Advanced Search (OLGA)

Gene: Hspb6 (heat shock protein family B (small) member 6) Rattus norvegicus

Analyze

Symbol:

Hspb6

Name:

heat shock protein family B (small) member 6

RGD ID:

621554

Description:

Enables protein homodimerization activity and protein kinase binding activity. Involved in negative regulation of cardiac muscle cell apoptotic process. Predicted to be located in extracellular region. Predicted to be active in cytoplasm and nucleus. Orthologous to human HSPB6 (heat shock protein family B (small) member 6); INTERACTS WITH (R)-adrenaline; 1,2,4-trimethylbenzene; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

heat shock 20 kDa-like protein p20; heat shock 20-kDa protein; heat shock protein beta-6; heat shock protein family B (small) member B6; heat shock protein, alpha-crystallin-related, B6; HSP20; Loc192245; p20

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	94,934,372 - 94,936,516 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	94,933,543 - 94,936,512 (+)	Ensembl				GRCr8
mRatBN7.2	1	85,806,898 - 85,809,072 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	85,806,146 - 85,809,071 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	91,223,661 - 91,225,800 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,689,826 - 99,691,965 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	92,981,941 - 92,984,080 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	89,008,117 - 89,010,256 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	89,008,117 - 89,010,256 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	90,162,932 - 90,165,071 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	85,599,075 - 85,601,214 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	80,178,449 - 80,180,588 (+)	NCBI		Celera
RGSC_v3.1	1	85,677,185 - 85,679,325 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

heart disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(R)-adrenaline (EXP)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

7H-xanthine (EXP)

9H-xanthine (EXP)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (EXP)

cantharidin (ISO)

captan (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

cisplatin (ISO)

cobalt dichloride (EXP)

copper atom (EXP)

copper(0) (EXP)

corticosterone (EXP)

cyclosporin A (EXP)

dexamethasone (ISO)

dibutyl phthalate (EXP)

diisononyl phthalate (ISO)

dimethylarsinic acid (EXP)

diquat (ISO)

diuron (EXP)

doxorubicin (EXP,ISO)

epoxiconazole (ISO)

ethanol (EXP)

folpet (ISO)

fulvestrant (ISO)

gentamycin (EXP)

graphite (ISO)

indometacin (ISO)

inulin (ISO)

leflunomide (ISO)

m-xylene (EXP)

methimazole (EXP)

methoxyacetic acid (EXP)

methoxychlor (EXP)

methylmercury chloride (EXP)

methylphenidate (ISO)

Monobutylphthalate (EXP)

nickel atom (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenylarsine oxide (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

progesterone (EXP)

resveratrol (ISO)

rotenone (EXP)

silicon dioxide (ISO)

sodium dichromate (ISO)

sunitinib (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

trovafloxacin (ISO)

tunicamycin (ISO)

undecane (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of apoptotic process (IBA)

negative regulation of cardiac muscle cell apoptotic process (IDA)

positive regulation of angiogenesis (IEA,ISO)

protein folding (IEA,ISO)

protein refolding (IBA)

response to heat (IBA)

Cellular Component

cytoplasm (IBA,IEA,ISO,ISS)

cytosol (IEA,ISO)

extracellular region (IEA,ISO)

nuclear speck (IEA,ISO)

nucleus (IBA,IEA,ISO,ISS)

Molecular Function

protein folding chaperone (IEA,ISO)

protein homodimerization activity (IPI)

protein kinase binding (IPI)

protein-folding chaperone binding (IEA,ISO)

structural constituent of eye lens (IEA)

unfolded protein binding (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Crystal structures of alpha-crystallin domain dimers of alphaB-crystallin and Hsp20.	Bagneris C, etal., J Mol Biol. 2009 Oct 9;392(5):1242-52. doi: 10.1016/j.jmb.2009.07.069. Epub 2009 Jul 30.
2.	Small heat-shock protein Hsp20 phosphorylation inhibits beta-agonist-induced cardiac apoptosis.	Fan GC, etal., Circ Res. 2004 Jun 11;94(11):1474-82. Epub 2004 Apr 22.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Inactivity-induced modulation of Hsp20 and Hsp25 content in rat hindlimb muscles.	Huey KA, etal., Muscle Nerve 2004 Jul;30(1):95-101.
6.	cDNA cloning of a 20-kDa protein (p20) highly homologous to small heat shock proteins: developmental and physiological changes in rat hindlimb muscles.	Inaguma Y, etal., Gene 1996 Oct 31;178(1-2):145-50.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Small heat shock protein 20 (Hsp20) facilitates nuclear import of protein kinase D 1 (PKD1) during cardiac hypertrophy.	Sin YY, etal., Cell Commun Signal. 2015 Mar 7;13:16. doi: 10.1186/s12964-015-0094-x.

Additional References at PubMed

PMID:8195168	PMID:10625651	PMID:12551873	PMID:14717697	PMID:15513950	PMID:18948619	PMID:19464326	PMID:19501592	PMID:19816949	PMID:19845507	PMID:22427880	PMID:23948568
PMID:26316108	PMID:26443497	PMID:27977738	PMID:29157081	PMID:30511325	PMID:35352799

Genomics

Comparative Map Data

Hspb6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	94,934,372 - 94,936,516 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	94,933,543 - 94,936,512 (+)	Ensembl				GRCr8
mRatBN7.2	1	85,806,898 - 85,809,072 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	85,806,146 - 85,809,071 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	91,223,661 - 91,225,800 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,689,826 - 99,691,965 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	92,981,941 - 92,984,080 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	89,008,117 - 89,010,256 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	89,008,117 - 89,010,256 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	90,162,932 - 90,165,071 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	85,599,075 - 85,601,214 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	80,178,449 - 80,180,588 (+)	NCBI		Celera
RGSC_v3.1	1	85,677,185 - 85,679,325 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

HSPB6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	35,754,566 - 35,757,029 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	35,754,566 - 35,758,079 (-)	Ensembl			hg38	GRCh38
GRCh37	19	36,245,467 - 36,247,930 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	40,937,310 - 40,939,770 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	40,937,309 - 40,939,770	NCBI
Celera	19	32,958,948 - 32,961,408 (-)	NCBI		Celera
Cytogenetic Map	19	q13.12	NCBI
HuRef	19	32,750,462 - 32,752,811 (-)	NCBI		HuRef
CHM1_1	19	36,246,780 - 36,249,243 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	38,299,879 - 38,302,342 (-)	NCBI		T2T-CHM13v2.0

Hspb6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	30,251,961 - 30,254,868 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	30,251,603 - 30,254,868 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	30,552,535 - 30,555,443 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	30,552,178 - 30,555,443 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	31,338,321 - 31,340,458 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	30,262,062 - 30,264,199 (+)	NCBI		MGSCv36	mm8
Celera	7	25,145,072 - 25,147,201 (+)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	18.56	NCBI

Hspb6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	2,797,076 - 2,800,546 (+)	Ensembl
ChiLan1.0	NW_004955468	2,797,076 - 2,799,589 (+)	NCBI	ChiLan1.0	ChiLan1.0

HSPB6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	41,748,846 - 41,752,205 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	43,734,174 - 43,737,533 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	32,684,355 - 32,686,833 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	41,418,655 - 41,421,012 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	41,419,608 - 41,420,972 (-)	Ensembl			panPan2	panpan1.1

HSPB6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	116,878,370 - 116,880,852 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	116,878,396 - 116,879,943 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	116,283,627 - 116,286,116 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	117,481,343 - 117,483,832 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	117,481,362 - 117,483,467 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	117,044,719 - 117,047,208 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	116,668,337 - 116,670,826 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	117,723,717 - 117,726,206 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Hspb6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	11,074,783 - 11,077,227 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936570	567,860 - 571,402 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936570	568,708 - 571,099 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HSPB6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	45,181,443 - 45,183,998 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	45,181,439 - 45,184,011 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	40,636,893 - 40,639,463 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HSPB6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	30,664,355 - 30,666,841 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	30,665,315 - 30,666,802 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	8,455,715 - 8,458,214 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hspb6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	10,060,732 - 10,063,903 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624794	10,060,728 - 10,063,800 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Hspb6
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	165,454,295 - 165,457,082 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Hspb6
10 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	353
Count of miRNA genes:	169
Interacting mature miRNAs:	193
Transcripts:	ENSRNOT00000028401
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	92963855	109494029	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	92683681	137683681	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	92683681	137683681	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat

Markers in Region

RH128196

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	85,808,803 - 85,808,994 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	89,009,993 - 89,010,183	NCBI	Rnor6.0
Rnor_5.0	1	90,164,808 - 90,164,998	UniSTS	Rnor5.0
RGSC_v3.4	1	85,600,951 - 85,601,141	UniSTS	RGSC3.4
Celera	1	80,180,325 - 80,180,515	UniSTS
RH 3.4 Map	1	851.7	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	91	59	6	355	191	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138887	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092870	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063279355	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC141526	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D29960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214730	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215336	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215890	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217608	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230043	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028401 ⟹ ENSRNOP00000028401

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	94,933,543 - 94,936,512 (+)	Ensembl
mRatBN7.2 Ensembl	1	85,806,146 - 85,809,068 (+)	Ensembl
Rnor_6.0 Ensembl	1	89,008,117 - 89,010,256 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100627 ⟹ ENSRNOP00000084902

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	85,806,146 - 85,809,071 (+)	Ensembl

RefSeq Acc Id:

NM_138887 ⟹ NP_620242

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,934,372 - 94,936,511 (+)	NCBI
mRatBN7.2	1	85,806,928 - 85,809,067 (+)	NCBI
Rnor_6.0	1	89,008,117 - 89,010,256 (+)	NCBI
Rnor_5.0	1	90,162,932 - 90,165,071 (+)	NCBI
RGSC_v3.4	1	85,599,075 - 85,601,214 (+)	RGD
Celera	1	80,178,449 - 80,180,588 (+)	RGD

Sequence:

show sequence

GCAGGATGGAGATCCGGGTGCCTGTGCAGCCTTCTTGGCTGCGCCGTGCTTCAGCTCCTTTACC
GGGTTTTTCCACTCCGGGACGCCTCTTTGACCAGCGTTTCGGCGAAGGGCTGCTTGAGGCAGAG
CTGGCTTCACTGTGCCCTGCTGCGATCGCGCCCTACTATCTGCGCGCCCCCAGTGTGGCGTTAC
CCACAGCCCAGGTGCCCACGGACCCTGGGTATTTTTCTGTGCTGCTGGATGTGAAGCACTTCTC
GCCAGAGGAAATCTCTGTCAAGGTGGTTGGTGACCATGTGGAGGTCCATGCTCGGCATGAGGAG
CGCCCAGATGAACATGGATTCATTGCTCGAGAGTTCCACCGCCGATACCGCCTGCCTCCTGGCG
TGGACCCTGCTGCAGTGACCTCTGCACTGTCTCCTGAGGGTGTTCTGTCTATCCAGGCCACACC
AGCGTCGGCCCAGGCCTCACTTCCGTCACCACCTGCTGCCAAGTAGGGGTCCCAGCATTACAGG
ACCGAACCGGGAAGCCTCTTTAGGCTCCCTTTTAAAATGCCGATCTGACTCCACTGCCCAGCCA
GATGTCCCAATCGCTGTCAAGACAGCCTTTCCCAACCACAACTAGATGTCCTCCCCTGAGACCT
TCCCAACCCAAACCCTACCTGAGCCTTAGTGACCTAGACACCCTTCCTAAGCCCTCTCCCAGCT
TTCAGGCCCCACCCATGACATCTCTCTAGAGGCAACACAAACACTACTGTCAGGAGCCAAGGCT
CCCATCAGACTGACCCCACTTTGGGCTTCTCTCACACTCAGGCTGCATTTGTGAGCTGTAGAAC
ACCCCACCGTGACAGCAGAGTACAATGTAGTCAGCGCTCCCCTCCTTCCAATCCTGTCACCTAA
TTCCCCACAGTGATGTAGACTGCATAGGCTTTCCACACCAGAACGCTCAAGCCTGGTCCACCAG
ACTCCAGTCTCTGTAACCTAACACTCCTCTGCCCCAGCCCACTGTCTGACTTAAAACTCCAGGC
ACCGAAATTCTTGAATACTATTCTGACCTCCAATTCTTGGGACTCCTATTCCTGACAAACCAGG
AACCCCAAACTCAAATTGTATGGACACTCCACCTTCTCCAGATGTGCTAGACCAATGAACAAGA
ACCTGTGAGCTCTCTGTCCTGGCTCCCCATCTGCAGTCAGATGTCTTAGGGAGCCCGCTCCACA
TCTGCCATCCTCTAAGGTTGCACCTTCACTCTGAACATTTCCTGTCTCCCCAGGCCTTCCTGCC
ATTAGTTCCCAATAAATGCACTTGAGATTT

hide sequence

RefSeq Acc Id:

XM_039092870 ⟹ XP_038948798

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,934,377 - 94,936,516 (+)	NCBI
mRatBN7.2	1	85,806,898 - 85,809,072 (+)	NCBI

RefSeq Acc Id:

XM_063279355 ⟹ XP_063135425

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,934,377 - 94,936,516 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_620242	(Get FASTA)	NCBI Sequence Viewer
	XP_038948798	(Get FASTA)	NCBI Sequence Viewer
	XP_063135425	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA06227	(Get FASTA)	NCBI Sequence Viewer
	EDM07749	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028401
	ENSRNOP00000028401.1
GenBank Protein	P97541	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_620242 ⟸ NM_138887
- UniProtKB:	P97541 (UniProtKB/Swiss-Prot), A6J9Y5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEIRVPVQPSWLRRASAPLPGFSTPGRLFDQRFGEGLLEAELASLCPAAIAPYYLRAPSVALPT AQVPTDPGYFSVLLDVKHFSPEEISVKVVGDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVD PAAVTSALSPEGVLSIQATPASAQASLPSPPAAK hide sequence

Ensembl Acc Id:

ENSRNOP00000028401 ⟸ ENSRNOT00000028401

RefSeq Acc Id:	XP_038948798 ⟸ XM_039092870
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000084902 ⟸ ENSRNOT00000100627

RefSeq Acc Id:	XP_063135425 ⟸ XM_063279355
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A0A0 (UniProtKB/TrEMBL)

Protein Domains

sHSP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P97541-F1-model_v2	AlphaFold	P97541	1-162	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689920

Promoter ID:

EPDNEW_R444

Type:

multiple initiation site

Name:

Hspb6_1

Description:

heat shock protein family B member 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	89,008,088 - 89,008,148	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621554	AgrOrtholog
BioCyc Gene	G2FUF-60099	BioCyc
Ensembl Genes	ENSRNOG00000020922	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000028401	ENTREZGENE
	ENSRNOT00000028401.5	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.40.790	UniProtKB/Swiss-Prot
InterPro	A-crystallin/Hsp20_dom	UniProtKB/Swiss-Prot
	Alpha-crystallin/HSP	UniProtKB/Swiss-Prot
	Alpha-crystallin_N	UniProtKB/Swiss-Prot
	HSP20-like_chaperone	UniProtKB/Swiss-Prot
KEGG Report	rno:192245	UniProtKB/Swiss-Prot
NCBI Gene	192245	ENTREZGENE
PANTHER	HEAT SHOCK PROTEIN BETA-6	UniProtKB/Swiss-Prot
	PTHR45640	UniProtKB/Swiss-Prot
Pfam	Crystallin	UniProtKB/Swiss-Prot
	HSP20	UniProtKB/Swiss-Prot
PhenoGen	Hspb6	PhenoGen
PRINTS	ACRYSTALLIN	UniProtKB/Swiss-Prot
PROSITE	SHSP	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000020922	RatGTEx
Superfamily-SCOP	SSF49764	UniProtKB/Swiss-Prot
UniProt	A0A8I6A0A0	ENTREZGENE
	A6J9Y5	ENTREZGENE, UniProtKB/TrEMBL
	HSPB6_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-02	Hspb6	heat shock protein family B (small) member 6	Hspb6	heat shock protein family B (small) member B6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-11-25	Hspb6	heat shock protein family B (small) member B6	Hspb6	heat shock protein, alpha-crystallin-related, B6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Hspb6	heat shock protein, alpha-crystallin-related, B6	Loc192245	heat shock 20-kDa protein	Symbol and Name updated	1299863	APPROVED
2002-08-07	Loc192245	heat shock 20-kDa protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_product	member of the small heat-shock protein family	633218
gene_protein	162 amino acids	633218

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD