Foxe3 (forkhead box E3) - Rat Genome Database

Name: Foxe3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Foxe3 (forkhead box E3) Rattus norvegicus

Analyze

Symbol:

Foxe3

Name:

forkhead box E3

RGD ID:

621727

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in several processes, including camera-type eye development; mRNA transcription by RNA polymerase II; and negative regulation of lens fiber cell differentiation. Predicted to act upstream of or within several processes, including camera-type eye development; positive regulation of epithelial cell proliferation; and transcription by RNA polymerase II. Predicted to be located in nucleus. Predicted to be part of transcription regulator complex. Human ortholog(s) of this gene implicated in anterior segment dysgenesis; anterior segment dysgenesis 2; cataract 34 multiple types; and thoracic aortic aneurysm. Orthologous to human FOXE3 (forkhead box E3); INTERACTS WITH ammonium chloride; bisphenol A; capsaicin.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

forkhead box protein E3; forkhead-related protein FKHL12; forkhead-related transcription factor 8; FREAC-8; hepatocyte nuclear factor 3 forkhead homolog 7; HFH-7; HFH7; HNF3; LOC313505

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FOXE3 (forkhead box E3)	HGNC	EggNOG, Ensembl, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Foxe3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FOXE3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FOXE3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Foxe3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FOXE3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FOXE3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Foxe3 (forkhead box E3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FOXE1 (forkhead box E1)	HGNC	Treefam
Alliance orthologs ³
Homo sapiens (human):	FOXE3 (forkhead box E3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Foxe3 (forkhead box E3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	foxe3 (forkhead box E3)	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	foxe3	Alliance	DIOPT (Hieranoid\|OrthoFinder)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	133,681,684 - 133,683,266 (-)	NCBI		GRCr8
mRatBN7.2	5	128,444,912 - 128,446,494 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	128,445,594 - 128,446,454 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	131,134,744 - 131,135,604 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	132,864,382 - 132,865,242 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	132,886,063 - 132,886,923 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	133,724,796 - 133,725,656 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	133,724,796 - 133,725,656 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	137,517,035 - 137,517,895 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	135,285,688 - 135,286,548 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	135,291,289 - 135,291,591 (-)	NCBI
Celera	5	127,097,587 - 127,098,447 (-)	NCBI		Celera
Cytogenetic Map	5	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

anterior segment dysgenesis (ISO)

anterior segment dysgenesis 1 (ISO)

anterior segment dysgenesis 2 (ISO)

aortic dissection (ISO)

Aphakia (ISO)

cataract 34 multiple types (ISO)

congenital aphakia (ISO,ISS)

Familial Thoracic Aortic Aneurysm 1 (ISO)

Familial Thoracic Aortic Aneurysm 11 (ISO)

genetic disease (ISO)

thoracic aortic aneurysm (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

ammonium chloride (EXP)

amosite asbestos (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

capsaicin (EXP)

choline (ISO)

crocidolite asbestos (ISO)

decabromodiphenyl ether (EXP)

folic acid (ISO)

fulvestrant (ISO)

L-methionine (ISO)

Licochalcone B (ISO)

methotrexate (ISO)

Theaflavin 3,3'-digallate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anatomical structure morphogenesis (IBA)

camera-type eye development (ISO)

cell development (ISO)

cell differentiation (IBA)

ciliary body morphogenesis (ISO,ISS)

cornea development in camera-type eye (ISO,ISS)

epithelial cell proliferation (ISO)

eye development (ISO,ISS)

iris morphogenesis (ISO,ISS)

lens development in camera-type eye (ISO,ISS)

mRNA transcription by RNA polymerase II (ISO,ISS)

negative regulation of apoptotic process (ISO,ISS)

negative regulation of lens fiber cell differentiation (ISO,ISS)

positive regulation of epithelial cell proliferation (ISO)

positive regulation of lens epithelial cell proliferation (ISO,ISS)

regulation of cell cycle (ISO,ISS)

regulation of transcription by RNA polymerase II (IBA)

trabecular meshwork development (ISO,ISS)

transcription by RNA polymerase II (ISO)

Cellular Component

nucleus (ISO,ISS)

transcription regulator complex (ISO)

Molecular Function

DNA binding (ISO,ISS)

DNA-binding transcription factor activity (ISO,ISS,NAS)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

sequence-specific DNA binding (ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Foxe3 is required for morphogenesis and differentiation of the anterior segment of the eye and is sensitive to Pax6 gene dosage.	Blixt A, etal., Dev Biol. 2007 Feb 1;302(1):218-29. Epub 2006 Sep 16.
2.	Identification of nine tissue-specific transcription factors of the hepatocyte nuclear factor 3/forkhead DNA-binding-domain family.	Clevidence DE, etal., Proc Natl Acad Sci U S A 1993 May 1;90(9):3948-52.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Functional analysis of FOXE3 mutations causing dominant and recessive ocular anterior segment disease.	Islam L, etal., Hum Mutat. 2015 Mar;36(3):296-300. doi: 10.1002/humu.22741.
5.	Severe defects in proliferation and differentiation of lens cells in Foxe3 null mice.	Medina-Martinez O, etal., Mol Cell Biol. 2005 Oct;25(20):8854-63.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	Foxe3 haploinsufficiency in mice: a model for Peters' anomaly.	Ormestad M, etal., Invest Ophthalmol Vis Sci. 2002 May;43(5):1350-7.
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation
13.	Mutations in the human forkhead transcription factor FOXE3 associated with anterior segment ocular dysgenesis and cataracts.	Semina EV, etal., Hum Mol Genet. 2001 Feb 1;10(3):231-6.
14.	Homozygous nonsense mutation in the FOXE3 gene as a cause of congenital primary aphakia in humans.	Valleix S, etal., Am J Hum Genet. 2006 Aug;79(2):358-64. Epub 2006 Jun 8.
15.	Growth inhibition of human lens epithelial cells by short hairpin RNA in transcription factor forkhead box E3 (FOXE3).	Wang Y, etal., Graefes Arch Clin Exp Ophthalmol. 2012 Jul;250(7):999-1007. doi: 10.1007/s00417-012-1944-5. Epub 2012 Apr 18.

Additional References at PubMed

PMID:10652278	PMID:10890982	PMID:11309658	PMID:27218149

Genomics

Comparative Map Data

Foxe3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	133,681,684 - 133,683,266 (-)	NCBI		GRCr8
mRatBN7.2	5	128,444,912 - 128,446,494 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	128,445,594 - 128,446,454 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	131,134,744 - 131,135,604 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	132,864,382 - 132,865,242 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	132,886,063 - 132,886,923 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	133,724,796 - 133,725,656 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	133,724,796 - 133,725,656 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	137,517,035 - 137,517,895 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	135,285,688 - 135,286,548 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	135,291,289 - 135,291,591 (-)	NCBI
Celera	5	127,097,587 - 127,098,447 (-)	NCBI		Celera
Cytogenetic Map	5	q35	NCBI

FOXE3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	47,416,285 - 47,418,052 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	47,416,285 - 47,418,052 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	47,881,957 - 47,883,724 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	47,654,331 - 47,656,311 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	47,593,763 - 47,595,743	NCBI
Celera	1	46,168,009 - 46,170,038 (+)	NCBI		Celera
Cytogenetic Map	1	p33	NCBI
HuRef	1	45,998,176 - 46,000,072 (+)	NCBI		HuRef
CHM1_1	1	47,998,586 - 48,000,566 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	47,294,744 - 47,296,511 (+)	NCBI		T2T-CHM13v2.0

Foxe3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	114,781,640 - 114,783,264 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	114,782,344 - 114,783,210 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	114,924,443 - 114,926,067 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	114,925,147 - 114,926,013 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	114,597,752 - 114,598,618 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	114,423,079 - 114,423,945 (-)	NCBI		MGSCv36	mm8
Celera	4	113,672,921 - 113,673,787 (-)	NCBI		Celera
Cytogenetic Map	4	D1	NCBI
cM Map	4	52.73	NCBI

FOXE3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	179,398,703 - 179,400,477 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	178,540,120 - 178,541,894 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	46,710,791 - 46,712,771 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

FOXE3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	13,291,160 - 13,295,982 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	13,445,213 - 13,446,211 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	13,441,830 - 13,442,846 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	13,441,830 - 13,443,020 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	13,241,940 - 13,242,931 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	13,309,628 - 13,310,638 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	13,379,114 - 13,380,118 (-)	NCBI		UU_Cfam_GSD_1.0

Foxe3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	62,386,321 - 62,388,211 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	28,211,313 - 28,212,272 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	28,211,144 - 28,212,963 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FOXE3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	164,132,034 - 164,133,011 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	164,130,638 - 164,133,218 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	151,682,360 - 151,687,569 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FOXE3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	85,502,938 - 85,505,158 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	85,504,126 - 85,505,076 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	31,577,474 - 31,579,685 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Foxe3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624859	5,412,280 - 5,414,737 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Foxe3
9 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	57
Count of miRNA genes:	53
Interacting mature miRNAs:	57
Transcripts:	ENSRNOT00000010208
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	84132602	129132602	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	87468046	132468046	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	87765973	132765973	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	97570330	136479578	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	124160767	133749643	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	125392826	139989768	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	128033842	133011550	Rat

Markers in Region

Foxe3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	128,445,627 - 128,446,017 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	133,724,830 - 133,725,219	NCBI	Rnor6.0
Rnor_5.0	5	137,517,069 - 137,517,458	UniSTS	Rnor5.0
Celera	5	127,097,621 - 127,098,010	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	endocrine system	musculoskeletal system	nervous system	reproductive system
High
Medium
Low				6
Below cutoff	1	3	1	11	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_134339	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L13207	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000010208 ⟹ ENSRNOP00000010208

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	128,445,594 - 128,446,454 (-)	Ensembl
Rnor_6.0 Ensembl	5	133,724,796 - 133,725,656 (-)	Ensembl

RefSeq Acc Id:

NM_134339 ⟹ NP_599166

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	133,681,684 - 133,683,266 (-)	NCBI
mRatBN7.2	5	128,444,912 - 128,446,494 (-)	NCBI
Rnor_6.0	5	133,724,796 - 133,725,656 (-)	NCBI
Rnor_5.0	5	137,517,035 - 137,517,895 (-)	NCBI
Celera	5	127,097,587 - 127,098,447 (-)	NCBI

Sequence:

show sequence

ATGGATGCGCACGTCGCTTTCTCCGGCTTTCCGACCCTGCCCTCGGTCTCGCCGTCGGGGCCGC
AGCCTCCATCGCTGGCCGGAGACGAGCCCGGGCGCGAACCAGAGGAGGTGGTGGGCGGTGGGGA
CTCCGAGCCCCCGGCCGCGCCGGGCCCTGGGAGGCGACGTCGGCGGCCGCTACAGCGTGGGAAG
CCGCCTTACTCGTACATCGCTCTTATCGCTATGGCCCTGGCGCACGCTCCGGGCCGTCGTCTCA
CGCTGGCAGCCATCTACCGCTTCATCACCGAGCGCTTCGCCTTCTACCGCGACAGCCCGCGCAA
GTGGCAGAACAGCATCCGCCACAACCTCACCCTCAACGACTGCTTCGTCAAGGTGCCGCGCGAG
CCGGGCAATCCGGGCAAGGGCAACTACTGGACGCTCGATCCCGCGGCCGCCGACATGTTCGACA
ACGGCAGCTTCCTGCGGCGCCGCAAGCGCTTTAAGCGCACCGAGCTGCCCGCGCCGCCGCCACC
GCCCTTTCCCTACGCGCCCTTCCCGCCCGCACCTGCACCTGCGCCCGCACCGCCCGCGCGCCTC
TTCCGCCTGGACAGCCTGCTGGGCTTGCAAACCGAGCCGCCAGGACCCTTGGCGCCCGAGCCGC
CTTGCTGCGCCGCGCCCGACGCCTCCTTCCCGCCCTGCGCCGCCGCAGCCTCGCCGCCGCTCTA
CTCGCCCGCGCCCGAGCGCCTGGGGCTGCCCGCGCCGTTGCCGGCGGAGCCTCTCCTGGCCTTG
GCAGGATCGGCTGGCGCGCTGGGGCCACTCGGCGCCGGAGAAGCCTACCTGAGACAGCCGGGCT
TCCCGCCCGGGCTGGAGCGCTACCTGTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_599166	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41323	(Get FASTA)	NCBI Sequence Viewer
	EDL90326	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010208
	ENSRNOP00000010208.1
GenBank Protein	Q63250	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_599166 ⟸ NM_134339

- UniProtKB:

G3V6Y8 (UniProtKB/Swiss-Prot), Q63250 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MDAHVAFSGFPTLPSVSPSGPQPPSLAGDEPGREPEEVVGGGDSEPPAAPGPGRRRRRPLQRGK
PPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTLNDCFVKVPRE
PGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRTELPAPPPPPFPYAPFPPAPAPAPAPPARL
FRLDSLLGLQTEPPGPLAPEPPCCAAPDASFPPCAAAASPPLYSPAPERLGLPAPLPAEPLLAL
AGSAGALGPLGAGEAYLRQPGFPPGLERYL

hide sequence

RefSeq Acc Id:

ENSRNOP00000010208 ⟸ ENSRNOT00000010208

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63250-F1-model_v2	AlphaFold	Q63250	1-286	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621727	AgrOrtholog
BioCyc Gene	G2FUF-40308	BioCyc
Ensembl Genes	ENSRNOG00000007770	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010208	ENTREZGENE
	ENSRNOT00000010208.3	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.10.10	UniProtKB/Swiss-Prot
InterPro	Fork_head_dom	UniProtKB/Swiss-Prot
	TF_fork_head_CS_1	UniProtKB/Swiss-Prot
	TF_fork_head_CS_2	UniProtKB/Swiss-Prot
	WH-like_DNA-bd_sf	UniProtKB/Swiss-Prot
	WH_DNA-bd_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:171302	UniProtKB/Swiss-Prot
NCBI Gene	171302	ENTREZGENE
PANTHER	FORKHEAD BOX PROTEIN	UniProtKB/Swiss-Prot
	FORKHEAD BOX PROTEIN E3	UniProtKB/Swiss-Prot
Pfam	Forkhead	UniProtKB/Swiss-Prot
PhenoGen	Foxe3	PhenoGen
PRINTS	FORKHEAD	UniProtKB/Swiss-Prot
PROSITE	FORK_HEAD_1	UniProtKB/Swiss-Prot
	FORK_HEAD_2	UniProtKB/Swiss-Prot
	FORK_HEAD_3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007770	RatGTEx
SMART	SM00339	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46785	UniProtKB/Swiss-Prot
UniProt	FOXE3_RAT	UniProtKB/Swiss-Prot
	G3V6Y8	ENTREZGENE
	Q63250	ENTREZGENE
UniProt Secondary	G3V6Y8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-04-28	Foxe3	forkhead box E3	Foxe3_predicted	forkhead box E3 (predicted)	Data merged from RGD:1307553	737654	APPROVED
2005-01-20	Foxe3	forkhead box E3			Symbol and Name status set to approved	1299863	APPROVED
2005-01-12	Foxe3_predicted	forkhead box E3 (predicted)			Symbol and Name status set to approved	70820	APPROVED
2002-08-07	Foxe3	forkhead box E3			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in liver, brain, kidney, lung and intestine and have a tissue-restricted expression pattern	632667

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM