Advanced Search (OLGA)

Gene: Pglyrp1 (peptidoglycan recognition protein 1) Rattus norvegicus

Analyze

Symbol:

Pglyrp1

Name:

peptidoglycan recognition protein 1

RGD ID:

621429

Description:

Predicted to enable several functions, including Hsp70 protein binding activity; peptidoglycan binding activity; and peptidoglycan immune receptor activity. Involved in regulation of circadian sleep/wake cycle, sleep. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to human PGLYRP1 (peptidoglycan recognition protein 1); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

peptidoglycan recognition protein; Pglyrp; Pgrp; PGRP-S

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PGLYRP1 (peptidoglycan recognition protein 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Pglyrp1 (peptidoglycan recognition protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pglyrp1 (peptidoglycan recognition protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PGLYRP1 (peptidoglycan recognition protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PGLYRP1 (peptidoglycan recognition protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pglyrp1 (peptidoglycan recognition protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PGLYRP1 (peptidoglycan recognition protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PGLYRP1 (peptidoglycan recognition protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pglyrp1 (peptidoglycan recognition protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pglyrp1 (peptidoglycan recognition protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Pglyrp1 (peptidoglycan recognition protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PGLYRP1 (peptidoglycan recognition protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pglyrp5 (peptidoglycan recognition protein 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	PGRP-SB1	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector)
Drosophila melanogaster (fruit fly):	PGRP-SB1	Alliance	DIOPT (InParanoid\|OMA\|OrthoInspector)
Drosophila melanogaster (fruit fly):	PGRP-SC1a	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	PGRP-SC1a	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	PGRP-SC1b	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	PGRP-SC1b	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	PGRP-SC2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	PGRP-SC2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pglyrp1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pglyrp1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	pglyrp1-like.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pglyrp1-like.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	87,659,863 - 87,665,048 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	87,651,271 - 87,665,048 (+)	Ensembl				GRCr8
mRatBN7.2	1	78,531,815 - 78,537,001 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	78,531,815 - 78,537,001 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	83,920,938 - 83,926,080 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	92,478,152 - 92,483,315 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	85,676,048 - 85,681,190 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	79,790,879 - 79,796,064 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	79,790,705 - 79,796,111 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	81,052,612 - 81,057,412 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	78,235,474 - 78,240,665 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	72,998,755 - 73,003,829 (+)	NCBI		Celera
RGSC_v3.1	1	78,313,584 - 78,318,776 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain Injuries (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

7,12-dimethyltetraphene (ISO)

acetamide (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

captan (ISO)

carbon nanotube (ISO)

carnosic acid (ISO)

chlordecone (ISO)

choline (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

crocidolite asbestos (ISO)

Dibutyl phosphate (ISO)

diethylstilbestrol (ISO)

dioxygen (EXP)

fenthion (ISO)

flavonoids (EXP)

folic acid (ISO)

fulvestrant (ISO)

genistein (ISO)

hexachlorobenzene (EXP)

hydrogen sulfide (ISO)

L-methionine (ISO)

lead(0) (ISO)

metacetamol (ISO)

methidathion (ISO)

nickel sulfate (ISO)

nitrofen (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

pirinixic acid (ISO)

progesterone (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

testosterone (EXP)

titanium dioxide (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

tungsten (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antimicrobial humoral immune response mediated by antimicrobial peptide (ISO)

biological process involved in interaction with host (ISO)

defense response to bacterium (IEA)

defense response to Gram-positive bacterium (IBA,ISO)

detection of bacterium (ISO)

immune response (IBA,TAS)

immune system process (IEA)

innate immune response (IEA)

negative regulation of inflammatory response (ISO)

negative regulation of natural killer cell differentiation involved in immune response (ISO)

negative regulation of type II interferon production (ISO)

peptidoglycan catabolic process (IEA)

regulation of circadian sleep/wake cycle, sleep (IEP)

regulation of multicellular organismal process (IEA)

response to bacterium (ISO)

signal transduction (IEA)

Cellular Component

extracellular region (IEA)

extracellular space (IBA,ISO)

Molecular Function

Hsp70 protein binding (ISO)

molecular adaptor activity (ISO)

N-acetylmuramoyl-L-alanine amidase activity (IBA,IEA)

peptidoglycan binding (IEA,ISO,ISS)

peptidoglycan immune receptor activity (IBA,ISO,TAS)

receptor ligand activity (ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	The cloning of a rat peptidoglycan recognition protein (PGRP) and its induction in brain by sleep deprivation.	Rehman A, etal., Cytokine 2001 Jan 7;13(1):8-17.
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11461926	PMID:16354652	PMID:16930467	PMID:17502600	PMID:19056867	PMID:19218085	PMID:20709292	PMID:22206666	PMID:23012479	PMID:23376485	PMID:23533145

Genomics

Comparative Map Data

Pglyrp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	87,659,863 - 87,665,048 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	87,651,271 - 87,665,048 (+)	Ensembl				GRCr8
mRatBN7.2	1	78,531,815 - 78,537,001 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	78,531,815 - 78,537,001 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	83,920,938 - 83,926,080 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	92,478,152 - 92,483,315 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	85,676,048 - 85,681,190 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	79,790,879 - 79,796,064 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	79,790,705 - 79,796,111 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	81,052,612 - 81,057,412 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	78,235,474 - 78,240,665 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	72,998,755 - 73,003,829 (+)	NCBI		Celera
RGSC_v3.1	1	78,313,584 - 78,318,776 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

PGLYRP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	46,019,153 - 46,023,053 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	46,019,153 - 46,023,053 (-)	Ensembl			hg38	GRCh38
GRCh37	19	46,522,411 - 46,526,311 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	51,214,281 - 51,218,163 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	51,214,280 - 51,218,163	NCBI
Celera	19	43,327,424 - 43,331,569 (-)	NCBI		Celera
Cytogenetic Map	19	q13.32	NCBI
HuRef	19	42,950,408 - 42,954,553 (-)	NCBI		HuRef
CHM1_1	19	46,524,786 - 46,528,931 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	48,846,608 - 48,850,508 (-)	NCBI		T2T-CHM13v2.0

Pglyrp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	18,618,615 - 18,624,363 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	18,605,256 - 18,624,384 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	18,884,690 - 18,890,438 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	18,871,331 - 18,890,459 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	19,470,039 - 19,475,787 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	18,043,212 - 18,048,960 (+)	NCBI		MGSCv36	mm8
Celera	7	16,300,004 - 16,301,170 (+)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	9.38	NCBI

Pglyrp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955574	424,142 - 427,540 (-)	Ensembl
ChiLan1.0	NW_004955574	424,046 - 427,675 (-)	NCBI	ChiLan1.0	ChiLan1.0

PGLYRP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	52,189,551 - 52,193,385 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	54,060,654 - 54,064,596 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	43,033,080 - 43,037,726 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	51,569,275 - 51,573,764 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	51,569,275 - 51,573,764 (-)	Ensembl			panPan2	panpan1.1

PGLYRP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	109,614,404 - 109,618,242 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	109,614,437 - 109,618,242 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	109,097,721 - 109,101,584 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	110,145,349 - 110,149,427 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	110,105,232 - 110,149,439 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	109,821,146 - 109,825,013 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	109,455,876 - 109,459,739 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	110,324,620 - 110,328,483 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pglyrp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	17,969,780 - 17,973,488 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936706	2,315,132 - 2,320,796 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936706	2,317,137 - 2,320,993 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PGLYRP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	52,318,531 - 52,322,638 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	52,318,544 - 52,322,504 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	47,708,977 - 47,712,942 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PGLYRP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	39,474,077 - 39,478,635 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	39,474,170 - 39,477,914 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	19,118,432 - 19,122,570 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pglyrp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	7,221,064 - 7,224,615 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624832	7,220,739 - 7,225,146 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pglyrp1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	171,732,552 - 171,738,687 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pglyrp1
30 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	77
Count of miRNA genes:	70
Interacting mature miRNAs:	72
Transcripts:	ENSRNOT00000018233
Prediction methods:	Microtar, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	46302615	91302615	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	46302615	91302615	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	46302615	91302615	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	46302615	91302615	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	51909206	91302615	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	46302615	91302615	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	43509952	88509952	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	46302615	91302615	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	12	66	158	87	86	55	91	55	6	347	190	11	134	79	91	31	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053373	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC110846	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF154114	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018233 ⟹ ENSRNOP00000018233

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	87,656,074 - 87,665,048 (+)	Ensembl
mRatBN7.2 Ensembl	1	78,531,815 - 78,537,001 (+)	Ensembl
Rnor_6.0 Ensembl	1	79,790,705 - 79,796,111 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107062 ⟹ ENSRNOP00000107755

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	87,651,271 - 87,665,048 (+)	Ensembl

RefSeq Acc Id:

NM_053373 ⟹ NP_445825

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	87,659,863 - 87,665,048 (+)	NCBI
mRatBN7.2	1	78,531,815 - 78,537,001 (+)	NCBI
Rnor_6.0	1	79,790,879 - 79,796,064 (+)	NCBI
Rnor_5.0	1	81,052,612 - 81,057,412 (+)	NCBI
RGSC_v3.4	1	78,235,474 - 78,240,665 (+)	RGD
Celera	1	72,998,755 - 73,003,829 (+)	RGD

Sequence:

show sequence

CGTGTGCAGCACGTCCAGCATGTTGTTTGCCTGGGCTCCCTTCCCTGCCCTCCTGGGCCTGGCA
GACTCCTGCTGTTTCGTCGTGCCCCGCAGTGAGTGGAAGGCCCTGCCATCCGAGTGCTCCAAGG
GCCTGAAGAAACCAGTCCGCTACGTGGTGATCTCACACACAGCCGGCAGCTTCTGCAGCAGCCC
AGACTCCTGTGAACAGCAGGCCCGCAATGTGCAGCTTTACCAAATGAAACAGCTGGGCTGGTGC
GATGTAGCCTACAACTTCCTCATTGGAGAGGATGGTCATGTCTACGAAGGCCGAGGCTGGACCA
TCAAGGGTGACCACACAGGGCCCATCTGGAACCCCATGTCTATCGGCATCACCTTCATGGGTGA
CTACTCACACCGGGTACCTGCAAAGCGGGCTCTCCGTGCTGCCCTAAATCTTCTGAAATGTGGG
GTGTCTGAGGGCTTCCTGAGATCTAACTATGAGGTCAAAGGACATCGAGATGTGCAAAGCACTC
TGTCTCCAGGTGACCAGCTCTACGAGATCATCCAAAGCTGGGACCACTACCGAGAGTGAGATCT
TGAGACCTTGTGGAGTTCCCACCCTGAAATCCCTCCTACCACCTGCTGCTTCCC

hide sequence

Protein Sequences


Protein RefSeqs	NP_445825	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF73252	(Get FASTA)	NCBI Sequence Viewer
	EDM08252	(Get FASTA)	NCBI Sequence Viewer
	EDM08253	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018233
GenBank Protein	Q9JLN4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_445825 ⟸ NM_053373
- Peptide Label:	precursor
- UniProtKB:	Q9JLN4 (UniProtKB/Swiss-Prot), A6J8I2 (UniProtKB/TrEMBL), G3V7R2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLFAWAPFPALLGLADSCCFVVPRSEWKALPSECSKGLKKPVRYVVISHTAGSFCSSPDSCEQQ ARNVQLYQMKQLGWCDVAYNFLIGEDGHVYEGRGWTIKGDHTGPIWNPMSIGITFMGDYSHRVP AKRALRAALNLLKCGVSEGFLRSNYEVKGHRDVQSTLSPGDQLYEIIQSWDHYRE hide sequence

Ensembl Acc Id:

ENSRNOP00000018233 ⟸ ENSRNOT00000018233

Ensembl Acc Id:

ENSRNOP00000107755 ⟸ ENSRNOT00000107062

Protein Domains

N-acetylmuramoyl-L-alanine amidase Peptidoglycan recognition protein family

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JLN4-F1-model_v2	AlphaFold	Q9JLN4	1-183	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689751

Promoter ID:

EPDNEW_R275

Type:

single initiation site

Name:

Pglyrp1_1

Description:

peptidoglycan recognition protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	79,790,861 - 79,790,921	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621429	AgrOrtholog
BioCyc Gene	G2FUF-60549	BioCyc
Ensembl Genes	ENSRNOG00000013395	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000018233	ENTREZGENE
Gene3D-CATH	3.40.80.10	UniProtKB/Swiss-Prot
InterPro	Amidase/PGRP_sf	UniProtKB/Swiss-Prot
	Amidase_domain	UniProtKB/Swiss-Prot
	Peptidoglycan_recognition	UniProtKB/Swiss-Prot
	PGRP	UniProtKB/Swiss-Prot
	PGRP_domain_met/bac	UniProtKB/Swiss-Prot
KEGG Report	rno:84387	UniProtKB/Swiss-Prot
NCBI Gene	84387	ENTREZGENE
PANTHER	PEPTIDOGLYCAN RECOGNITION PROTEIN 1	UniProtKB/Swiss-Prot
	PTHR11022	UniProtKB/Swiss-Prot
Pfam	Amidase_2	UniProtKB/Swiss-Prot
PhenoGen	Pglyrp1	PhenoGen
PIRSF	PGRPs	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000013395	RatGTEx
SMART	Ami_2	UniProtKB/Swiss-Prot
	PGRP	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF55846	UniProtKB/Swiss-Prot
UniProt	A0ABK0LYR8_RAT	UniProtKB/TrEMBL
	A6J8I1_RAT	UniProtKB/TrEMBL
	A6J8I2	ENTREZGENE, UniProtKB/TrEMBL
	G3V7R2	ENTREZGENE, UniProtKB/TrEMBL
	PGRP1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Pglyrp1	peptidoglycan recognition protein 1	Pglyrp	peptidoglycan recognition protein	Symbol and Name updated	1299863	APPROVED
2004-02-26	Pglyrp	peptidoglycan recognition protein			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Pglyrp	peptidoglycan recognition protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_function	binds to peptidoglycan (PG) or live bacteria	724610
gene_regulation	induced in brain by sleep deprivation	724610

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD