Symbol:
Clec4f
Name:
C-type lectin domain family 4, member F
RGD ID:
621062
Description:
Predicted to enable galactose binding activity; glycolipid binding activity; and pattern recognition receptor activity. Involved in positive regulation of gene expression. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane. Orthologous to human CLEC4F (C-type lectin domain family 4 member F); INTERACTS WITH 3H-1,2-dithiole-3-thione; aflatoxin B1; ammonium chloride.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 13; C-type lectin 13; C-type lectin domain family 4 member F; C-type lectin superfamily member 13; Clecsf13; Kclr; Kupffer cell receptor; MGC112607
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CLEC4F (C-type lectin domain family 4 member F) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Clec4f (C-type lectin domain family 4, member f) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Clec4f (C-type lectin domain family 4 member F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CLEC4F (C-type lectin domain family 4 member F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CLEC4F (C-type lectin domain family 4 member F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Clec4f (C-type lectin domain family 4 member F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CLEC4F (C-type lectin domain family 4 member F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CLEC4F (C-type lectin domain family 4 member F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Clec4f (C-type lectin domain family 4 member F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CLEC4F (C-type lectin domain family 4 member F)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Clec4f (C-type lectin domain family 4, member f)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
clec-149
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
lectin-37Da
Alliance
DIOPT (PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 117,686,686 - 117,696,407 (-) NCBI GRCr8 mRatBN7.2 4 116,129,023 - 116,138,744 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 116,129,023 - 116,138,775 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 121,607,811 - 121,617,529 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 117,382,983 - 117,392,701 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 115,996,525 - 116,006,244 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 115,322,300 - 115,332,021 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 115,322,291 - 115,332,052 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 179,911,569 - 179,921,290 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 117,839,863 - 117,849,584 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 118,084,343 - 118,094,065 (-) NCBI Celera 4 105,121,362 - 105,131,083 (-) NCBI Celera Cytogenetic Map 4 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Clec4f Rat 17alpha-ethynylestradiol multiple interactions ISO Clec4f (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CLEC4F mRNA CTD PMID:17942748 Clec4f Rat 17beta-estradiol decreases expression ISO Clec4f (Mus musculus) 6480464 Estradiol results in decreased expression of CLEC4F mRNA CTD PMID:39298647 Clec4f Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Clec4f (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Clec4f Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Clec4f (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CLEC4F mRNA CTD PMID:17942748 Clec4f Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Clec4f (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CLEC4F mRNA CTD PMID:21570461 and PMID:28922406 Clec4f Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Clec4f (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Clec4f Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of CLEC4F mRNA CTD PMID:19162173 Clec4f Rat 4,4'-sulfonyldiphenol decreases expression ISO Clec4f (Mus musculus) 6480464 bisphenol S results in decreased expression of CLEC4F mRNA CTD PMID:39298647 Clec4f Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of CLEC4F mRNA CTD PMID:23630614 more ... Clec4f Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CLEC4F mRNA CTD PMID:16483693 Clec4f Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of CLEC4F mRNA CTD PMID:30779732 Clec4f Rat benzo[a]pyrene affects methylation ISO CLEC4F (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CLEC4F exon CTD PMID:27901495 Clec4f Rat benzo[e]pyrene increases methylation ISO CLEC4F (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of CLEC4F intron CTD PMID:30157460 Clec4f Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CLEC4F mRNA CTD PMID:30903817 Clec4f Rat bisphenol A increases expression ISO Clec4f (Mus musculus) 6480464 bisphenol A results in increased expression of CLEC4F mRNA CTD PMID:30245210 Clec4f Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of CLEC4F mRNA CTD PMID:24136188 Clec4f Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of CLEC4F mRNA CTD PMID:25993096 Clec4f Rat carbon nanotube decreases expression ISO Clec4f (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Clec4f Rat chrysene decreases expression ISO Clec4f (Mus musculus) 6480464 chrysene results in decreased expression of CLEC4F mRNA CTD PMID:26377693 Clec4f Rat clofibrate multiple interactions ISO Clec4f (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of CLEC4F mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of CLEC4F mRNA] CTD PMID:17585979 Clec4f Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of CLEC4F mRNA CTD PMID:20187946 Clec4f Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of CLEC4F mRNA CTD PMID:23914054 Clec4f Rat Echimidine decreases expression EXP 6480464 echimidine results in decreased expression of CLEC4F mRNA CTD PMID:32419051 Clec4f Rat ethanol multiple interactions EXP 6480464 [Fish Oils co-treated with Ethanol] results in increased expression of CLEC4F mRNA CTD PMID:17347304 Clec4f Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of CLEC4F mRNA CTD PMID:24136188 Clec4f Rat fumonisin B1 increases expression ISO Clec4f (Mus musculus) 6480464 fumonisin B1 results in increased expression of CLEC4F mRNA CTD PMID:16221962 Clec4f Rat Heliotrine decreases expression EXP 6480464 heliotrine results in decreased expression of CLEC4F mRNA CTD PMID:32419051 Clec4f Rat hexachlorobenzene increases expression EXP 6480464 Hexachlorobenzene results in increased expression of CLEC4F mRNA CTD PMID:15159207 Clec4f Rat Lasiocarpine decreases expression EXP 6480464 lasiocarpine results in decreased expression of CLEC4F mRNA CTD PMID:32419051 Clec4f Rat manganese(II) chloride increases methylation EXP 6480464 manganese chloride results in increased methylation of CLEC4F gene CTD PMID:28801915 Clec4f Rat methapyrilene increases methylation ISO CLEC4F (Homo sapiens) 6480464 Methapyrilene results in increased methylation of CLEC4F intron CTD PMID:30157460 Clec4f Rat N-nitrosodiethylamine multiple interactions ISO Clec4f (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of CLEC4F mRNA CTD PMID:24535843 Clec4f Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of CLEC4F mRNA CTD PMID:19041683 Clec4f Rat N-nitrosodiethylamine decreases expression ISO Clec4f (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of CLEC4F mRNA CTD PMID:24535843 Clec4f Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of CLEC4F mRNA CTD PMID:24136188 Clec4f Rat nickel atom decreases expression ISO CLEC4F (Homo sapiens) 6480464 Nickel results in decreased expression of CLEC4F mRNA CTD PMID:25583101 Clec4f Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of CLEC4F mRNA CTD PMID:24136188 Clec4f Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of CLEC4F mRNA CTD PMID:33484710 Clec4f Rat paracetamol multiple interactions ISO Clec4f (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of CLEC4F mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of CLEC4F mRNA] CTD PMID:17585979 Clec4f Rat paracetamol affects expression ISO Clec4f (Mus musculus) 6480464 Acetaminophen affects the expression of CLEC4F mRNA CTD PMID:17562736 Clec4f Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of CLEC4F mRNA CTD PMID:19162173 Clec4f Rat phenobarbital multiple interactions ISO Clec4f (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of CLEC4F mRNA and NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of CLEC4F mRNA] CTD PMID:19482888 and PMID:24535843 Clec4f Rat phenobarbital decreases expression ISO Clec4f (Mus musculus) 6480464 Phenobarbital results in decreased expression of CLEC4F mRNA CTD PMID:19482888 Clec4f Rat pirinixic acid decreases expression ISO Clec4f (Mus musculus) 6480464 pirinixic acid results in decreased expression of CLEC4F mRNA CTD PMID:11798191 Clec4f Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of CLEC4F mRNA CTD PMID:19162173 Clec4f Rat potassium dichromate increases expression ISO Clec4f (Mus musculus) 6480464 Potassium Dichromate results in increased expression of CLEC4F mRNA CTD PMID:23608068 Clec4f Rat pravastatin decreases expression EXP 6480464 Pravastatin results in decreased expression of CLEC4F mRNA CTD PMID:27225895 Clec4f Rat pravastatin decreases expression ISO Clec4f (Mus musculus) 6480464 Pravastatin results in decreased expression of CLEC4F mRNA CTD PMID:27225895 Clec4f Rat resveratrol multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of CLEC4F mRNA CTD PMID:25905778 Clec4f Rat resveratrol multiple interactions ISO Clec4f (Mus musculus) 6480464 Resveratrol inhibits the reaction [titanium dioxide results in decreased expression of CLEC4F mRNA] CTD PMID:31298478 Clec4f Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of CLEC4F mRNA CTD PMID:28374803 Clec4f Rat senecionine decreases expression EXP 6480464 senecionine results in decreased expression of CLEC4F mRNA CTD PMID:32419051 Clec4f Rat senecionine decreases expression ISO Clec4f (Mus musculus) 6480464 senecionine results in decreased expression of CLEC4F protein CTD PMID:35357534 Clec4f Rat Senkirkine decreases expression EXP 6480464 senkirkine results in decreased expression of CLEC4F mRNA CTD PMID:32419051 Clec4f Rat silicon dioxide decreases expression ISO Clec4f (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of CLEC4F mRNA CTD PMID:23221170 Clec4f Rat sodium arsenite decreases expression ISO Clec4f (Mus musculus) 6480464 sodium arsenite results in decreased expression of CLEC4F protein CTD PMID:29044176 Clec4f Rat sodium fluoride increases expression ISO Clec4f (Mus musculus) 6480464 Sodium Fluoride results in increased expression of CLEC4F mRNA CTD PMID:27862939 Clec4f Rat streptozocin multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of CLEC4F mRNA CTD PMID:25905778 Clec4f Rat tetrachloromethane increases expression ISO Clec4f (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CLEC4F mRNA CTD PMID:27339419 Clec4f Rat tetrachloromethane decreases expression ISO Clec4f (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of CLEC4F mRNA CTD PMID:31919559 Clec4f Rat theophylline decreases expression ISO CLEC4F (Homo sapiens) 6480464 Theophylline results in decreased expression of CLEC4F mRNA CTD PMID:18951874 Clec4f Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CLEC4F mRNA CTD PMID:34492290 Clec4f Rat titanium dioxide decreases expression ISO Clec4f (Mus musculus) 6480464 titanium dioxide results in decreased expression of CLEC4F mRNA CTD PMID:31298478 Clec4f Rat titanium dioxide multiple interactions ISO Clec4f (Mus musculus) 6480464 Resveratrol inhibits the reaction [titanium dioxide results in decreased expression of CLEC4F mRNA] CTD PMID:31298478 Clec4f Rat trichloroethene decreases expression ISO Clec4f (Mus musculus) 6480464 Trichloroethylene results in decreased expression of CLEC4F mRNA CTD PMID:19448997 Clec4f Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CLEC4F mRNA CTD PMID:33387578 Clec4f Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of CLEC4F mRNA CTD PMID:30589522
17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (EXP) ammonium chloride (EXP) amphetamine (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) buspirone (EXP) cadmium dichloride (EXP) carbon nanotube (ISO) chrysene (ISO) clofibrate (ISO) cocaine (EXP) decabromodiphenyl ether (EXP) Echimidine (EXP) ethanol (EXP) flutamide (EXP) fumonisin B1 (ISO) Heliotrine (EXP) hexachlorobenzene (EXP) Lasiocarpine (EXP) manganese(II) chloride (EXP) methapyrilene (ISO) N-nitrosodiethylamine (EXP,ISO) nefazodone (EXP) nickel atom (ISO) nimesulide (EXP) nitrofen (EXP) paracetamol (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) pirinixic acid (EXP,ISO) potassium dichromate (ISO) pravastatin (EXP,ISO) resveratrol (EXP,ISO) rotenone (EXP) senecionine (EXP,ISO) Senkirkine (EXP) silicon dioxide (ISO) sodium arsenite (ISO) sodium fluoride (ISO) streptozocin (EXP) tetrachloromethane (ISO) theophylline (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP,ISO) triphenyl phosphate (EXP)
Clec4f Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 117,686,686 - 117,696,407 (-) NCBI GRCr8 mRatBN7.2 4 116,129,023 - 116,138,744 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 116,129,023 - 116,138,775 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 121,607,811 - 121,617,529 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 117,382,983 - 117,392,701 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 115,996,525 - 116,006,244 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 115,322,300 - 115,332,021 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 115,322,291 - 115,332,052 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 179,911,569 - 179,921,290 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 117,839,863 - 117,849,584 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 118,084,343 - 118,094,065 (-) NCBI Celera 4 105,121,362 - 105,131,083 (-) NCBI Celera Cytogenetic Map 4 q34 NCBI
CLEC4F Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 70,808,643 - 70,825,235 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 70,808,643 - 70,820,599 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 71,035,775 - 71,047,731 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 70,889,283 - 70,901,240 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 70,947,432 - 70,959,387 NCBI Celera 2 70,886,456 - 70,898,414 (-) NCBI Celera Cytogenetic Map 2 p13.3 NCBI HuRef 2 70,772,576 - 70,784,093 (-) NCBI HuRef CHM1_1 2 70,965,099 - 70,977,053 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 70,819,694 - 70,836,320 (-) NCBI T2T-CHM13v2.0
Clec4f Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 83,621,524 - 83,633,098 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 83,621,524 - 83,633,169 (-) Ensembl GRCm39 Ensembl GRCm38 6 83,644,542 - 83,656,116 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 83,644,542 - 83,656,187 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 83,594,536 - 83,606,110 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 83,610,200 - 83,621,774 (-) NCBI MGSCv36 mm8 Celera 6 85,626,646 - 85,638,216 (-) NCBI Celera Cytogenetic Map 6 C3 NCBI cM Map 6 35.94 NCBI
Clec4f Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 14,367,192 - 14,381,350 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 14,365,348 - 14,379,664 (+) NCBI ChiLan1.0 ChiLan1.0
CLEC4F Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 55,568,918 - 55,580,564 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 55,572,862 - 55,584,508 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 70,872,242 - 70,883,547 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 71,985,988 - 71,997,123 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 71,985,814 - 71,997,123 (-) Ensembl panpan1.1 panPan2
CLEC4F Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 69,170,393 - 69,179,578 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 69,170,437 - 69,179,914 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 69,057,978 - 69,067,000 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 70,192,860 - 70,202,052 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 70,192,908 - 70,202,376 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 69,911,411 - 69,920,436 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 70,172,783 - 70,181,815 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 70,472,208 - 70,481,400 (-) NCBI UU_Cfam_GSD_1.0
Clec4f
CLEC4F
CLEC4F
Clec4f
.
Predicted Target Of
Count of predictions: 141 Count of miRNA genes: 96 Interacting mature miRNAs: 101 Transcripts: ENSRNOT00000017643 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 631689 Scl4 Serum cholesterol level QTL 4 1.9 0.008 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 95174120 140174120 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1578655 Bmd11 Bone mineral density QTL 11 11 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 4 90850165 135850165 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357342 Bw40 Body weight QTL 40 0.001 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 631556 Bp135 Blood pressure QTL 135 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 78881294 117676292 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 70167 Bw22 Body weight QTL 22 3.1 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 724522 Bp146 Blood pressure QTL 146 2.2 0.0021 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 73630210 118630210 Rat 61476 Aia3 Adjuvant induced arthritis QTL 3 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 86730991 131730991 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 1578670 Bss14 Bone structure and strength QTL 14 16.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 4 87327165 132327165 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 1578662 Bss15 Bone structure and strength QTL 15 19.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 4 87327165 132327165 Rat 2302051 Pia28 Pristane induced arthritis QTL 28 5.3 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 73630210 118630210 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 634334 Xhs3 X-ray hypersensitivity QTL 3 10 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 84728680 129854654 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 2306899 Bp338 Blood pressure QTL 338 0.071 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 81006124 120102625 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat
RH132980
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 117,686,865 - 117,687,571 (+) Marker Load Pipeline mRatBN7.2 4 116,129,202 - 116,129,908 (+) MAPPER mRatBN7.2 Rnor_6.0 4 115,322,480 - 115,323,185 NCBI Rnor6.0 Rnor_5.0 4 179,911,749 - 179,912,454 UniSTS Rnor5.0 RGSC_v3.4 4 117,840,043 - 117,840,748 UniSTS RGSC3.4 Celera 4 105,121,542 - 105,122,247 UniSTS RH 3.4 Map 4 674.9 UniSTS Cytogenetic Map 4 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
7
30
41
83
86
57
25
57
6
167
70
24
27
37
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017643 ⟹ ENSRNOP00000017643
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 116,129,023 - 116,138,775 (-) Ensembl Rnor_6.0 Ensembl 4 115,322,291 - 115,332,052 (-) Ensembl
RefSeq Acc Id:
NM_053753 ⟹ NP_446205
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,686,686 - 117,696,407 (-) NCBI mRatBN7.2 4 116,129,023 - 116,138,744 (-) NCBI Rnor_6.0 4 115,322,300 - 115,332,021 (-) NCBI Rnor_5.0 4 179,911,569 - 179,921,290 (-) NCBI RGSC_v3.4 4 117,839,863 - 117,849,584 (-) RGD Celera 4 105,121,362 - 105,131,083 (-) RGD
Sequence:
TGGGCTCCCAGGACAGACCTTAGAATCGTGGGGCAAGAGCAGTGCAGGAGGATGAAGGAGGCGGAACTGAACAGAGATGTGGCTAAATTCTGCACTGACAACCAGTGTGTCATCCTACAGCCCCAAGG
hide sequence
RefSeq Acc Id:
NP_446205 ⟸ NM_053753
- UniProtKB:
Q4KMB0 (UniProtKB/Swiss-Prot), P10716 (UniProtKB/Swiss-Prot), A6IAN7 (UniProtKB/TrEMBL)
- Sequence:
MKEAELNRDVAKFCTDNQCVILQPQGLGPKSAAPMAPRTLRHVQAIVALVVVTVFFSLLALFVVVLQPWRQKQNEDHPVKAGLHGGNYSGSDNCSQFVRRAEMQEAIQSLRASGNSSSCHKEIQTLKY
hide sequence
Ensembl Acc Id:
ENSRNOP00000017643 ⟸ ENSRNOT00000017643
RGD ID: 13693183 Promoter ID: EPDNEW_R3707 Type: multiple initiation site Name: Clec4f_1 Description: C-type lectin domain family 4, member F SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 115,332,020 - 115,332,080 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-06-08
Clec4f
C-type lectin domain family 4, member F
Clec4f
C-type lectin domain family 4, member f
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Clec4f
C-type lectin domain family 4, member f
Clecsf13
C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 13
Symbol and Name updated
1299863 APPROVED
2005-01-20
Clecsf13
C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 13
Kclr
Kupffer cell receptor
Symbol and Name updated
1299863 APPROVED
2002-08-07
Kclr
Kupffer cell receptor
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_protein
protein has 550 amino acids
633038
gene_transcript
has 18 contiguous, homologous sequences which have 14 residues in length
633038
