Advanced Search (OLGA)

Gene: Kcne3 (potassium voltage-gated channel subfamily E regulatory subunit 3) Rattus norvegicus

Analyze

Symbol:

Kcne3

Name:

potassium voltage-gated channel subfamily E regulatory subunit 3

RGD ID:

621384

Description:

Enables potassium channel regulator activity and transmembrane transporter binding activity. Involved in negative regulation of delayed rectifier potassium channel activity. Located in plasma membrane. Part of voltage-gated potassium channel complex. Human ortholog(s) of this gene implicated in Brugada syndrome 6 and hypokalemic periodic paralysis. Orthologous to human KCNE3 (potassium voltage-gated channel subfamily E regulatory subunit 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; all-trans-retinoic acid.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC105432; minimum potassium ion channel-related peptide 2; mink-related peptide 2; MiRP2; potassium channel subunit beta MiRP2; potassium channel, voltage gated subfamily E regulatory beta subunit 3; potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 3; potassium voltage-gated channel subfamily E member 3; potassium voltage-gated channel, Isk-related family, member 3; potassium voltage-gated channel, Isk-related subfamily, gene 3; potassium voltage-gated channel, Isk-related subfamily, member 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	163,936,035 - 163,942,998 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	163,935,991 - 163,950,162 (+)	Ensembl				GRCr8
mRatBN7.2	1	154,523,903 - 154,530,865 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	154,523,830 - 154,532,020 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	162,518,249 - 162,525,206 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	169,698,347 - 169,705,304 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	162,571,923 - 162,578,879 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	165,189,934 - 165,196,949 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	165,189,985 - 165,196,948 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	171,390,138 - 171,397,804 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	157,558,044 - 157,565,008 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	152,607,926 - 152,614,889 (+)	NCBI		Celera
RGSC_v3.1	1	157,636,337 - 157,643,300 (+)	NCBI
Cytogenetic Map	1	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brugada syndrome (ISO)

Brugada syndrome 6 (ISO)

hypokalemic periodic paralysis (ISO)

long QT syndrome (ISO)

Sudden Unexpected Nocturnal Death Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

amiodarone (ISO)

amitrole (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[ghi]perylene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

choline (ISO)

Chromanol 293B (ISO)

chrysene (ISO)

cisplatin (ISO)

copper atom (EXP)

copper(0) (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

dextran sulfate (ISO)

dibenz[a,h]anthracene (ISO)

diethyl maleate (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

entinostat (ISO)

etoposide (ISO)

folic acid (ISO)

furan (EXP)

gardiquimod (ISO)

genistein (ISO)

gentamycin (EXP)

iron atom (EXP)

iron(0) (EXP)

L-methionine (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

mitomycin C (ISO)

Moniliformin (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

pentanal (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

potassium atom (ISO)

progesterone (ISO)

protein kinase inhibitor (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

S-nitrosoglutathione (ISO)

SB 431542 (ISO)

silicon dioxide (EXP,ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tetraphene (ISO)

Theaflavin 3,3'-digallate (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

trovafloxacin (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intracellular chloride ion homeostasis (IEA,ISO)

membrane repolarization during action potential (IBA)

membrane repolarization during ventricular cardiac muscle cell action potential (IEA)

monoatomic ion transport (IEA)

negative regulation of delayed rectifier potassium channel activity (IDA,ISO)

negative regulation of membrane repolarization during ventricular cardiac muscle cell action potential (IEA,ISO)

negative regulation of potassium ion export across plasma membrane (IEA,ISO)

negative regulation of voltage-gated potassium channel activity (IDA)

positive regulation of voltage-gated calcium channel activity (IDA)

potassium ion export across plasma membrane (IBA)

potassium ion transmembrane transport (IEA,ISO)

potassium ion transport (IEA)

regulation of heart rate by cardiac conduction (IBA,IEA,ISO)

regulation of potassium ion transport (IMP)

regulation of ventricular cardiac muscle cell membrane repolarization (IBA)

sodium ion transport (IEA,ISO)

ventricular cardiac muscle cell action potential (IBA)

Cellular Component

basolateral part of cell (IEA,ISO)

cytoplasm (IEA,ISO,ISS)

dendrite (IEA,ISO,ISS)

membrane (IEA)

membrane raft (IEA,ISO)

neuronal cell body membrane (IEA,ISO,ISS)

perikaryon (IEA,ISO,ISS)

plasma membrane (IDA,IEA,ISO)

vesicle (IEA,ISO,ISS)

voltage-gated potassium channel complex (IDA,IEA,ISO)

Molecular Function

delayed rectifier potassium channel activity (IBA)

potassium channel regulator activity (IBA,IDA,IEA,ISO,TAS)

protein binding (IPI,ISO)

transmembrane transporter binding (IBA,IPI)

voltage-gated potassium channel activity (IEA)

voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	MiRP2 forms potassium channels in skeletal muscle with Kv3.4 and is associated with periodic paralysis.	Abbott GW, etal., Cell. 2001 Jan 26;104(2):217-31.
2.	Sexual dimorphism and oestrogen regulation of KCNE3 expression modulates the functional properties of KCNQ1 K(+) channels.	Alzamora R, etal., J Physiol. 2011 Nov 1;589(Pt 21):5091-107. doi: 10.1113/jphysiol.2011.215772. Epub 2011 Sep 12.
3.	Regulation and properties of KCNQ1 (K(V)LQT1) and impact of the cystic fibrosis transmembrane conductance regulator.	Boucherot A, etal., J Membr Biol 2001 Jul 1;182(1):39-47.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	MinK, MiRP1, and MiRP2 diversify Kv3.1 and Kv3.2 potassium channel gating.	Lewis A, etal., J Biol Chem. 2004 Feb 27;279(9):7884-92. Epub 2003 Dec 16.
6.	MinK-related peptide 2 modulates Kv2.1 and Kv3.1 potassium channels in mammalian brain.	McCrossan ZA, etal., J Neurosci. 2003 Sep 3;23(22):8077-91.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:10646604	PMID:11220365	PMID:12477932	PMID:15489334	PMID:20533308	PMID:22987075

Genomics

Comparative Map Data

Kcne3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	163,936,035 - 163,942,998 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	163,935,991 - 163,950,162 (+)	Ensembl				GRCr8
mRatBN7.2	1	154,523,903 - 154,530,865 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	154,523,830 - 154,532,020 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	162,518,249 - 162,525,206 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	169,698,347 - 169,705,304 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	162,571,923 - 162,578,879 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	165,189,934 - 165,196,949 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	165,189,985 - 165,196,948 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	171,390,138 - 171,397,804 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	157,558,044 - 157,565,008 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	152,607,926 - 152,614,889 (+)	NCBI		Celera
RGSC_v3.1	1	157,636,337 - 157,643,300 (+)	NCBI
Cytogenetic Map	1	q32	NCBI

KCNE3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	74,454,841 - 74,467,549 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	74,454,841 - 74,467,743 (-)	Ensembl			hg38	GRCh38
GRCh37	11	74,165,886 - 74,178,594 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	73,843,534 - 73,856,248 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	11	73,843,805 - 73,850,798	NCBI
Celera	11	71,472,396 - 71,485,109 (-)	NCBI		Celera
Cytogenetic Map	11	q13.4	NCBI
HuRef	11	70,461,201 - 70,473,937 (-)	NCBI		HuRef
CHM1_1	11	74,049,426 - 74,062,143 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	74,384,260 - 74,396,980 (-)	NCBI		T2T-CHM13v2.0

Kcne3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	99,825,714 - 99,834,076 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	99,825,709 - 99,834,076 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	100,176,507 - 100,184,869 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	100,176,502 - 100,184,869 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	107,327,207 - 107,333,374 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	100,052,780 - 100,058,947 (+)	NCBI		MGSCv36	mm8
Celera	7	100,513,245 - 100,519,198 (+)	NCBI		Celera
Cytogenetic Map	7	E2	NCBI
cM Map	7	54.33	NCBI

Kcne3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955414	17,166,546 - 17,200,353 (+)	Ensembl
ChiLan1.0	NW_004955414	17,166,537 - 17,200,385 (+)	NCBI	ChiLan1.0	ChiLan1.0

KCNE3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	75,396,558 - 75,409,080 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	76,440,593 - 76,453,426 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	69,527,663 - 69,540,236 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	72,832,858 - 72,845,399 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	72,835,048 - 72,835,359 (-)	Ensembl			panPan2	panpan1.1

KCNE3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	23,860,727 - 23,872,194 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	21	23,871,648 - 23,871,947 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	23,625,823 - 23,638,780 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	24,063,194 - 24,076,168 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	21	24,074,135 - 24,074,434 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	21	23,860,571 - 23,873,532 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	24,057,896 - 24,070,858 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	23,975,487 - 23,988,456 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Kcne3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	61,876,838 - 61,888,024 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936498	3,478,039 - 3,478,350 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936498	3,477,313 - 3,487,580 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KCNE3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	8,810,720 - 8,822,494 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	8,810,716 - 8,822,191 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	9,649,248 - 9,660,859 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KCNE3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	65,699,558 - 65,710,305 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	65,700,156 - 65,700,467 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666043	60,150,565 - 60,161,017 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kcne3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624817	2,513,539 - 2,606,682 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624817	2,593,649 - 2,607,462 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Kcne3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	98,474,087 - 98,480,940 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Kcne3
43 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	322
Count of miRNA genes:	202
Interacting mature miRNAs:	224
Transcripts:	ENSRNOT00000048437
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	131179947	176179947	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	137611478	182611478	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	153679879	198679879	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	130419227	175419227	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	132760429	191848948	Rat
631684	Bp117	Blood pressure QTL 117	8.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	120082258	165082258	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	153679879	205813246	Rat
8694166	Bw147	Body weight QTL 147	6.83	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	1	153788989	198788989	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	142582336	182383862	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	160573753	210707719	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	130419227	175419227	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	139442053	223964440	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	160573753	210707719	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	127329268	206393015	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	161077990	206077990	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	99645382	182701046	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	159894717	207261263	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	109493780	193400781	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	146080545	243492863	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	141173126	169168317	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	155359438	194575574	Rat
631206	Niddm40	Non-insulin dependent diabetes mellitus QTL 40			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	140833106	185833106	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	153679879	232414077	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	160574007	235238518	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	116099376	191260518	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	131243790	176243790	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
737974	Bp161	Blood pressure QTL 161		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	129182274	174182274	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	132760429	191848948	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	162753891	207753891	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	115183611	176289080	Rat
634315	Niddm45	Non-insulin dependent diabetes mellitus QTL 45	7.16		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	153680016	182383862	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
61379	Bp44	Blood pressure QTL 44	19.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	153680016	183564652	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	102780511	182384005	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	111949780	210707719	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	128019551	173019551	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	139442053	223964440	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	111949780	210707719	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	178317588	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	210707719	Rat
8693608	Alc24	Alcohol consumption QTL 24	2.3	0.74	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	159863716	177663210	Rat
1576310	Schws2	Schwannoma susceptibility QTL 2		0.029	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	1	153788989	198788989	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	180021436	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760429	191190115	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	132966869	206393015	Rat
631548	Bp88	Blood pressure QTL 88	5	0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	140915717	185915717	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	132760429	191848948	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat
7411599	Foco11	Food consumption QTL 11	18.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	1	153788989	198788989	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	210707719	Rat

Markers in Region

AW533943

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	154,526,740 - 154,526,896 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	165,192,825 - 165,192,980	NCBI	Rnor6.0
Rnor_5.0	1	171,393,680 - 171,393,835	UniSTS	Rnor5.0
RGSC_v3.4	1	157,560,884 - 157,561,039	UniSTS	RGSC3.4
Celera	1	152,610,765 - 152,610,920	UniSTS
RH 3.4 Map	1	1255.2	UniSTS
Cytogenetic Map	1	q32	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	152	90	89	58	70	58	6	325	170	11	126	73	88	31	12	12

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022235	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006229786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC121350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ271742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000048437 ⟹ ENSRNOP00000044706

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	154,523,830 - 154,532,020 (+)	Ensembl
Rnor_6.0 Ensembl	1	165,189,985 - 165,196,948 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097656

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	154,523,876 - 154,532,020 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106352

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	154,523,830 - 154,532,020 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112289 ⟹ ENSRNOP00000102937

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	163,935,991 - 163,950,162 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000140820 ⟹ ENSRNOP00000110902

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	163,936,006 - 163,942,714 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000155651 ⟹ ENSRNOP00000098796

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	163,936,035 - 163,942,997 (+)	Ensembl

RefSeq Acc Id:

NM_022235 ⟹ NP_071571

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	163,936,035 - 163,942,998 (+)	NCBI
mRatBN7.2	1	154,523,903 - 154,530,865 (+)	NCBI
Rnor_6.0	1	165,189,985 - 165,196,949 (+)	NCBI
Rnor_5.0	1	171,390,138 - 171,397,804 (+)	NCBI
RGSC_v3.4	1	157,558,044 - 157,565,008 (+)	RGD
Celera	1	152,607,926 - 152,614,889 (+)	RGD

Sequence:

show sequence

CACTGAGCGCCGCTGGGCATCACTGCAGTGCTCACCGGAGACAGATCGCAGAGTCAGATCACAT
TCCAGCTCTTCCCATACCTCGATTTCTGTTGCTATGGAGACTTCCAACGGGACTGAGACCTGGT
ACAAGAGCCTCCACGCTGTGCTAAAGGCTCTGAACACAACCCTTCACAGTCACTTGCTCTGCCG
GCCTGGGCCAGGGCCAGGGTCAGGAACAGGGCCAGACAATCAAACAGAGGATCATCGGGCTAGC
CTTCCCGGCCGTAATGACAACTCCTACATGTATATTCTTTTTGTCATGTTCCTATTCGCTGTCA
CTGTGGGCAGTCTCATCCTGGGATATACCCGTTCACGCAAAGTGGACAAACGTAGTGACCCCTA
TCATGTGTACATCAAAAACCGTGTGTCTATGATCTGATGTGAGGTGCCTGAGGACAATGGAAGA
TTATGATGTCTGAGGATTGTCTTCTTGGGTCTCCGGAACTCATCTCGACCCTATCAAGCCACAG
TACCTCTGTCTATACAAGATCAACGAGAAATTGGTAAGAGAGTTAGGTCATCACTGGGACCAGA
GAAGAGGGGCTGATAGGCCTGGTCTTCTGGATGAGACATTTTTCTAGACACAGATGCGCATTAT
AAACTCAGAGCCCGTGAGCACACATATAAAAGTATGGACAACCAACAAGTAGGAGAGGAAGCTG
TGGTGAAGGGAAATGGAGCAGGAAAATGCTCTGGAAATATAATCTTTTAATGTATGATCTTTAA
CATGAGAGATCTTGATAAAACAGAGAATGCTACTTACTTGTATCGATTCAAAGTTTGTTCTTTA
AATAGCCTTAATATTTGTGGGTTTTGCCTCATCTGCCAAGAAAACGGAACAAGTCCTATGACTG
GAATCCAGGAACTCTGGTCATTTCTTCTAGGACTTTTCAATCCCACGTCGGGTAAGATCCAGGC
CAGAAGAACATTCGGCCGAGCACAATGATGCATGTCTACAATTGTAGTGCTCAAGAGGCTGAGT
GGGGAGGATCATTTGAGTTCAAGAGTTCAAGACCAGACTACTCAAGCTCTATCTTGGAAGGGAC
TTGGTGGGGGCTGTTGAGAAATATCTTACTTTTACAAATATTACCAAAGACACGTCACTGTGCT
AACGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_071571	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86406	(Get FASTA)	NCBI Sequence Viewer
	CAB72139	(Get FASTA)	NCBI Sequence Viewer
	EDM18361	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000098796
GenBank Protein	Q9JJV7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_071571 ⟸ NM_022235
- UniProtKB:	Q9JJV7 (UniProtKB/Swiss-Prot), A6I6L9 (UniProtKB/TrEMBL)
- Sequence:	show sequence METSNGTETWYKSLHAVLKALNTTLHSHLLCRPGPGPGSGTGPDNQTEDHRASLPGRNDNSYMY ILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI hide sequence

Ensembl Acc Id:

ENSRNOP00000044706 ⟸ ENSRNOT00000048437

Ensembl Acc Id:

ENSRNOP00000110902 ⟸ ENSRNOT00000140820

Ensembl Acc Id:

ENSRNOP00000098796 ⟸ ENSRNOT00000155651

Ensembl Acc Id:

ENSRNOP00000102937 ⟸ ENSRNOT00000112289

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JJV7-F1-model_v2	AlphaFold	Q9JJV7	1-107	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690238

Promoter ID:

EPDNEW_R761

Type:

multiple initiation site

Name:

Kcne3_1

Description:

potassium voltage-gated channel subfamily E regulatory subunit3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	165,189,970 - 165,190,030	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621384	AgrOrtholog
BioCyc Gene	G2FUF-58342	BioCyc
Ensembl Genes	ENSRNOG00000017054	Ensembl
	ENSRNOG00000063050	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000155651	ENTREZGENE
IMAGE_CLONE	IMAGE:7306835	IMAGE-MGC_LOAD
InterPro	K_chnl_KCNE	UniProtKB/Swiss-Prot
	K_chnl_volt-dep_bsu_KCNE3	UniProtKB/Swiss-Prot
KEGG Report	rno:63883	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105432	IMAGE-MGC_LOAD
NCBI Gene	63883	ENTREZGENE
PANTHER	PTHR15282	UniProtKB/Swiss-Prot
	PTHR15282:SF6	UniProtKB/Swiss-Prot
Pfam	ISK_Channel	UniProtKB/Swiss-Prot
PharmGKB	KCNE3	RGD
PhenoGen	Kcne3	PhenoGen
PRINTS	KCNE3CHANNEL	UniProtKB/Swiss-Prot
	KCNECHANNEL	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000017054	RatGTEx
	ENSRNOG00000063050	RatGTEx
RNAcentral	URS00022AFD56	RNACentral
	URS00022B0438	RNACentral
	URS00022B6E8C	RNACentral
UniProt	A6I6L9	ENTREZGENE, UniProtKB/TrEMBL
	KCNE3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Kcne3	potassium voltage-gated channel subfamily E regulatory subunit 3	Kcne3	potassium channel, voltage gated subfamily E regulatory beta subunit 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-01-27	Kcne3	potassium channel, voltage gated subfamily E regulatory beta subunit 3	Kcne3	potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-01-26	Kcne3	potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 3	Kcne3	potassium voltage-gated channel, Isk-related family, member 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-04-29	Kcne3	potassium voltage-gated channel, Isk-related family, member 3	Kcne3	potassium voltage-gated channel, Isk-related subfamily, gene 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-22	Kcne3	potassium voltage-gated channel, Isk-related subfamily, gene 3	Kcne3	potassium voltage-gated channel, Isk-related subfamily, member 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Kcne3	potassium voltage-gated channel, Isk-related subfamily, member 3		mink-related peptide 2	Name updated	1299863	APPROVED
2002-08-07	Kcne3	mink-related peptide 2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_process	coexpression activates K+ currents	633042

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM