Ptf1a (pancreas associated transcription factor 1a)

Gene: Ptf1a (pancreas associated transcription factor 1a) Rattus norvegicus

Analyze

Symbol:

Ptf1a

Name:

pancreas associated transcription factor 1a

RGD ID:

621709

Description:

Enables RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in exocrine pancreas development and regulation of DNA-templated transcription. Located in cytoplasm and nucleus. Part of transcription regulator complex. Human ortholog(s) of this gene implicated in pancreatic agenesis. Orthologous to human PTF1A (pancreas associated transcription factor 1a); INTERACTS WITH ammonium chloride; bisphenol A; sodium dichromate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

bHLH transcription factor p48; p48 DNA-binding subunit of transcription factor PTF1; pancreas specific transcription factor, 1a; pancreas transcription factor 1 subunit alpha; pancreas-specific transcription factor 1a; PTF1-p48

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	86,959,621 - 86,961,475 (+)	NCBI		GRCr8
mRatBN7.2	17	82,051,281 - 82,053,135 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	82,051,281 - 82,053,135 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	85,516,340 - 85,518,202 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	89,351,776 - 89,353,638 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	83,368,532 - 83,370,394 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	86,199,623 - 86,201,477 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	86,199,623 - 86,201,477 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	87,911,175 - 87,913,029 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	93,494,689 - 93,496,543 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	93,505,521 - 93,507,376 (+)	NCBI
Celera	17	81,323,632 - 81,325,486 (+)	NCBI		Celera
Cytogenetic Map	17	q12.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cerebellar disease (ISO)

Chemical and Drug Induced Liver Injury (ISO)

Decreased Urinary Activity of Kallikrein (ISO)

diabetes mellitus (ISO)

genetic disease (ISO)

maturity-onset diabetes of the young (ISO)

maturity-onset diabetes of the young type 1 (ISO)

pancreatic agenesis (ISO)

Pancreatic Agenesis 2 (ISO)

Pancreatic Beta Cell Agenesis with Neonatal Diabetes Mellitus (ISO)

permanent neonatal diabetes mellitus (ISO)

Permanent Neonatal Diabetes Mellitus, with Cerebellar Agenesis (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

all-trans-retinol (ISO)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

choline (ISO)

crocidolite asbestos (ISO)

folic acid (ISO)

L-methionine (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

amacrine cell differentiation (ISO,ISS)

cell fate commitment (ISO)

cerebellum development (ISO,ISS)

developmental process (IBA)

exocrine pancreas development (IDA)

generation of neurons (ISO,ISS)

hindbrain development (ISO,ISS)

neuron differentiation (ISO)

neuron fate commitment (ISO)

pancreas development (ISO)

positive regulation of DNA-templated transcription (ISO,ISS)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of DNA-templated transcription (IDA,ISO)

regulation of neural retina development (ISO,ISS)

regulation of transcription by RNA polymerase II (IBA)

retina layer formation (ISO,ISS)

retina morphogenesis in camera-type eye (ISO)

retinoic acid receptor signaling pathway (ISO,ISS)

tissue development (ISO,ISS)

transcription by RNA polymerase II (ISO)

Cellular Component

cytoplasm (IDA)

nucleus (IDA)

transcription regulator complex (IDA,ISO)

Molecular Function

chromatin binding (ISO)

DNA binding (IDA,ISO,ISS)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (TAS)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

E-box binding (ISO)

protein binding (ISO)

protein dimerization activity (IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IDA)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IBA)

sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Role of the basic helix-loop-helix transcription factor p48 in the differentiation phenotype of exocrine pancreas cancer cells.	Adell T, etal., Cell Growth Differ. 2000 Mar;11(3):137-47.
2.	Identification of a cell-specific DNA-binding activity that interacts with a transcriptional activator of genes expressed in the acinar pancreas.	Cockell M, etal., Mol Cell Biol. 1989 Jun;9(6):2464-76.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Constitutive expression of the gene for the cell-specific p48 DNA-binding subunit of pancreas transcription factor 1 in cultured cells is under control of binding sites for transcription factors Sp1 and alphaCbf.	Knofler M, etal., J Biol Chem 1996 Sep 6;271(36):21993-2002.
6.	The p48 DNA-binding subunit of transcription factor PTF1 is a new exocrine pancreas-specific basic helix-loop-helix protein.	Krapp A, etal., EMBO J 1996 Aug 15;15(16):4317-29.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Isolation of the murine ribonuclease gene Rib-1: structure and tissue specific expression in pancreas and parotid gland.	Samuelson LC, etal., Nucleic Acids Res. 1991 Dec 25;19(24):6935-41.
14.	Nuclear targeting of the transcription factor PTF1 is mediated by a protein subunit that does not bind to the PTF1 cognate sequence.	Sommer L, etal., Cell. 1991 Nov 29;67(5):987-94.

Additional References at PubMed

PMID:2294404	PMID:9851981	PMID:11279116	PMID:11318877	PMID:12185368	PMID:15543146	PMID:16039563	PMID:16201968	PMID:17075007	PMID:17301087	PMID:17907943	PMID:17938243
PMID:18834332	PMID:19887377	PMID:22232429	PMID:23616538	PMID:23639443	PMID:25063451

Genomics

Comparative Map Data

Ptf1a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	86,959,621 - 86,961,475 (+)	NCBI		GRCr8
mRatBN7.2	17	82,051,281 - 82,053,135 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	82,051,281 - 82,053,135 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	85,516,340 - 85,518,202 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	89,351,776 - 89,353,638 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	83,368,532 - 83,370,394 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	86,199,623 - 86,201,477 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	86,199,623 - 86,201,477 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	87,911,175 - 87,913,029 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	93,494,689 - 93,496,543 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	93,505,521 - 93,507,376 (+)	NCBI
Celera	17	81,323,632 - 81,325,486 (+)	NCBI		Celera
Cytogenetic Map	17	q12.3	NCBI

PTF1A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	23,192,312 - 23,194,245 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	23,192,312 - 23,194,245 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	23,481,241 - 23,483,174 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	23,521,466 - 23,523,187 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	23,521,465 - 23,522,841	NCBI
Celera	10	23,169,055 - 23,170,776 (+)	NCBI		Celera
Cytogenetic Map	10	p12.2	NCBI
HuRef	10	23,141,665 - 23,143,386 (+)	NCBI		HuRef
CHM1_1	10	23,481,988 - 23,483,709 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	23,211,306 - 23,213,239 (+)	NCBI		T2T-CHM13v2.0

Ptf1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	19,450,474 - 19,452,312 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	19,450,474 - 19,452,312 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	19,445,663 - 19,447,501 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	19,445,663 - 19,447,501 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	19,367,290 - 19,369,128 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	19,363,417 - 19,365,246 (+)	NCBI		MGSCv36	mm8
Celera	2	19,344,731 - 19,346,569 (+)	NCBI		Celera
Cytogenetic Map	2	A3	NCBI
cM Map	2	13.37	NCBI

Ptf1a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955429	5,808,124 - 5,809,522 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955429	5,807,804 - 5,809,522 (-)	NCBI	ChiLan1.0	ChiLan1.0

PTF1A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	35,862,703 - 35,883,010 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	35,868,097 - 35,888,336 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	23,356,165 - 23,359,579 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	23,731,808 - 23,732,880 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

PTF1A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	10,069,594 - 10,071,360 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	10,069,581 - 10,071,336 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	8,761,404 - 8,763,210 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	8,265,759 - 8,267,565 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	8,265,753 - 8,267,830 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	7,631,134 - 7,632,939 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	7,715,133 - 7,716,942 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	7,882,444 - 7,884,250 (-)	NCBI		UU_Cfam_GSD_1.0

Ptf1a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	22,979,751 - 22,981,585 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936520	4,978,896 - 4,980,648 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936520	4,978,896 - 4,980,648 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PTF1A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	51,817,924 - 51,819,960 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	10	51,817,697 - 51,820,147 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	57,473,803 - 57,475,233 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PTF1A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	22,944,122 - 22,965,905 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	22,964,164 - 22,965,565 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666051	28,727,857 - 28,729,812 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ptf1a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624796	5,549,184 - 5,550,439 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624796	5,548,982 - 5,550,563 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ptf1a
9 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	41
Count of miRNA genes:	30
Interacting mature miRNAs:	37
Transcripts:	ENSRNOT00000022727
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	0.00000071	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
7411575	Bw140	Body weight QTL 140	30.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
8694181	Bw151	Body weight QTL 151	4.36	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	49920154	86533673	Rat
2303580	Gluco49	Glucose level QTL 49	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	50040271	86533673	Rat
4889894	Eae33	Experimental allergic encephalomyelitis QTL 33	5.2	0.0001	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	50909099	86022412	Rat
1354588	Bvd4	Brain ventricular dilatation QTL 4	5.31	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	53498828	82479847	Rat
2317045	Aia11	Adjuvant induced arthritis QTL 11	4.06		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	60781426	86533673	Rat
7411577	Bw141	Body weight QTL 141		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	62619516	86533673	Rat
12904736	Cm121	Cardiac mass QTL 121		0.043	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	71774621	82479847	Rat

Markers in Region

Ptf1a

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	82,052,259 - 82,052,681 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	86,200,602 - 86,201,023	NCBI	Rnor6.0
Rnor_5.0	17	87,912,154 - 87,912,575	UniSTS	Rnor5.0
RGSC_v3.4	17	93,495,668 - 93,496,089	UniSTS	RGSC3.4
Celera	17	81,324,611 - 81,325,032	UniSTS
Cytogenetic Map	17	q12.3	UniSTS

Ptf1a

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	82,052,268 - 82,052,699 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	86,200,611 - 86,201,041	NCBI	Rnor6.0
Rnor_5.0	17	87,912,163 - 87,912,593	UniSTS	Rnor5.0
RGSC_v3.4	17	93,495,677 - 93,496,107	UniSTS	RGSC3.4
Celera	17	81,324,620 - 81,325,050	UniSTS
Cytogenetic Map	17	q12.3	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	nervous system	renal system	reproductive system
High
Medium
Low	2	2	7	2	13
Below cutoff	7	6	2	6	19	2	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X98170	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X98446	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000022727 ⟹ ENSRNOP00000022727

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	82,051,281 - 82,053,135 (+)	Ensembl
Rnor_6.0 Ensembl	17	86,199,623 - 86,201,477 (+)	Ensembl

RefSeq Acc Id:

NM_053964 ⟹ NP_446416

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	86,959,621 - 86,961,475 (+)	NCBI
mRatBN7.2	17	82,051,281 - 82,053,135 (+)	NCBI
Rnor_6.0	17	86,199,623 - 86,201,477 (+)	NCBI
Rnor_5.0	17	87,911,175 - 87,913,029 (+)	NCBI
RGSC_v3.4	17	93,494,689 - 93,496,543 (+)	RGD
Celera	17	81,323,632 - 81,325,486 (+)	RGD

Sequence:

show sequence

AACTCCAGCAAGCGGGTCCCAGCCCTCCCCAGTGCATCCCCAGAGCCAGTCAGAGCCAGAGGCC
GCCGCGCACTCCAGGGAGGCCCCGGGGCGGGGAGGGGTGGCGCCTCGCCATCTCCAACGCCAAC
CCCACGAGGGAGGGGCTGCGGGCAATACCCGAACTGCCACAGATCACGCACAAAGCGTCACCCG
GCGCAGCCCATCAGTCCCTTGAGGCCTCAGTGGCGGACGACATGGACGCCGTGCTCCTGGAGCA
TTTTCCCGGGGCCCTGGACACCTTCCCGTCCTCTTACTTCGATGAGGAAGATTTCTTCACCGAT
CAGTCCTCTCGGGACCCACTGGAGGACGGCGACGAGCTGCTGGGGGATGAGCAGGCGGAGGTAG
AGTTCCTCAGTCACCAGCTGCACGAATACTGCTACCGCGACGGGGCGTGCCTGCTGCTGCAACC
TGCGCCCTCGGCGGCCCCGCACGCGCTCGCTCCGCCGCCTTTGGGGGACCCTGGCGAGCCCGAG
GACAGCGGCAGCTATTGCTGCGATGCAGGGGCGCCTCTTGGTGCCTTCCCCTACTCGCCTGGCT
CACCGCCCTCCTGTCTCGCCTACCCTTGCACCGCGGTACTGTCCCCCGGTACGCGGCTCCGTGG
TTTGAACGGGGCAGCGGCAGCGGCGGCGGCGGCCGCAAGGCGGCGGCGACGCGTGCGCTCCGAG
GCAGAGCTGCAGCAGCTGCGACAAGCGGCCAACGTGCGAGAGCGGCGCCGCATGCAGTCTATCA
ACGACGCCTTCGAGGGGCTGCGTTCGCACATCCCCACGCTGCCCTACGAAAAGCGCCTCTCCAA
GGTAGACACGCTGCGCTTAGCCATAGGCTACATTAACTTCCTCAGCGAGCTGGTGCAAGCCGAC
TTGCCACTGCGCGGGAGTGGCACAGGTGGTTGCGGGGGCCCAGGTGGCAGCCGGCACCTCGGAG
GGGACAGCCCAGGTAACCAGGCCCAGAAGGTCATCATCTGCCATCGAGGCACCCGTTCGCCCTC
CCCCAGCGACCCGGACTACGGTCTCCCTCCTCTTGCAGGGCACTCCCTTTCCTGGGCTGATGAA
AAACAGCTCAAAGAACAAAATATTATTCGTACAGCTAAAGTGTGGACCCCAGAGGACCCCAGAA
AACTCAACAGTAAATCTTTTGACAACATAGAGAACGAACCACCTTTTGAGTTTGTGTCCTGAGA
AAGCTCTCACAGGCCGGCTGTGTCTTTGTGCATATTGTACGTGTAAATACCTATAATGTAAATG
TAATTTAAAGACCACATTTTTCTAATGGCAATCAACTGTTTGTTATTTATCTATTTATTATGCT
GTTGAGTTAATGGAAATAGATTGTCTTTTTAAAAATATATAATTTATATAATTTATCGTGATAT
TCTATAATATGATTTCCCCAGAACCTTTGGCAGAACTCTGAACTGGAAGATCTCTGTCCGTGCT
TATTTAATGTCGGAATTGGTTTACTTCTGAGTGTTGCTAATAAATGCTATTCACACGGGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_446416	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA66851	(Get FASTA)	NCBI Sequence Viewer
	CAA67076	(Get FASTA)	NCBI Sequence Viewer
	EDL78780	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022727
	ENSRNOP00000022727.1
	ENSRNOP00055015422
	ENSRNOP00060029281
	ENSRNOP00065003133
GenBank Protein	Q64305	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446416 ⟸ NM_053964

- UniProtKB:

Q64305 (UniProtKB/Swiss-Prot), A6JMA2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDAVLLEHFPGALDTFPSSYFDEEDFFTDQSSRDPLEDGDELLGDEQAEVEFLSHQLHEYCYRD
GACLLLQPAPSAAPHALAPPPLGDPGEPEDSGSYCCDAGAPLGAFPYSPGSPPSCLAYPCTAVL
SPGTRLRGLNGAAAAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTL
PYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGTGGCGGPGGSRHLGGDSPGNQAQKVIIC
HRGTRSPSPSDPDYGLPPLAGHSLSWADEKQLKEQNIIRTAKVWTPEDPRKLNSKSFDNIENEP
PFEFVS

hide sequence

RefSeq Acc Id:

ENSRNOP00000022727 ⟸ ENSRNOT00000022727

Protein Domains

bHLH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q64305-F1-model_v2	AlphaFold	Q64305	1-326	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700608

Promoter ID:

EPDNEW_R11131

Type:

single initiation site

Name:

Ptf1a_1

Description:

pancreas specific transcription factor, 1a

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	86,199,629 - 86,199,689	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621709	AgrOrtholog
BioCyc Gene	G2FUF-8528	BioCyc
Ensembl Genes	ENSRNOG00000016902	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055011307	UniProtKB/Swiss-Prot
	ENSRNOG00060020572	UniProtKB/Swiss-Prot
	ENSRNOG00065003124	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000022727	ENTREZGENE
	ENSRNOT00000022727.3	UniProtKB/Swiss-Prot
	ENSRNOT00055019148	UniProtKB/Swiss-Prot
	ENSRNOT00060035615	UniProtKB/Swiss-Prot
	ENSRNOT00065004396	UniProtKB/Swiss-Prot
Gene3D-CATH	4.10.280.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	bHLH_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:117034	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	117034	ENTREZGENE
PANTHER	BASIC HELIX-LOOP-HELIX TRANSCRIPTION FACTOR, TWIST	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PANCREAS TRANSCRIPTION FACTOR 1 SUBUNIT ALPHA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ptf1a	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000016902	RatGTEx
	ENSRNOG00055011307	RatGTEx
	ENSRNOG00060020572	RatGTEx
	ENSRNOG00065003124	RatGTEx
SMART	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	HLH, helix-loop-helix DNA-binding domain	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6JMA2	ENTREZGENE, UniProtKB/TrEMBL
	PTF1A_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-03-01	Ptf1a	pancreas associated transcription factor 1a	Ptf1a	pancreas specific transcription factor, 1a	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Ptf1a	pancreas specific transcription factor, 1a			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Ptf1a	pancreas specific transcription factor, 1a			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expression is restricted to cells of the exocrine pancreas in the adult and to the pancreatic primordium in the embryo	633757

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM