Advanced Search (OLGA)

Gene: Zwint (ZW10 interacting kinetochore protein) Rattus norvegicus

Analyze

Symbol:

Zwint

Name:

ZW10 interacting kinetochore protein

RGD ID:

628671

Description:

Predicted to be involved in establishment of localization in cell; nuclear chromosome segregation; and regulation of metaphase/anaphase transition of cell cycle. Located in dendrite. Orthologous to human ZWINT (ZW10 interacting kinetochore protein); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

neuroprotective protein 8; outer kinetochore KNL1 complex subunit ZWINT; scoilin; Sip30; SNAP25 interacting protein 30; SNAP25-interacting protein 30; ZW10 interacting protein-1; ZW10 interactor; ZW10 interactor, kinetochore protein; ZW10-interacting protein 1; Zwint-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	15,502,559 - 15,953,701 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	15,937,396 - 15,953,203 (-)	Ensembl				GRCr8
mRatBN7.2	20	15,938,157 - 15,953,997 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	15,938,157 - 15,953,957 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	16,649,159 - 16,664,966 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	16,004,145 - 16,019,952 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	16,476,752 - 16,492,559 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	17,075,781 - 17,091,715 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	17,075,771 - 17,091,766 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	19,258,272 - 19,274,238 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	20	17,366,344 - 17,382,150 (-)	NCBI		Celera
Cytogenetic Map	20	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

hepatocellular carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-butoxyethanol (ISO)

3,3',5,5'-tetrabromobisphenol A (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-amino-2,6-dinitrotoluene (EXP)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (ISO)

afimoxifene (ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (EXP)

all-trans-retinoic acid (ISO)

amiodarone (EXP)

ammonium chloride (EXP)

antimony(0) (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

azathioprine (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bicalutamide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (ISO)

bisphenol AF (ISO)

bisphenol F (EXP,ISO)

cadmium dichloride (EXP)

calcitriol (ISO)

carbon nanotube (ISO)

chromium atom (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clofibrate (EXP,ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

coumarin (EXP)

coumestrol (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

D-glucose (EXP)

DDE (ISO)

dexamethasone (ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dioxygen (EXP,ISO)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

Enterolactone (ISO)

epoxiconazole (ISO)

ethanol (ISO)

finasteride (EXP)

fipronil (EXP)

flavonoids (EXP)

flutamide (EXP)

folic acid (ISO)

fulvestrant (ISO)

genistein (ISO)

glucose (EXP)

GSK-J4 (ISO)

hypochlorous acid (ISO)

indole-3-methanol (EXP)

indometacin (ISO)

inulin (ISO)

L-ethionine (EXP)

leflunomide (EXP)

lucanthone (ISO)

menadione (ISO)

mercury atom (ISO)

mercury dichloride (EXP)

mercury(0) (ISO)

methidathion (ISO)

miconazole (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-methylformamide (ISO)

N-nitrosodiethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

nefazodone (EXP)

nickel atom (ISO)

niclosamide (ISO)

nimesulide (EXP)

nitrates (ISO)

okadaic acid (ISO)

omeprazole (EXP)

palbociclib (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

pentachlorophenol (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phorbol 13-acetate 12-myristate (ISO)

piperonyl butoxide (EXP)

pirinixic acid (EXP,ISO)

piroxicam (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

propanal (ISO)

quinolin-8-ol (ISO)

resveratrol (ISO)

rotenone (EXP)

selenium atom (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sirolimus (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sotorasib (ISO)

sulforaphane (ISO)

sunitinib (ISO)

testosterone (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trametinib (ISO)

trichloroethene (EXP,ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (EXP)

troglitazone (ISO)

urethane (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vancomycin (ISO)

vincaleukoblastine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell division (IEA)

establishment of localization in cell (IBA,ISO)

homologous chromosome orientation in meiotic metaphase I (IEA,ISO,ISS)

mitotic sister chromatid segregation (IBA,ISO)

mitotic spindle assembly checkpoint signaling (IBA,ISO)

regulation of meiosis I spindle assembly checkpoint (IEA,ISO,ISS)

Cellular Component

cytoplasm (ISO)

cytosol (IBA,ISO)

dendrite (IBA,IDA)

kinetochore (IBA,IEA,ISO,ISS)

Knl1/Spc105 complex (ISO,ISS)

nuclear body (IBA,ISO)

nucleoplasm (ISO)

nucleus (IEA)

outer kinetochore (ISO)

Molecular Function

protein binding (IPI,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Identification of a novel SNAP25 interacting protein (SIP30).	Lee HK, etal., J Neurochem 2002 Jun;81(6):1338-47.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:11682612	PMID:15485811	PMID:15489334	PMID:19723624	PMID:21124846	PMID:22871113	PMID:24403136	PMID:30053369

Genomics

Comparative Map Data

Zwint
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	15,502,559 - 15,953,701 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	15,937,396 - 15,953,203 (-)	Ensembl				GRCr8
mRatBN7.2	20	15,938,157 - 15,953,997 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	15,938,157 - 15,953,957 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	16,649,159 - 16,664,966 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	16,004,145 - 16,019,952 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	16,476,752 - 16,492,559 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	17,075,781 - 17,091,715 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	17,075,771 - 17,091,766 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	19,258,272 - 19,274,238 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	20	17,366,344 - 17,382,150 (-)	NCBI		Celera
Cytogenetic Map	20	p11	NCBI

ZWINT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	56,357,227 - 56,361,273 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	56,356,736 - 56,361,392 (-)	Ensembl			hg38	GRCh38
GRCh37	10	58,116,988 - 58,121,034 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	57,787,205 - 57,791,040 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	57,787,204 - 57,791,040	NCBI
Celera	10	51,380,359 - 51,384,194 (-)	NCBI		Celera
Cytogenetic Map	10	q21.1	NCBI
HuRef	10	52,100,166 - 52,104,002 (-)	NCBI		HuRef
CHM1_1	10	58,399,021 - 58,402,856 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	57,207,567 - 57,211,612 (-)	NCBI		T2T-CHM13v2.0

Zwint
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	72,490,678 - 72,510,796 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	72,490,677 - 72,510,796 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	72,654,846 - 72,674,964 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	72,654,845 - 72,674,964 (+)	Ensembl			mm10	GRCm38
MGSCv37	10	72,117,643 - 72,132,537 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	72,050,213 - 72,070,263 (+)	NCBI		MGSCv36	mm8
Celera	10	73,721,825 - 73,736,719 (+)	NCBI		Celera
Cytogenetic Map	10	B5.3	NCBI
cM Map	10	37.15	NCBI

Zwint
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955425	10,477,331 - 10,486,288 (-)	Ensembl
ChiLan1.0	NW_004955425	10,477,224 - 10,486,372 (-)	NCBI	ChiLan1.0	ChiLan1.0

ZWINT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	68,652,375 - 68,660,157 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	68,657,697 - 68,665,829 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	52,978,892 - 52,986,797 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	55,202,564 - 55,206,450 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	55,202,383 - 55,206,450 (-)	Ensembl			panPan2	panpan1.1

ZWINT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	32,432,385 - 32,459,377 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	32,432,406 - 32,453,162 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	32,311,125 - 32,367,927 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	33,957,126 - 34,013,841 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	33,956,942 - 33,996,948 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	31,858,877 - 31,915,636 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	31,447,375 - 31,504,073 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	32,649,687 - 32,706,484 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Zwint
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	72,225,358 - 72,237,265 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936693	1,539,987 - 1,551,685 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZWINT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	94,094,894 - 94,102,060 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	94,094,781 - 94,109,447 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	102,560,703 - 102,610,775 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ZWINT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	74,912,070 - 74,915,920 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	74,912,093 - 74,915,926 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	35,825,925 - 35,829,966 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Zwint
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624791	7,528,426 - 7,534,553 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624791	7,528,452 - 7,534,182 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Zwint
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	18	14,328,491 - 14,331,050 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Zwint
5025 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	121
Count of miRNA genes:	96
Interacting mature miRNAs:	109
Transcripts:	ENSRNOT00000074404
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889610	Pancm3	Pancreatic morphology QTL 3	3.75	0.001	pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	20	4189476	49189476	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	1	26925056	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1	33724594	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26128279	Rat
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8043920	29865039	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600300	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1533083	46533083	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24164241	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	1	34066551	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29193376	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	1	27341128	Rat
1598870	Bp289	Blood pressure QTL 289	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	8216359	53216359	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29193376	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29193376	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29193376	Rat
1598858	Cm61	Cardiac mass QTL 61	3.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	20	8216359	53216359	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29193376	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	12243242	49189476	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578510	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600300	Rat

Markers in Region

RH127633

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	9,587,907 - 9,588,085 (+)	MAPPER	mRatBN7.2
mRatBN7.2	20	15,938,432 - 15,938,632 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	17,076,057 - 17,076,256	NCBI	Rnor6.0
Rnor_6.0	16	10,609,508 - 10,609,685	NCBI	Rnor6.0
Rnor_5.0	16	8,928,049 - 8,928,226	UniSTS	Rnor5.0
Rnor_5.0	20	19,258,548 - 19,258,747	UniSTS	Rnor5.0
RGSC_v3.4	16	9,911,823 - 9,912,000	UniSTS	RGSC3.4
Celera	20	17,366,620 - 17,366,819	UniSTS
RH 3.4 Map	20	204.1	UniSTS
Cytogenetic Map	16	p16	UniSTS

RH129520

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	15,938,376 - 15,938,577 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	17,076,001 - 17,076,201	NCBI	Rnor6.0
Rnor_5.0	20	19,258,492 - 19,258,692	UniSTS	Rnor5.0
Celera	20	17,366,564 - 17,366,764	UniSTS
RH 3.4 Map	20	201.9	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_147138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098465	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063278987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF439397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF532776	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC063144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU000468	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212792	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228814	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000074404 ⟹ ENSRNOP00000067414

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	15,937,396 - 15,953,203 (-)	Ensembl
mRatBN7.2 Ensembl	20	15,938,157 - 15,953,957 (-)	Ensembl
Rnor_6.0 Ensembl	20	17,075,771 - 17,091,766 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100712 ⟹ ENSRNOP00000085046

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	15,937,396 - 15,953,182 (-)	Ensembl
mRatBN7.2 Ensembl	20	15,938,157 - 15,953,943 (-)	Ensembl

RefSeq Acc Id:

NM_147138 ⟹ NP_671479

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	15,937,396 - 15,953,203 (-)	NCBI
mRatBN7.2	20	15,938,157 - 15,953,964 (-)	NCBI
Rnor_6.0	20	17,075,781 - 17,091,715 (-)	NCBI
Rnor_5.0	20	19,258,272 - 19,274,238 (-)	NCBI
Celera	20	17,366,344 - 17,382,150 (-)	RGD

Sequence:

show sequence

GGCGTGGTGGGCGTCAGAACCATGGCGGACGCGGAGAAAAACGCTGTTGCGGAGAAAAACGCTG
TTGCGGAGGAAAACGCCGTTGCGGAGGAAAACGCCGTTGCGGATAAAAACGCAACGAAAGAGGT
TCTGGCTGAGGCAGCAAGCGTTCTGGAACCTGTAGGATTGCCGGAAGAAGCAGAGCTGCCTGCC
AAGATCATGGAGGAATTTATGAGGAACTCTCGGAAGAAAGACAAGCTGCTCTGTAGCCAGCTTC
AAGTAGTGAACTTCTTACAGACTTTTCTGGCCCAGGAGGATAATACTGACCAGAACCCAGATGC
TCTGGCTTCTGAAGATACAAGTCGACAAAAGGCAACTGAAACTAAGGAGCAGTGGAAGGAGCTG
AAGGCAACATACATGGATCATGTGGACGTCATCAAATGTGCCCTGTCTGAGGCCTTGCCCCAGG
TTAAAGAGGCACACAGGAAGTACACCGAGCTTCAGAAGGCTTTTGAGCAACTCGAGGCTAAGAA
GCGAGTCCTTGAGGAGAAACTGCAGTTAGCTCAGAAGCAGTGGGTGCTGCAGCAGAAGCGTTTG
CAGAATCTGACAAAGATTTCTGCTGAGGTCAAGAGACGCCGGAAGAGAGCTCTGGAGAAGCTTG
ATGGTTCTCACCAGGAACTTGAAACCTTGAAGCAGCAAGCAGGACAGGAGCAGGAGAAGCTGCA
GAGGAACCAGAGCTACCTCCAGCTGCTGTGCTCCCTGCAGAATAAGCTGGTCATCTCTGAGTCC
AAGGCCGACGACAAAGATGTCAAAGGGCCCGCCCTTCCACCCAAGTCTCCGTAAAGATGAAAGC
GAGAACGAGACTGCGCTCCAGCTGTGCTGCTTGGGCTGAGACCAGAGTGGTTCCTTCGCTGTTG
TATCCCTAGGCCTAGGCCTGTAGCCTTGTACAATCTTCCAAGCGGACTCAGTTTGGCATCTCTT
GGCTTCTCAGTGAATTGTTCTGTTTCATTTCTTACCATATATTCTGGCTTGTTCTGTCTTCACC
TGGGTCCAACCTGCTGTTTCTGTAAAATTGTGCCAGTGAAATTGTCACGTGCATGCACGCAGGC
ACACAGGCACGCATGCCACAACCACCCTTTTCTCTCGCTGATCTTCAGTAGTCTCTCCTCTGGC
CCTCTCTCTCTCTGTCTTCTCTCCCGACCAGATGTGAAAGTAACTTTATGCACCCGATGTAATT
GTTGCCTCGGAGGCTCATTGATGAATAAGCTCACCCTGTGTAGTTCTTGCTAAACTCTGGCTGG
CTGGTTCAACTCAGCTCTTCTGGTTCAAACCCGTCTCCAAACTGACTGATTGAAACAGGCCTCT
CTTGGCTTGGAAAGTCTGCTCTGAACTCCAGAACTGAACGGTACTGACTGCACTGACTCGACTG
AACGAAACTGCACCGAGTTGATTGACTCCTTCTCCCTTTACTGCTCTTAAGTACCCTCTCTTCC
CTGTGCTGTCCTCCTGAGTCATGCTGCCAAATCTTTCTCTGATTCATCACTTCGCCCCTCAATT
AAACTGGCAATTTCAAACGTGGCACTTAGCATTTCAGTTGTAGTCACTTAATACTGCATTCAGA
ACTTGAGTCTATTGAATCCATAATGTGAAACCATGTCTTCGTGACTGTGACCTCACTACTCAGT
ATTGTGTAAAAGTTTTAGGAACTCTCCAAGTAAGCACTTGGTATTTGCTCATTGATAGAACAGA
AAAATGCTGTGTAGATAATAAATAAACACGGCTATAAGATTAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039098465 ⟹ XP_038954393

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	15,939,848 - 15,953,701 (-)	NCBI
mRatBN7.2	20	15,951,425 - 15,953,997 (-)	NCBI

RefSeq Acc Id:

XM_063278987 ⟹ XP_063135057

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	15,502,559 - 15,953,301 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_671479	(Get FASTA)	NCBI Sequence Viewer
	XP_038954393	(Get FASTA)	NCBI Sequence Viewer
	XP_063135057	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH63144	(Get FASTA)	NCBI Sequence Viewer
	AAL35221	(Get FASTA)	NCBI Sequence Viewer
	AAM95974	(Get FASTA)	NCBI Sequence Viewer
	ABY47884	(Get FASTA)	NCBI Sequence Viewer
	EDL97244	(Get FASTA)	NCBI Sequence Viewer
	EDL97245	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000067414
	ENSRNOP00000067414.1
GenBank Protein	Q8VIL3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_671479 ⟸ NM_147138

- UniProtKB:

Q546Y5 (UniProtKB/Swiss-Prot), Q8VIL3 (UniProtKB/Swiss-Prot), A6JKM9 (UniProtKB/TrEMBL), A0A8I6A1E2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MADAEKNAVAEKNAVAEENAVAEENAVADKNATKEVLAEAASVLEPVGLPEEAELPAKIMEEFM
RNSRKKDKLLCSQLQVVNFLQTFLAQEDNTDQNPDALASEDTSRQKATETKEQWKELKATYMDH
VDVIKCALSEALPQVKEAHRKYTELQKAFEQLEAKKRVLEEKLQLAQKQWVLQQKRLQNLTKIS
AEVKRRRKRALEKLDGSHQELETLKQQAGQEQEKLQRNQSYLQLLCSLQNKLVISESKADDKDV
KGPALPPKSP

hide sequence

Ensembl Acc Id:

ENSRNOP00000067414 ⟸ ENSRNOT00000074404

RefSeq Acc Id:	XP_038954393 ⟸ XM_039098465
- Peptide Label:	isoform X1
- UniProtKB:	Q8VIL3 (UniProtKB/Swiss-Prot), Q546Y5 (UniProtKB/Swiss-Prot), A6JKM9 (UniProtKB/TrEMBL), A0A8I6A1E2 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000085046 ⟸ ENSRNOT00000100712

RefSeq Acc Id:	XP_063135057 ⟸ XM_063278987
- Peptide Label:	isoform X1
- UniProtKB:	Q8VIL3 (UniProtKB/Swiss-Prot), Q546Y5 (UniProtKB/Swiss-Prot), A0A8I6A1E2 (UniProtKB/TrEMBL), A6JKM9 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8VIL3-F1-model_v2	AlphaFold	Q8VIL3	1-266	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701547

Promoter ID:

EPDNEW_R12071

Type:

multiple initiation site

Name:

Zwint_1

Description:

ZW10 interacting kinetochore protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	17,091,703 - 17,091,763	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628671	AgrOrtholog
BioCyc Gene	G2FUF-4077	BioCyc
Ensembl Genes	ENSRNOG00000048682	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000074404	ENTREZGENE
	ENSRNOT00000074404.3	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.4090	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6921645	IMAGE-MGC_LOAD
InterPro	Zwint-1	UniProtKB/Swiss-Prot
KEGG Report	rno:257644	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72643	IMAGE-MGC_LOAD
NCBI Gene	257644	ENTREZGENE
PANTHER	PTHR31504	UniProtKB/Swiss-Prot
	ZW10 INTERACTOR	UniProtKB/Swiss-Prot
Pfam	Zwint	UniProtKB/Swiss-Prot
PhenoGen	Zwint	PhenoGen
RatGTEx	ENSRNOG00000048682	RatGTEx
UniProt	A0A8I6A1E2	ENTREZGENE, UniProtKB/TrEMBL
	A6JKM8_RAT	UniProtKB/TrEMBL
	A6JKM9	ENTREZGENE, UniProtKB/TrEMBL
	Q546Y5	ENTREZGENE
	Q8VIL3	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q546Y5	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-09-17	Zwint	ZW10 interacting kinetochore protein	Zwint	ZW10 interactor, kinetochore protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-08-02	Zwint	ZW10 interactor, kinetochore protein	Zwint	ZW10 interactor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Zwint	ZW10 interactor	Sip30	SNAP25 interacting protein 30	Symbol and Name updated	1299863	APPROVED
2003-02-27	Sip30	SNAP25 interacting protein 30			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in brain, testis and kidney	633971
gene_physical_interaction	indirectly interacts with syntaxin	633971

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD