Advanced Search (OLGA)

Gene: Slc32a1 (solute carrier family 32 member 1) Rattus norvegicus

Analyze

Symbol:

Slc32a1

Name:

solute carrier family 32 member 1

RGD ID:

621402

Description:

Enables gamma-aminobutyric acid:proton antiporter activity and glycine transmembrane transporter activity. Involved in carboxylic acid transport; hippocampus development; and neurotransmitter loading into synaptic vesicle. Located in inhibitory synapse and synaptic vesicle. Is active in GABA-ergic synapse and synaptic vesicle membrane. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy and generalized epilepsy with febrile seizures plus. Orthologous to human SLC32A1 (solute carrier family 32 member 1); INTERACTS WITH (+)-pilocarpine; 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

GABA and glycine transporter; rGVAT; RUNC-47; solute carrier family 32 (GABA vesicular transporter), member 1; UNC-47 homolog; vesicular GABA transporter; vesicular inhibitory amino acid transporter; vesicular inhibitory amino acid transporter-like; Vgat; Viaat

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLC32A1 (solute carrier family 32 member 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Slc32a1 (solute carrier family 32 (GABA vesicular transporter), member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Slc32a1 (solute carrier family 32 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLC32A1 (solute carrier family 32 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLC32A1 (solute carrier family 32 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slc32a1 (solute carrier family 32 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLC32A1 (solute carrier family 32 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLC32A1 (solute carrier family 32 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slc32a1 (solute carrier family 32 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Slc32a1 (solute carrier family 32 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SLC32A1 (solute carrier family 32 member 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Slc32a1 (solute carrier family 32 (GABA vesicular transporter), member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc32a1 (solute carrier family 32 member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	AVT1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	AVT1	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	VGAT	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	unc-47	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	slc32a1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	slc32a1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	167,687,245 - 167,691,714 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	167,687,098 - 167,691,731 (+)	Ensembl				GRCr8
mRatBN7.2	3	147,267,373 - 147,271,842 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	147,267,373 - 147,271,844 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	151,099,258 - 151,103,727 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	159,598,572 - 159,603,041 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	157,334,122 - 157,338,592 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	155,102,980 - 155,107,815 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	155,103,150 - 155,107,817 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	160,500,062 - 160,504,882 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	149,342,399 - 149,347,124 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	145,965,158 - 145,969,589 (+)	NCBI		Celera
RGSC_v3.1	3	149,248,307 - 149,253,033 (+)	NCBI
Cytogenetic Map	3	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

developmental and epileptic encephalopathy (ISO)

Developmental and Epileptic Encephalopathy 114 (ISO)

epilepsy (ISO)

generalized epilepsy with febrile seizures plus (ISO)

Generalized Epilepsy with Febrile Seizures Plus, Type 12 (ISO)

genetic disease (ISO)

obesity (ISO)

temporal lobe epilepsy (ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (EXP)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (EXP)

17alpha-ethynylestradiol (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,4'-trichlorobiphenyl (ISO)

2-palmitoylglycerol (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (EXP)

benzo[a]pyrene (EXP,ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

Brodifacoum (EXP)

butanal (ISO)

cannabidiol (ISO)

cannabigerol (ISO)

choline (ISO)

citalopram (EXP)

cocaine (EXP)

copper atom (ISO)

copper(0) (ISO)

D-gluconic acid (EXP)

dibutyl phthalate (EXP)

dimethylarsinic acid (EXP)

dorsomorphin (ISO)

ethanol (EXP,ISO)

fenamidone (ISO)

fenvalerate (EXP)

flavonoids (EXP)

fluoxetine (EXP)

folic acid (ISO)

gamma-aminobutyric acid (EXP)

ketamine (EXP)

L-methionine (ISO)

lead diacetate (EXP)

lead(0) (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-methyl-4-phenylpyridinium (ISO)

paraquat (EXP)

PCB138 (ISO)

pentanal (ISO)

phenylmercury acetate (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP)

titanium dioxide (ISO)

toluene (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

beta-alanine transport (IDA)

gamma-aminobutyric acid import (IEA,IMP,ISO,ISS)

gamma-aminobutyric acid transport (IBA,IDA,IMP)

glycine transport (IBA,IMP,ISO,ISS,TAS)

hippocampus development (IEP)

neurotransmitter loading into synaptic vesicle (IBA,IDA,IMP)

neurotransmitter transport (IEA,TAS)

proton transmembrane transport (IEA)

Cellular Component

cell surface (IEA,ISO)

cell tip (IEA,ISO)

cone cell pedicle (IEA,ISO)

cytoplasmic vesicle (IEA)

dendrite (IEA,ISO)

dendrite terminus (IBA,IEA,ISO)

GABA-ergic synapse (IDA)

inhibitory synapse (IDA,IEA,ISO)

membrane (IEA)

neuron projection (IEA,ISO)

neuron projection terminus (IBA,IEA,ISO)

presynapse (IDA,IEA)

presynaptic active zone (IEA,ISO)

synapse (IDA)

synaptic vesicle (IDA)

synaptic vesicle membrane (IBA,IDA,IEA,IEP)

Molecular Function

gamma-aminobutyric acid transmembrane transporter activity (IMP)

gamma-aminobutyric acid:proton antiporter activity (IDA,IEA,ISO)

glycine transmembrane transporter activity (IBA,IEA,IMP,ISO,TAS)

glycine:proton antiporter activity (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Vesicular glutamate and GABA transporters sort to distinct sets of vesicles in a population of presynaptic terminals.	Boulland JL, etal., Cereb Cortex. 2009 Jan;19(1):241-8. doi: 10.1093/cercor/bhn077. Epub 2008 May 22.
2.	The vesicular GABA transporter, VGAT, localizes to synaptic vesicles in sets of glycinergic as well as GABAergic neurons.	Chaudhry FA, etal., J Neurosci. 1998 Dec 1;18(23):9733-50.
3.	Expression of the vesicular inhibitory amino acid transporter in pancreatic islet cells: distribution of the transporter within rat islets.	Chessler SD, etal., Diabetes 2002 Jun;51(6):1763-71.
4.	Control of excitatory and inhibitory synapse formation by neuroligins.	Chih B, etal., Science. 2005 Feb 25;307(5713):1324-8. Epub 2005 Jan 27.
5.	Presence of the vesicular inhibitory amino acid transporter in GABAergic and glycinergic synaptic terminal boutons.	Dumoulin A, etal., J Cell Sci. 1999 Mar;112 ( Pt 6):811-23. doi: 10.1242/jcs.112.6.811.
6.	VGLUT1 and VGAT are sorted to the same population of synaptic vesicles in subsets of cortical axon terminals.	Fattorini G, etal., J Neurochem. 2009 Sep;110(5):1538-46. Epub 2009 Jul 15.
7.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.	Vesicular inhibitory amino acid transporter is a Cl-/gamma-aminobutyrate Co-transporter.	Juge N, etal., J Biol Chem. 2009 Dec 11;284(50):35073-8. doi: 10.1074/jbc.M109.062414. Epub 2009 Oct 20.
9.	Vesicular GABA transporter (VGAT) transports β-alanine.	Juge N, etal., J Neurochem. 2013 Nov;127(4):482-6. doi: 10.1111/jnc.12393. Epub 2013 Aug 27.
10.	Enhanced glutamatergic and decreased GABAergic synaptic appositions to GnRH neurons on proestrus in the rat: modulatory effect of aging.	Khan M, etal., PLoS One. 2010 Apr 14;5(4):e10172.
11.	Postsynaptic scaffolding molecules modulate the localization of neuroligins.	Levinson JN, etal., Neuroscience. 2010 Feb 3;165(3):782-93. doi: 10.1016/j.neuroscience.2009.11.016. Epub 2009 Nov 13.
12.	Identification and characterization of the vesicular GABA transporter.	McIntire SL, etal., Nature 1997 Oct 23;389(6653):870-6.
13.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
14.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.	The components required for amino acid neurotransmitter signaling are present in adipose tissues.	Nicolaysen A, etal., J Lipid Res. 2007 Oct;48(10):2123-32. Epub 2007 Jun 28.
16.	GOA pipeline	RGD automated data pipeline
17.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
18.	Presynaptic CLC-3 determines quantal size of inhibitory transmission in the hippocampus.	Riazanski V, etal., Nat Neurosci. 2011 Apr;14(4):487-94. doi: 10.1038/nn.2775. Epub 2011 Mar 6.

Additional References at PubMed

PMID:9395291	PMID:12115694	PMID:12882924	PMID:16079394	PMID:16814779	PMID:17218060	PMID:17503488	PMID:17554001	PMID:17823315	PMID:19103593	PMID:21356198	PMID:21700703
PMID:23258346	PMID:25749864	PMID:29476059

Genomics

Comparative Map Data

Slc32a1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	167,687,245 - 167,691,714 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	167,687,098 - 167,691,731 (+)	Ensembl				GRCr8
mRatBN7.2	3	147,267,373 - 147,271,842 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	147,267,373 - 147,271,844 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	151,099,258 - 151,103,727 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	159,598,572 - 159,603,041 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	157,334,122 - 157,338,592 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	155,102,980 - 155,107,815 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	155,103,150 - 155,107,817 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	160,500,062 - 160,504,882 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	149,342,399 - 149,347,124 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	145,965,158 - 145,969,589 (+)	NCBI		Celera
RGSC_v3.1	3	149,248,307 - 149,253,033 (+)	NCBI
Cytogenetic Map	3	q42	NCBI

SLC32A1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	38,724,486 - 38,729,372 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	38,724,486 - 38,729,372 (+)	Ensembl			hg38	GRCh38
GRCh37	20	37,353,129 - 37,358,015 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	36,786,519 - 36,791,429 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	20	36,786,518 - 36,791,429	NCBI
Celera	20	34,063,870 - 34,068,780 (+)	NCBI		Celera
Cytogenetic Map	20	q11.23	NCBI
HuRef	20	34,090,311 - 34,095,221 (+)	NCBI		HuRef
CHM1_1	20	37,257,300 - 37,262,210 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	40,454,638 - 40,459,524 (+)	NCBI		T2T-CHM13v2.0

Slc32a1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	158,449,158 - 158,457,667 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	158,452,687 - 158,457,668 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	158,607,260 - 158,615,747 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	158,610,767 - 158,615,748 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	158,436,494 - 158,441,483 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	158,302,642 - 158,307,103 (+)	NCBI		MGSCv36	mm8
Celera	2	164,544,280 - 164,549,271 (+)	NCBI		Celera
Cytogenetic Map	2	H1	NCBI
cM Map	2	78.72	NCBI

Slc32a1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955445	18,032,932 - 18,038,216 (-)	Ensembl
ChiLan1.0	NW_004955445	18,033,128 - 18,038,002 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC32A1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	44,450,155 - 44,455,102 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	44,443,252 - 44,448,201 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	35,049,115 - 35,054,347 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	36,157,265 - 36,162,426 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	36,157,265 - 36,162,426 (+)	Ensembl			panPan2	panpan1.1

SLC32A1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	27,142,153 - 27,146,986 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	27,142,423 - 27,146,262 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	26,787,770 - 26,792,575 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	27,838,505 - 27,843,313 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	27,838,476 - 27,843,320 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	27,112,243 - 27,117,048 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	27,220,594 - 27,225,400 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	27,708,664 - 27,713,472 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Slc32a1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	176,035,173 - 176,039,904 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936561	2,709,463 - 2,714,313 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936561	2,709,580 - 2,714,313 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC32A1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	41,689,479 - 41,694,553 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	17	41,689,479 - 41,694,560 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	47,181,003 - 47,185,792 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC32A1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	25,028,028 - 25,032,975 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	25,026,609 - 25,032,916 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666050	73,858,288 - 73,863,468 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc32a1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624842	946,211 - 954,768 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624842	949,907 - 955,002 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Slc32a1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	137,955,482 - 137,960,126 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Slc32a1
16 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	309
Count of miRNA genes:	185
Interacting mature miRNAs:	219
Transcripts:	ENSRNOT00000020720
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	141555229	186555229	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141555229	186555229	Rat
1582233	Insul10	Insulin level QTL 10	5.4	0.0015	blood insulin amount (VT:0001560)	serum insulin level times blood glucose level (CMO:0002040)	3	133259579	178259579	Rat
1300113	Bp176	Blood pressure QTL 176	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	166376089	177728348	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	141555229	186555229	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	141555229	186555229	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	151075912	189428310	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	129154923	182114333	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	141555229	186555229	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	141555229	186555229	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	161492708	189428310	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
8552791	Vie2	Viral induced encephalitis QTL 2	4.1		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	3	166376089	189428310	Rat
61335	Bp20	Blood pressure QTL 20	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	161799493	176036425	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	133134628	178134628	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	161799270	187311134	Rat
1582213	Insul6	Insulin level QTL 6	3.7	0.0009	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	3	155759447	189428310	Rat
1598854	Memor10	Memory QTL 10	2		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	3	166376089	189428310	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	152055202	189428310	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	142898802	187898802	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	145335553	189428310	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	125116475	170116475	Rat
1582256	Insul9	Insulin level QTL 9	4.4	0.0016	blood insulin amount (VT:0001560)	absolute change in serum insulin level (CMO:0002038)	3	155759447	189428310	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	139299381	184299381	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	141508991	177728348	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	131036586	176036586	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	137114333	182114333	Rat
1582248	Insul7	Insulin level QTL 7	3.9	0.0041	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	3	155759447	189428310	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	131036586	176036586	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	151075912	189428310	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	151075912	189428310	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	141555229	186555229	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	144575244	189428310	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	160357340	167835660	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
3	4	21	141	26	30	19	53	19	2	139	85	11	129	29	66	11	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031782	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006235441	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF030253	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020720 ⟹ ENSRNOP00000020720

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	167,687,098 - 167,691,731 (+)	Ensembl
mRatBN7.2 Ensembl	3	147,267,373 - 147,271,844 (+)	Ensembl
Rnor_6.0 Ensembl	3	155,103,150 - 155,107,817 (+)	Ensembl

RefSeq Acc Id:

NM_031782 ⟹ NP_113970

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	167,687,245 - 167,691,714 (+)	NCBI
mRatBN7.2	3	147,267,373 - 147,271,842 (+)	NCBI
Rnor_6.0	3	155,103,150 - 155,107,815 (+)	NCBI
Rnor_5.0	3	160,500,062 - 160,504,882 (-)	NCBI
RGSC_v3.4	3	149,342,399 - 149,347,124 (+)	RGD
Celera	3	145,965,158 - 145,969,589 (+)	NCBI

Sequence:

show sequence

AGCGGAGATAGCGGCCCTTGCTGCCTTGACGCGCGCCCGCCGCGTCCCCAGACCCTTCTGTCCT
TTTCTCCCGCCCCGCCGCCGCCATGGCCACCCTGCTCCGCAGCAAGCTGACCAACGTGGCCACC
TCTGTGTCCAACAAGTCCCAGGCCAAGGTGAGCGGCATGTTCGCCAGGATGGGGTTTCAGGCGG
CCACGGATGAGGAGGCGGTGGGCTTCGCGCACTGCGACGATCTCGACTTTGAGCACCGCCAGGG
CCTGCAGATGGACATCCTGAAATCGGAAGGCGAGCCCTGCGGGGACGAGGGCGCAGAACCTCCC
GTCGAGGGAGACATTCATTATCAGCGCGGCGGCGCTCCCCTGCCACCCTCGGGCTCCAAGGACC
AGGCCGTGGGAGCTGGTGGGGAGTTCGGGGGTCACGACAAACCCAAGATCACGGCGTGGGAAGC
GGGCTGGAACGTGACAAACGCCATTCAGGGCATGTTCGTGCTGGGTCTACCCTACGCCATCCTC
CACGGCGGCTACCTGGGGTTGTTCCTCATCATCTTCGCCGCGGTGGTGTGCTGCTACACCGGCA
AGATCCTCATCGCGTGCCTGTACGAGGAGAACGAAGATGGTGAGGTGGTGCGCGTGAGGGACTC
GTATGTGGCCATAGCTAACGCGTGCTGCGCTCCTCGATTCCCCACGCTGGGCGGCCGCGTGGTC
AATGTGGCCCAGATCATCGAGCTGGTGATGACGTGTATCTTGTACGTAGTGGTGAGCGGCAACC
TCATGTACAACAGTTTCCCGGGGCTGCCCGTGTCGCAGAAGTCCTGGTCCATCATAGCCACGGC
GGTGCTGCTGCCCTGCGCCTTCCTGAAGAATCTCAAGGCCGTGTCCAAGTTCAGTCTGCTGTGC
ACGCTGGCCCACTTCGTCATCAACATCCTGGTCATCGCCTACTGTCTCTCGCGCGCGCGTGACT
GGGCCTGGGAGAAGGTGAAGTTCTACATCGACGTCAAGAAGTTTCCTATCTCCATCGGCATCAT
CGTGTTCAGCTACACGTCGCAGATCTTCCTGCCCTCGCTCGAAGGCAACATGCAGCAGCCCAGC
GAATTCCACTGCATGATGAACTGGACACACATCGCCGCCTGCGTGCTCAAGGGTCTCTTCGCGC
TCGTCGCCTACCTCACCTGGGCCGACGAGACCAAGGAAGTCATCACGGATAACCTGCCCGGTTC
CATCCGCGCCGTGGTCAACATCTTCCTGGTGGCCAAGGCGCTGCTGTCCTACCCGTTGCCCTTC
TTCGCGGCCGTCGAAGTGCTGGAGAAGTCTCTCTTCCAGGAAGGCAGTCGTGCCTTCTTCCCCG
CCTGCTACGGTGGCGACGGTCGCCTTAAGTCCTGGGGGCTGACGCTGCGCTGCGCGCTGGTGGT
CTTCACGCTGCTCATGGCCATCTACGTGCCACACTTCGCGCTGCTCATGGGCCTCACGGGCAGC
CTCACGGGAGCCGGCCTCTGCTTCCTGCTGCCCAGCCTCTTCCACTTGCGTCTTCTCTGGCGCA
AGCTGCTGTGGCACCAGGTCTTCTTCGATGTGGCCATCTTCGTCATCGGCGGCATCTGCAGCGT
GTCCGGCTTCGTGCATTCACTCGAGGGCCTCATCGAGGCCTACCGAACCAACGCAGAGGACTAG
GGGGCGGGGACCCTGCCCCCAGCTCCCTCCCCGCCCACCCCCACTCCCCCTTATCCCCGCCCCC
AACCCCCACCCCCAGCCCCCTGCGCAACCACGCTGGGGAGGCCGAGCTTTAAACACCTCCGGTT
CCTAGTTGCTGATTATTCGGGGACCGGGCGGGGGAGGGAGGGGGATAGACATCCAAGGTCCACT
GCGTCTGCGTTTCTGTCGTTCTTTCTATTCCACATCGTCCTGATTTGGGGGGAGGGAGCAGAGC
GTATAAGTGAAGGGTATTTTCTGTCCTTCCTAGAACACCCACCACCACCACCACCAAACTTTGG
CTCCAGTCAATGTTAGGGGTGGGAAGGGAGGGGGAAAGGGAACACGCAGTTCGCAGGCTCGGAA
ACTTGACCTTGGGGGTGGGGTGGGGGACATTTCACAGCCATTCAGTGCTTGGAATCTACTGCGT
CCAGCCATTTCCAGCAAGAGCGCTCCCCATGCCCTAGACATTTCAACCTTGAGGCCTGAAAGGC
TGACCGGGAAATCCATTTCGGGCAGGCGACTTCCCTCTGGAGAAGCCGCGGCAGGGGCCCCCGT
TTGCCTGCCGGTTTTCAGGAACCCAAACTCATCTTGTGCAATGTATCCGGTTGTGGAACTGTAT
ACTGTGCGTGTGGTGTGCTCGTGGTGAATAAGATGAAATGTATATCAGAAAAAATCTATCTCTA
ATTTAGAGTGCGGTGCCTCGTGCC

hide sequence

Protein Sequences


Protein RefSeqs	NP_113970	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB82950	(Get FASTA)	NCBI Sequence Viewer
	EDL96634	(Get FASTA)	NCBI Sequence Viewer
	EDL96635	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020720
	ENSRNOP00000020720.5
GenBank Protein	O35458	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113970 ⟸ NM_031782

- UniProtKB:

O35458 (UniProtKB/Swiss-Prot), A6JWX5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MATLLRSKLTNVATSVSNKSQAKVSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILK
SEGEPCGDEGAEPPVEGDIHYQRGGAPLPPSGSKDQAVGAGGEFGGHDKPKITAWEAGWNVTNA
IQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVVRVRDSYVAIANA
CCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQKSWSIIATAVLLPCAF
LKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKFYIDVKKFPISIGIIVFSYTSQ
IFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYLTWADETKEVITDNLPGSIRAVVNI
FLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPACYGGDGRLKSWGLTLRCALVVFTLLMAI
YVPHFALLMGLTGSLTGAGLCFLLPSLFHLRLLWRKLLWHQVFFDVAIFVIGGICSVSGFVHSL
EGLIEAYRTNAED

hide sequence

Ensembl Acc Id:

ENSRNOP00000020720 ⟸ ENSRNOT00000020720

Protein Domains

Amino acid transporter transmembrane

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35458-F1-model_v2	AlphaFold	O35458	1-525	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621402	AgrOrtholog
BioCyc Gene	G2FUF-47006	BioCyc
Ensembl Genes	ENSRNOG00000015393	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000020720	ENTREZGENE
	ENSRNOT00000020720.7	UniProtKB/Swiss-Prot
InterPro	AA_transpt_TM	UniProtKB/Swiss-Prot
KEGG Report	rno:83612	UniProtKB/Swiss-Prot
NCBI Gene	83612	ENTREZGENE
PANTHER	AA_TRANS DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot
	AMINO ACID TRANSPORTER	UniProtKB/Swiss-Prot
Pfam	Aa_trans	UniProtKB/Swiss-Prot
PhenoGen	Slc32a1	PhenoGen
RatGTEx	ENSRNOG00000015393	RatGTEx
UniProt	A6JWX4_RAT	UniProtKB/TrEMBL
	A6JWX5	ENTREZGENE, UniProtKB/TrEMBL
	O35458	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-24	Slc32a1	solute carrier family 32 member 1	Slc32a1	solute carrier family 32 (GABA vesicular transporter), member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	Slc32a1	solute carrier family 32 (GABA vesicular transporter), member 1	Viaat	vesicular inhibitory amino acid transporter	Symbol and Name updated	1299863	APPROVED
2004-02-26	Viaat	vesicular inhibitory amino acid transporter			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Viaat	vesicular inhibitory amino acid transporter			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	protein expressed in pancreatic islets	730056
gene_homology	aa sequence shares 98% identity with human VIAAT	730056

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM