Advanced Search (OLGA)

Gene: Hsd3b7 (hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7) Rattus norvegicus

Analyze

Symbol:

Hsd3b7

Name:

hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7

RGD ID:

628727

Description:

Enables cholest-5-ene-3-beta,7-alpha-diol 3-beta-dehydrogenase activity. Involved in cholesterol catabolic process; liver regeneration; and regulation of cell growth. Predicted to be located in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in congenital bile acid synthesis defect 1 and intrahepatic cholestasis. Orthologous to human HSD3B7 (hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7); PARTICIPATES IN bile acid biosynthetic pathway; cerebrotendinous xanthomatosis pathway; congenital bile acid synthesis defect pathway; INTERACTS WITH 1,2-dimethylhydrazine; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

3 beta-hydroxysteroid dehydrogenase type 7; 3 beta-hydroxysteroid dehydrogenase type VII; 3-beta-HSD VII; 3-beta-hydroxy-Delta(5)-C27 steroid oxidoreductase; c(27) 3-beta-HSD; Cca2; cholest-5-ene-3-beta,7-alpha-diol 3-beta-dehydrogenase; confluent 3Y1 cell-associated 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	191,842,688 - 191,845,919 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	191,842,636 - 191,845,921 (+)	Ensembl				GRCr8
mRatBN7.2	1	182,412,216 - 182,415,447 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	182,412,151 - 182,415,442 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	190,762,758 - 190,765,989 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	197,948,848 - 197,952,079 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	190,619,309 - 190,622,540 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	199,248,084 - 199,251,745 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	199,248,470 - 199,251,740 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	206,270,509 - 206,274,641 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	187,085,808 - 187,089,078 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	180,063,215 - 180,066,485 (+)	NCBI		Celera
RGSC_v3.1	1	187,235,688 - 187,238,959 (+)	NCBI
Cytogenetic Map	1	q37	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cholestasis (ISO)

congenital bile acid synthesis defect (ISO)

congenital bile acid synthesis defect 1 (ISO)

genetic disease (ISO)

intrahepatic cholestasis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP,ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

carbon nanotube (ISO)

chenodeoxycholic acid (ISO)

chlordecone (ISO)

cisplatin (EXP)

clofibrate (ISO)

cyclosporin A (ISO)

deoxycholic acid (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ferric oxide (ISO)

fipronil (ISO)

fonofos (ISO)

glafenine (EXP)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

leflunomide (EXP)

letrozole (ISO)

lipopolysaccharide (ISO)

methamphetamine (EXP)

methapyrilene (EXP,ISO)

methidathion (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monosodium L-glutamate (ISO)

NAD zwitterion (ISO)

NAD(+) (ISO)

naled (ISO)

obeticholic acid (ISO)

paracetamol (EXP,ISO)

parathion (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (EXP)

pirinixic acid (ISO)

resveratrol (ISO)

rivaroxaban (EXP)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

Sunset Yellow FCF (ISO)

terbufos (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (ISO)

tetracycline (ISO)

tetraphene (ISO)

thapsigargin (EXP)

thioacetamide (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

B cell chemotaxis (ISO,ISS)

bile acid metabolic process (TAS)

cholesterol catabolic process (IDA)

lipid metabolic process (IEA)

liver regeneration (IEP)

regulation of cell growth (IDA)

steroid biosynthetic process (IEA)

Cellular Component

endoplasmic reticulum (IEA)

endoplasmic reticulum membrane (IEA)

lipid droplet (ISO)

Molecular Function

cholest-5-ene-3-beta,7-alpha-diol 3-beta-dehydrogenase activity (IDA,IEA,ISO)

oxidoreductase activity (IEA)

oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (IBA,IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

bile acid biosynthetic pathway (IEA,ISO)

cerebrotendinous xanthomatosis pathway (ISO)

congenital bile acid synthesis defect pathway (ISO)

familial hypercholanemia pathway (ISO)

primary bile acid biosynthetic pathway (IEA)

Zellweger syndrome pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Molecular genetics of 3beta-hydroxy-Delta5-C27-steroid oxidoreductase deficiency in 16 patients with loss of bile acid synthesis and liver disease.	Cheng JB, etal., J Clin Endocrinol Metab. 2003 Apr;88(4):1833-41.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Isolation of a novel cDNA whose corresponding mRNA is accumulated in growth-arrested confluent but not in growing sub-confluent rat 3Y1 cells.	Hayashi Y, etal., Biochim Biophys Acta 1997 May 30;1352(2):145-50.
4.	Bile acid biosynthesis during liver regeneration: enzyme activities of cholesterol 7alpha-hydroxylase and 3beta-hydroxy-delta5-C27-steroid dehydrogenase in rats.	Maeda Y, etal., Ann Clin Lab Sci. 2005 Summer;35(3):323-8.
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	The bile acid synthetic gene 3beta-hydroxy-Delta(5)-C(27)-steroid oxidoreductase is mutated in progressive intrahepatic cholestasis.	Schwarz M, etal., J Clin Invest 2000 Nov;106(9):1175-84.

Additional References at PubMed

PMID:22999953

Genomics

Comparative Map Data

Hsd3b7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	191,842,688 - 191,845,919 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	191,842,636 - 191,845,921 (+)	Ensembl				GRCr8
mRatBN7.2	1	182,412,216 - 182,415,447 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	182,412,151 - 182,415,442 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	190,762,758 - 190,765,989 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	197,948,848 - 197,952,079 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	190,619,309 - 190,622,540 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	199,248,084 - 199,251,745 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	199,248,470 - 199,251,740 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	206,270,509 - 206,274,641 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	187,085,808 - 187,089,078 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	180,063,215 - 180,066,485 (+)	NCBI		Celera
RGSC_v3.1	1	187,235,688 - 187,238,959 (+)	NCBI
Cytogenetic Map	1	q37	NCBI

HSD3B7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	30,985,207 - 30,989,147 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	30,985,143 - 30,989,154 (+)	Ensembl			hg38	GRCh38
GRCh37	16	30,996,528 - 31,000,468 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	30,904,033 - 30,907,972 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	16	30,904,032 - 30,907,972	NCBI
Celera	16	29,296,983 - 29,300,937 (-)	NCBI		Celera
Cytogenetic Map	16	p11.2	NCBI
HuRef	16	28,558,975 - 28,562,929 (+)	NCBI		HuRef
CHM1_1	16	32,313,519 - 32,317,473 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	31,372,649 - 31,376,589 (+)	NCBI		T2T-CHM13v2.0

Hsd3b7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	127,399,830 - 127,402,973 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	127,399,776 - 127,402,974 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	127,800,609 - 127,803,802 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	127,800,604 - 127,803,802 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	134,944,123 - 134,947,316 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	127,591,817 - 127,594,948 (+)	NCBI		MGSCv36	mm8
Celera	7	127,635,644 - 127,638,838 (+)	NCBI		Celera
Cytogenetic Map	7	F3	NCBI
cM Map	7	69.74	NCBI

Hsd3b7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955493	7,835,160 - 7,838,428 (+)	Ensembl
ChiLan1.0	NW_004955493	7,835,160 - 7,838,428 (+)	NCBI	ChiLan1.0	ChiLan1.0

HSD3B7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	34,190,677 - 34,195,155 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	38,992,081 - 38,996,924 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	23,979,487 - 23,984,225 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	31,352,619 - 31,356,803 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	31,352,322 - 31,356,803 (+)	Ensembl			panPan2	panpan1.1

HSD3B7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	17,220,006 - 17,223,985 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	17,219,574 - 17,223,114 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	18,795,302 - 18,798,953 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	17,350,564 - 17,354,218 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	17,350,579 - 17,354,193 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	17,150,916 - 17,154,584 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	17,070,068 - 17,073,719 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	17,382,602 - 17,386,270 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Hsd3b7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	125,265,718 - 125,269,698 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936501	13,363,576 - 13,367,553 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936501	13,363,630 - 13,367,553 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

STX1B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	17,439,581 - 17,459,516 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	17,439,563 - 17,459,517 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	17,848,121 - 17,856,072 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HSD3B7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	27,675,591 - 27,680,011 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	27,676,502 - 27,679,046 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666068	1,792,225 - 1,796,427 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hsd3b7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624782	14,053,765 - 14,057,241 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624782	14,054,028 - 14,057,248 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Hsd3b7
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	74,100,866 - 74,104,495 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Hsd3b7
89 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	226
Count of miRNA genes:	145
Interacting mature miRNAs:	155
Transcripts:	ENSRNOT00000025933
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	153679879	198679879	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	177339686	222339686	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	132760429	191848948	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	181059071	226059071	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	181059071	226059071	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	153679879	205813246	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	182039247	227039247	Rat
8694166	Bw147	Body weight QTL 147	6.83	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	1	153788989	198788989	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	183564652	228564652	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	160573753	210707719	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	181059071	226059071	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	139442053	223964440	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	160573753	210707719	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	165278545	210278545	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	127329268	206393015	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	161077990	206077990	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	181059071	226059071	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	181059071	226059071	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	168063662	213063662	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	159894717	207261263	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	109493780	193400781	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	163992710	208992710	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	182535316	227535316	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	146080545	243492863	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	155359438	194575574	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	181059071	226059071	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	153679879	232414077	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	160574007	235238518	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	181059071	226059071	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	181059071	226059071	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	132760429	191848948	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	162753891	207753891	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	180739993	225739993	Rat
61378	Bp43	Blood pressure QTL 43	22.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	191177449	205813246	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	191190115	223964326	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	172718770	228180370	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	111949780	210707719	Rat
2312558	Glom17	Glomerulus QTL 17	3.9	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	175967553	200707874	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	178547286	206690557	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	188241285	250779312	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	139442053	223964440	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	111949780	210707719	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	185979875	230979875	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	210707719	Rat
1576310	Schws2	Schwannoma susceptibility QTL 2		0.029	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	1	153788989	198788989	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	165707719	210707719	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	173363824	227535316	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	132966869	206393015	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	132760429	191848948	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	191260175	236260175	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2325727	Pia41	Pristane induced arthritis QTL 41			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	188241285	233241285	Rat
7411599	Foco11	Food consumption QTL 11	18.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	1	153788989	198788989	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	210707719	Rat
2325725	Eae31	Experimental allergic encephalomyelitis QTL 31			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	188241285	197807511	Rat
631670	Iddm10	Insulin dependent diabetes mellitus QTL 10	1.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	183564652	205813246	Rat

Markers in Region

AI195443

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	182,414,966 - 182,415,080 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	199,251,265 - 199,251,378	NCBI	Rnor6.0
Rnor_5.0	1	206,273,693 - 206,273,806	UniSTS	Rnor5.0
RGSC_v3.4	1	187,088,603 - 187,088,716	UniSTS	RGSC3.4
Celera	1	180,066,010 - 180,066,123	UniSTS
Cytogenetic Map	1	q36	UniSTS

BE120262

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	182,411,694 - 182,411,853 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	199,247,993 - 199,248,151	NCBI	Rnor6.0
Rnor_5.0	1	206,270,421 - 206,270,579	UniSTS	Rnor5.0
RGSC_v3.4	1	187,085,331 - 187,085,489	UniSTS	RGSC3.4
Celera	1	180,062,738 - 180,062,896	UniSTS
Cytogenetic Map	1	q36	UniSTS

AI706765

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	182,415,339 - 182,415,429 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	199,251,638 - 199,251,727	NCBI	Rnor6.0
Rnor_5.0	1	206,274,066 - 206,274,155	UniSTS	Rnor5.0
RGSC_v3.4	1	187,088,976 - 187,089,065	UniSTS	RGSC3.4
Celera	1	180,066,383 - 180,066,472	UniSTS
Cytogenetic Map	1	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	161	91	90	59	92	59	6	356	192	11	140	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001398675	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_139329	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039099539	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB000199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC111812	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025933 ⟹ ENSRNOP00000025933

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	191,842,643 - 191,845,919 (+)	Ensembl
mRatBN7.2 Ensembl	1	182,412,172 - 182,415,442 (+)	Ensembl
Rnor_6.0 Ensembl	1	199,248,470 - 199,251,740 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097840 ⟹ ENSRNOP00000091092

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	191,842,643 - 191,845,918 (+)	Ensembl
mRatBN7.2 Ensembl	1	182,412,151 - 182,415,438 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109576 ⟹ ENSRNOP00000085197

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	191,842,636 - 191,844,962 (+)	Ensembl
mRatBN7.2 Ensembl	1	182,412,151 - 182,414,490 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000162091 ⟹ ENSRNOP00000102339

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	191,842,636 - 191,845,921 (+)	Ensembl

RefSeq Acc Id:

NM_001398675 ⟹ NP_001385604

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	191,842,688 - 191,845,919 (+)	NCBI
mRatBN7.2	1	182,412,216 - 182,415,447 (+)	NCBI

RefSeq Acc Id:

NM_139329 ⟹ NP_647545

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	191,842,688 - 191,845,919 (+)	NCBI
mRatBN7.2	1	182,412,216 - 182,415,447 (+)	NCBI
Rnor_6.0	1	199,248,470 - 199,251,740 (+)	NCBI
Rnor_5.0	1	206,270,509 - 206,274,641 (+)	NCBI
RGSC_v3.4	1	187,085,808 - 187,089,078 (+)	RGD
Celera	1	180,063,215 - 180,066,485 (+)	RGD

Sequence:

show sequence

GCGAGCGGAAGGAAGGAAGCCTGTGTGCATCTAGCTGGTCCACCAGTCCAGGACACAACATCTC
CCAGTGGCCAGTTTGGGCGCCCTGGGACTTCCTACAGCTGGCCATGGCAGACTCTGCACAGGTG
CCAGCACTGGTATACCTGGTCACAGGTGGCTGTGGCTTCCTGGGGGAGCATATTGTTCGAATGC
TGCTGGAGTGGGAGCCCAGGCTCCGGGAGCTGCGTGTCTTTGACCTGCACCTGAGTTCTTGGCT
GGAGGAGCTGAAAACAGGGCCTGTGCAGGTGACTGCCATCCAGGGGGATGTGACTCAGGCCCAC
GAGGTGGCAGCAGCCATGGCTGGATCTCATGTGGTCATCCATACAGCTGGGCTGGTAGATGTGT
TTGGGAAGGCCAGTCCAGAGACCATCCACAAAGTCAATGTGCAGGGCACACAGAATGTGATTGA
CGCTTGTGTGCAGACCGGGACTCGGCTCCTGGTCTACACGAGTAGCATGGAAGTGGTAGGGCCT
AATGTCAAGGGCCACCCCTTCTACAGGGGCAATGAAGACACCCCATATGAGGCCATCCACAGGC
ATCCCTACCCATGTAGCAAGGCCCTCGCTGAGCAGTTGGTCCTCGAGGCCAATGGAAGGAAGGG
ACTGCGCTTTGGAGGTCGGCTGTTTCGGGCCATCCCAGCTTCCGTGGAGCATGGTCGGGTCTAC
GTTGGCAATGTGGCTTGGATGCATATACTGGTGGCCCGAGAGCTGGAGCAGCGGGCAGCACTCA
TGGGTGGCCAGGTGTATTTCTGCTATGATAAGTCACCTTATAAAAGCTACGAGGACTTCAACAT
GGAGTTTCTGAGTCCCTGTGGACTTCGGCTGATAGGCACCCACCCACTGCTGCCCTACTGGCTA
CTGGTGCTGCTGACTGCCCTCAACGCTCTGCTGCAGTGGCTGCTTCGGCCGCTGGTGCTGTACA
CACCCCTGCTGAATCCCTACACTCTGGCTGTGGCCAACACCACCTTTACTGTCAGCACCAACAA
GGCACAGCGCCATTTCGGCTACAAGCCCCTCTTCTCATGGGAAGAGAGCAGGGCCCGCACCATT
CACTGGGTGCAGGCCATGGAGGGTTCCGCCTGGTGATGGCAGGGCCAGGAACTGGAGACCACTG
TGGCACACTCCAGGTCCTGAGCCCCCAAAAGCCTGGACGGAGAGAAATGGCTACCTTTTGAAGC
TGCTGACTCTGCTAGACACATCAGGACTGTGCTATGGACCCTGCCACGTCTGTGCCTGGTTCAT
ATCCCAGTCTCCAAGTTCTAGGACAGAGTCTGGGTGCAGGCCTATCTTTGGTGCCAACTCGGGC
CTGCCAGCTAGTTGGCAAAAACTGATTCCTGAATGGTCTCACTACCCCTTCCTGTTTCTAGTTT
CTCAAGCAGGGAGGGACAGAGACTCCAGAGGTCTGTTGCTGGCCTGCTTACTCCAGGTACCATT
TTCAGACCTGGCTCCTGCCACATCTGGTTCTCCATTTTCTTTTCTTTTTTTTTTTTCTTTTTCT
TTTTTTTTTATTTTTTTCGGAGCTGGGGACCGAACCCAGGGCCTTCGCTTGCTAGGCAAGCGCT
CTACCACTGAGCTAAATCGTTTTCTTAAGTGTATCTCTTTTAGACATTTTTCTTTTAATTTGCT
TTAAAGAAAACTGAAGGAATGAATGGTTTTCCATGTCTTGCCTTCTTAACAAATTCAGCTATGA
TATTGTTAGCTTCCTCCCTGAGGATGCCAACCTGTATCTGGCCACACCTGGATTAAAATCCTTT
GCC

hide sequence

RefSeq Acc Id:

XM_039099539 ⟹ XP_038955467

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	191,843,235 - 191,845,919 (+)	NCBI
mRatBN7.2	1	182,412,762 - 182,415,447 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001385604	(Get FASTA)	NCBI Sequence Viewer
	NP_647545	(Get FASTA)	NCBI Sequence Viewer
	XP_038955467	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA22931	(Get FASTA)	NCBI Sequence Viewer
	EDM17231	(Get FASTA)	NCBI Sequence Viewer
	EDM17232	(Get FASTA)	NCBI Sequence Viewer
	EDM17233	(Get FASTA)	NCBI Sequence Viewer
	EDM17234	(Get FASTA)	NCBI Sequence Viewer
	EDM17235	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000091092
	ENSRNOP00000102339
GenBank Protein	O35048	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_647545 ⟸ NM_139329
- Peptide Label:	isoform 2
- UniProtKB:	O35048 (UniProtKB/Swiss-Prot), A6I9U6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MADSAQVPALVYLVTGGCGFLGEHIVRMLLEWEPRLRELRVFDLHLSSWLEELKTGPVQVTAIQ GDVTQAHEVAAAMAGSHVVIHTAGLVDVFGKASPETIHKVNVQGTQNVIDACVQTGTRLLVYTS SMEVVGPNVKGHPFYRGNEDTPYEAIHRHPYPCSKALAEQLVLEANGRKGLRFGGRLFRAIPAS VEHGRVYVGNVAWMHILVARELEQRAALMGGQVYFCYDKSPYKSYEDFNMEFLSPCGLRLIGTH PLLPYWLLVLLTALNALLQWLLRPLVLYTPLLNPYTLAVANTTFTVSTNKAQRHFGYKPLFSWE ESRARTIHWVQAMEGSAW hide sequence

Ensembl Acc Id:

ENSRNOP00000025933 ⟸ ENSRNOT00000025933

RefSeq Acc Id:	XP_038955467 ⟸ XM_039099539
- Peptide Label:	isoform X1
- UniProtKB:	O35048 (UniProtKB/Swiss-Prot)

Ensembl Acc Id:

ENSRNOP00000091092 ⟸ ENSRNOT00000097840

Ensembl Acc Id:

ENSRNOP00000085197 ⟸ ENSRNOT00000109576

RefSeq Acc Id:	NP_001385604 ⟸ NM_001398675
- Peptide Label:	isoform 1
- UniProtKB:	O35048 (UniProtKB/Swiss-Prot), A0A8I6APT0 (UniProtKB/TrEMBL), A6I9U5 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000102339 ⟸ ENSRNOT00000162091

Protein Domains

3-beta hydroxysteroid dehydrogenase/isomerase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35048-F1-model_v2	AlphaFold	O35048	1-338	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690441

Promoter ID:

EPDNEW_R966

Type:

initiation region

Name:

Hsd3b7_1

Description:

hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	199,248,514 - 199,248,574	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628727	AgrOrtholog
BioCyc Gene	G2FUF-57339	BioCyc
Ensembl Genes	ENSRNOG00000019080	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000097840	ENTREZGENE
	ENSRNOT00000162091	ENTREZGENE
Gene3D-CATH	NAD(P)-binding Rossmann-like Domain	UniProtKB/Swiss-Prot
InterPro	3Beta_OHSteriod_DH/Estase	UniProtKB/Swiss-Prot
	NAD(P)-bd_dom_sf	UniProtKB/Swiss-Prot
	NAD(P)_epim/dehydrat-rel	UniProtKB/Swiss-Prot
KEGG Report	rno:246211	UniProtKB/Swiss-Prot
NCBI Gene	246211	ENTREZGENE
PANTHER	3 BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 7	UniProtKB/Swiss-Prot
	NAD DEPENDENT EPIMERASE/DEHYDRATASE	UniProtKB/Swiss-Prot
Pfam	3Beta_HSD	UniProtKB/Swiss-Prot
PhenoGen	Hsd3b7	PhenoGen
RatGTEx	ENSRNOG00000019080	RatGTEx
Superfamily-SCOP	SSF51735	UniProtKB/Swiss-Prot
UniProt	3BHS7_RAT	UniProtKB/Swiss-Prot
	A0A8I5ZZK1_RAT	UniProtKB/TrEMBL
	A0A8I6APT0	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0L1L7_RAT	UniProtKB/TrEMBL
	A6I9U5	ENTREZGENE, UniProtKB/TrEMBL
	A6I9U6	ENTREZGENE, UniProtKB/TrEMBL
	A6I9U7_RAT	UniProtKB/TrEMBL
	A6I9U8_RAT	UniProtKB/TrEMBL
	A6I9U9_RAT	UniProtKB/TrEMBL
	D3ZPY2_RAT	UniProtKB/TrEMBL
	O35048	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Hsd3b7	hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7		CCA2 protein	Name updated	1299863	APPROVED
2004-09-10	Hsd3b7	CCA2 protein	Cca2		Symbol and Name updated	1299863	APPROVED
2003-02-27	Cca2	CCA2 protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_homology	shows 35% identity with rat type IV 3beta-hydroxysteroid dehydrogenase	632348
gene_protein	338 amino acids	632348
gene_transcript	1795 nucleotides	632348

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)