_004955455	11,269,486 - 11,298,342 (+)	NCBI	ChiLan1.0	ChiLan1.0

MSI1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	128,402,554 - 128,430,509 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	128,398,931 - 128,426,786 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	117,915,879 - 117,943,772 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	121,289,281 - 121,316,276 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	121,289,281 - 121,316,276 (-)	Ensembl			panPan2	panpan1.1

MSI1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	16,266,302 - 16,288,980 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	16,266,586 - 16,289,012 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	16,270,168 - 16,292,838 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	16,533,308 - 16,556,005 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	16,533,366 - 16,555,993 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	16,494,719 - 16,517,389 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	16,571,374 - 16,594,034 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	16,614,085 - 16,635,848 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Msi1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	146,074,570 - 146,097,615 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936668	573,453 - 596,696 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936668	573,459 - 595,278 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MSI1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	40,331,377 - 40,356,788 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	40,331,371 - 40,356,793 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	42,789,298 - 42,812,679 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MSI1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	115,691,313 - 115,719,268 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	129,383,701 - 129,411,767 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Msi1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	13,291,071 - 13,316,532 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624747	13,290,999 - 13,316,410 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Msi1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	38,370,700 - 38,397,229 (-)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	60
Count of miRNA genes:	55
Interacting mature miRNAs:	58
Transcripts:	ENSRNOT00000001532
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	37764145	51558799	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	33700432	51558799	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	44139558	52308831	Rat

Markers in Region

AW533646

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	41,191,132 - 41,191,293 (+)	MAPPER	mRatBN7.2
mRatBN7.2	12	41,191,132 - 41,191,684 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	46,927,866 - 46,928,417	NCBI	Rnor6.0
Rnor_6.0	12	46,927,866 - 46,928,026	NCBI	Rnor6.0
Rnor_5.0	12	48,724,520 - 48,725,071	UniSTS	Rnor5.0
Rnor_5.0	12	48,724,520 - 48,724,680	UniSTS	Rnor5.0
RGSC_v3.4	12	42,455,048 - 42,455,208	UniSTS	RGSC3.4
RGSC_v3.4	12	42,455,048 - 42,455,599	UniSTS	RGSC3.4
Celera	12	42,813,849 - 42,814,400	UniSTS
Celera	12	42,813,849 - 42,814,009	UniSTS
RH 3.4 Map	12	772.12	UniSTS
Cytogenetic Map	12	q16	UniSTS

RH134213

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	41,190,227 - 41,190,408 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	46,926,961 - 46,927,141	NCBI	Rnor6.0
Rnor_5.0	12	48,723,615 - 48,723,795	UniSTS	Rnor5.0
RGSC_v3.4	12	42,454,143 - 42,454,323	UniSTS	RGSC3.4
Celera	12	42,812,944 - 42,813,124	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	161	90	89	58	34	58	6	295	134	11	140	79	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_148890	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089123	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089124	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089125	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271088	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271091	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010056363	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010056364	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY043393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001532 ⟹ ENSRNOP00000001532

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	46,819,039 - 46,845,425 (-)	Ensembl
mRatBN7.2 Ensembl	12	41,158,599 - 41,191,076 (-)	Ensembl
Rnor_6.0 Ensembl	12	46,895,447 - 46,920,952 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117406 ⟹ ENSRNOP00000084373

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	46,819,039 - 46,845,425 (-)	Ensembl
mRatBN7.2 Ensembl	12	41,158,599 - 41,191,076 (-)	Ensembl

RefSeq Acc Id:

NM_148890 ⟹ NP_683688

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,819,039 - 46,845,425 (-)	NCBI
mRatBN7.2	12	41,158,301 - 41,184,690 (-)	NCBI
Rnor_6.0	12	46,899,835 - 46,935,335 (-)	NCBI
Rnor_5.0	12	48,696,700 - 48,731,989 (-)	NCBI
RGSC_v3.4	12	42,425,957 - 42,462,517 (-)	RGD
Celera	12	42,786,001 - 42,821,164 (-)	RGD

Sequence:

show sequence

ATGGAGACTGACGCGCCCCAGCCCGGCCTCGCCTCCCCGGACTCGCCGCACGACCCCTGCAAGA
TGTTCATCGGAGGACTCAGTTGGCAGACCACGCAGGAAGGGCTGCGCGAATACTTCGGCCAGTT
CGGGGAGGTGAAAGAGTGTCTGGTGATGCGGGACCCCCTGACCAAAAGATCCAGGGGTTTCGGC
TTCGTCACTTTCATGGACCAGGCGGGGGTGGATAAAGTGCTGGCGCAATCTCGGCACGAGCTCG
ACTCCAAAACAATTGACCCCAAGGTGGCCTTTCCTCGGAGAGCACAGCCTAAGATGGTCACTCG
AACTAAGAAGATCTTTGTGGGGGGGCTGTCTGTGAACACCACGGTGGAGGACGTGAAGCACTAT
TTTGAGCAGTTCGGAAAGGTGGATGATGCCATGCTGATGTTCGACAAAACCACCAACAGGCACA
GAGGGTTCGGGTTTGTCACGTTCGAGAGTGAGGACATCGTAGAGAAAGTGTGTGAGATCCACTT
CCATGAAATCAACAACAAAATGGTGGAATGCAAGAAAGCTCAGCCAAAGGAGGTGATGTCCCCG
ACAGGCTCAGCCCGGGGCCGGTCTCGAGTCATGCCCTACGGGATGGACGCCTTCATGCTGGGTA
TTGGCATGTTAGGTTACCCAGGGTTCCAAGCCACGACCTACGCCAGCCGGAGTTACACAGGCCT
TGCCCCTGGTTACACCTACCAGTTCCCCGAATTCCGTGTAGAGCGGACCCCTCTCCCGAGCGCC
CCAGTCCTCCCCGAGCTTACAGCCATCCCTCTCACTGCTTATGGTCCGATGGCAGCGGCGGCGG
CAGCGGCGGCTGTAGTCCGAGGGACAGGCTCTCACCCCTGGACGATGGCTCCCCCTCCAGGTTC
TACTCCCAGCCGCACAGGGGGCTTCCTGGGGACCACAAGCCCCGGCCCCATGGCTGAGCTCTAT
GGGGCAGCCAACCAGGACTCGGGGGTCAGCAGTTACATCAGCGCCGCCAGCCCCGCCCCCAGCA
CTGGTTTTGGCCACAGTCTTGGGGGTCCCTTGATTGCGACAGCCTTCACCAATGGGTACCACTG
A

hide sequence

RefSeq Acc Id:

XM_039089120 ⟹ XP_038945048

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,819,039 - 46,845,436 (-)	NCBI
mRatBN7.2	12	41,158,301 - 41,184,704 (-)	NCBI

RefSeq Acc Id:

XM_039089121 ⟹ XP_038945049

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,819,039 - 46,845,436 (-)	NCBI
mRatBN7.2	12	41,158,301 - 41,184,704 (-)	NCBI

RefSeq Acc Id:

XM_039089122 ⟹ XP_038945050

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,819,039 - 46,845,436 (-)	NCBI
mRatBN7.2	12	41,158,301 - 41,184,704 (-)	NCBI

RefSeq Acc Id:

XM_039089123 ⟹ XP_038945051

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,819,039 - 46,842,452 (-)	NCBI
mRatBN7.2	12	41,158,301 - 41,181,749 (-)	NCBI

RefSeq Acc Id:

XM_039089124 ⟹ XP_038945052

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,819,039 - 46,839,664 (-)	NCBI
mRatBN7.2	12	41,158,301 - 41,178,582 (-)	NCBI

RefSeq Acc Id:

XM_039089125 ⟹ XP_038945053

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,819,039 - 46,911,852 (-)	NCBI
mRatBN7.2	12	41,158,301 - 41,251,134 (-)	NCBI

RefSeq Acc Id:

XM_063271088 ⟹ XP_063127158

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,815,225 - 46,845,436 (-)	NCBI

RefSeq Acc Id:

XM_063271090 ⟹ XP_063127160

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,819,039 - 46,839,669 (-)	NCBI

RefSeq Acc Id:

XM_063271091 ⟹ XP_063127161

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,819,039 - 46,839,673 (-)	NCBI

RefSeq Acc Id:

XR_010056363

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,815,225 - 46,845,436 (-)	NCBI

RefSeq Acc Id:

XR_010056364

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,815,225 - 46,845,436 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_683688	(Get FASTA)	NCBI Sequence Viewer
	XP_038945048	(Get FASTA)	NCBI Sequence Viewer
	XP_038945049	(Get FASTA)	NCBI Sequence Viewer
	XP_038945050	(Get FASTA)	NCBI Sequence Viewer
	XP_038945051	(Get FASTA)	NCBI Sequence Viewer
	XP_038945052	(Get FASTA)	NCBI Sequence Viewer
	XP_038945053	(Get FASTA)	NCBI Sequence Viewer
	XP_063127158	(Get FASTA)	NCBI Sequence Viewer
	XP_063127160	(Get FASTA)	NCBI Sequence Viewer
	XP_063127161	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK94485	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001532
	ENSRNOP00000001532.6
	ENSRNOP00000084373
GenBank Protein	Q8K3P4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_683688 ⟸ NM_148890

- UniProtKB:

Q8K3P4 (UniProtKB/Swiss-Prot), A6J1U2 (UniProtKB/TrEMBL), F1LRH1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFG
FVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKHY
FEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSP
TGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSA
PVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELY
GAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH

hide sequence

Ensembl Acc Id:

ENSRNOP00000001532 ⟸ ENSRNOT00000001532

RefSeq Acc Id:	XP_038945053 ⟸ XM_039089125
- Peptide Label:	isoform X7
- UniProtKB:	A6J1U2 (UniProtKB/TrEMBL), F1LRH1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945050 ⟸ XM_039089122
- Peptide Label:	isoform X4
- UniProtKB:	A6J1U2 (UniProtKB/TrEMBL), F1LRH1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945049 ⟸ XM_039089121
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6GAA4 (UniProtKB/TrEMBL), A6J1U2 (UniProtKB/TrEMBL), F1LRH1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945048 ⟸ XM_039089120
- Peptide Label:	isoform X2
- UniProtKB:	A6J1U2 (UniProtKB/TrEMBL), F1LRH1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945051 ⟸ XM_039089123
- Peptide Label:	isoform X5
- UniProtKB:	A6J1U2 (UniProtKB/TrEMBL), F1LRH1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945052 ⟸ XM_039089124
- Peptide Label:	isoform X6

Ensembl Acc Id:

ENSRNOP00000084373 ⟸ ENSRNOT00000117406

RefSeq Acc Id:	XP_063127158 ⟸ XM_063271088
- Peptide Label:	isoform X1
- UniProtKB:	Q8K3P4 (UniProtKB/Swiss-Prot), A6J1U2 (UniProtKB/TrEMBL), F1LRH1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063127161 ⟸ XM_063271091
- Peptide Label:	isoform X9

RefSeq Acc Id:	XP_063127160 ⟸ XM_063271090
- Peptide Label:	isoform X8

Protein Domains

RRM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8K3P4-F1-model_v2	AlphaFold	Q8K3P4	1-362	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628778	AgrOrtholog
BioCyc Gene	G2FUF-18993	BioCyc
Ensembl Genes	ENSRNOG00000001156	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000001532	ENTREZGENE
	ENSRNOT00000001532.6	UniProtKB/Swiss-Prot
	ENSRNOT00000117406	ENTREZGENE
Gene3D-CATH	3.30.70.330	UniProtKB/Swiss-Prot
InterPro	MSI_RRM2	UniProtKB/Swiss-Prot
	Nucleotide-bd_a/b_plait_sf	UniProtKB/Swiss-Prot
	RBD_domain_sf	UniProtKB/Swiss-Prot
	RRM_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:259272	UniProtKB/Swiss-Prot
NCBI Gene	259272	ENTREZGENE
PANTHER	RNA-BINDING PROTEIN MUSASHI HOMOLOG 1	UniProtKB/Swiss-Prot
	RNA-BINDING PROTEIN MUSASHI HOMOLOG RBP6	UniProtKB/Swiss-Prot
Pfam	RRM_1	UniProtKB/Swiss-Prot
PhenoGen	Msi1	PhenoGen
PROSITE	RRM	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001156	RatGTEx
SMART	RRM	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54928	UniProtKB/Swiss-Prot
UniProt	A0A8I6GAA4	ENTREZGENE, UniProtKB/TrEMBL
	A6J1U2	ENTREZGENE, UniProtKB/TrEMBL
	F1LRH1	ENTREZGENE, UniProtKB/TrEMBL
	MSI1H_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-01-02	Msi1	musashi RNA-binding protein 1	Msi1	Musashi homolog 1(Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-16	Msi1	Musashi homolog 1(Drosophila)	Msi1h	musashi homolog 1(Drosophila)	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2005-01-20	Msi1h	musashi homolog 1(Drosophila)		Musashi homolog 1(Drosophila)	Name updated	1299863	APPROVED
2003-02-27	Msi1h	Musashi homolog 1(Drosophila)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in neural stem cells	633285

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)