Advanced Search (OLGA)

Gene: Napa (NSF attachment protein alpha) Rattus norvegicus

Analyze

Symbol:

Napa

Name:

NSF attachment protein alpha

RGD ID:

620855

Description:

Enables syntaxin binding activity. Involved in positive regulation of ATP-dependent activity; protein-containing complex disassembly; and response to hyperoxia. Located in dendrite. Part of synaptobrevin 2-SNAP-25-syntaxin-1a complex. Is active in neuromuscular junction; postsynapse; and presynaptic active zone membrane. Orthologous to human NAPA (NSF attachment protein alpha); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,5-hexanedione; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

alpha-SNAP; alpha-soluble NSF attachment protein; N-ethylmaleimide sensitive fusion protein attachment protein alpha; N-ethylmaleimide-sensitive factor attachment protein, alpha; SNAP-alpha

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NAPA (NSF attachment protein alpha)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Napa (N-ethylmaleimide sensitive fusion protein attachment protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Napa (NSF attachment protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NAPA (NSF attachment protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NAPA (NSF attachment protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Napa (NSF attachment protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NAPA (NSF attachment protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NAPA (NSF attachment protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Napa (NSF attachment protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Napa (NSF attachment protein alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NAPB (NSF attachment protein beta)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	NAPA (NSF attachment protein alpha)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Napa (N-ethylmaleimide sensitive fusion protein attachment protein alpha)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	napaa (N-ethylmaleimide-sensitive factor attachment protein, alpha a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	napaa (N-ethylmaleimide-sensitive factor attachment protein, alpha a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	napab (N-ethylmaleimide-sensitive factor attachment protein, alpha b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	napab (N-ethylmaleimide-sensitive factor attachment protein, alpha b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	snap-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	snap-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SEC17	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SEC17	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	alphaSnap	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	alphaSnap	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	napa	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	napa	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	85,915,088 - 85,934,054 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	85,915,119 - 85,934,053 (+)	Ensembl				GRCr8
mRatBN7.2	1	76,787,036 - 76,805,869 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	76,786,932 - 76,805,869 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	82,161,106 - 82,179,706 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	90,725,130 - 90,743,730 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	83,916,205 - 83,934,791 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	77,994,227 - 78,012,846 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	77,994,203 - 78,012,845 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	79,261,024 - 79,279,633 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	76,438,616 - 76,457,225 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	71,277,383 - 71,295,992 (+)	NCBI		Celera
RGSC_v3.1	1	76,516,726 - 76,535,336 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Idiopathic Generalized Epilepsy (IMP)

temporal lobe epilepsy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,5-hexanedione (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

6-propyl-2-thiouracil (EXP)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP)

CGP 52608 (ISO)

chlorpyrifos (ISO)

choline (ISO)

cisplatin (ISO)

cocaine (EXP)

copper atom (ISO)

copper(0) (ISO)

D-glucose (ISO)

diazinon (ISO)

Dibutyl phosphate (ISO)

dimethylarsinous acid (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

ethanol (EXP,ISO)

folic acid (ISO)

furfural (ISO)

genistein (ISO)

gentamycin (EXP)

glucose (ISO)

GSK-J4 (ISO)

ivermectin (ISO)

L-methionine (ISO)

LY294002 (ISO)

N-methyl-4-phenylpyridinium (ISO)

paracetamol (ISO)

PCB138 (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

sodium arsenite (EXP,ISO)

sodium chloride (ISO)

Soman (EXP)

sunitinib (ISO)

tamoxifen (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apical protein localization (ISO)

brain development (ISO)

intracellular protein transport (IBA,IEA,ISO)

membrane fusion (NAS)

neuron differentiation (ISO)

positive regulation of ATP-dependent activity (IDA)

protein transport (IEA)

protein-containing complex disassembly (IDA,IEA)

regulation of synaptic vesicle priming (IBA,IEA,ISO)

response to hyperoxia (IEP)

SNARE complex disassembly (IBA,ISO)

synaptic transmission, glutamatergic (IBA,ISO)

synaptic vesicle priming (IEA,ISO)

vesicle-mediated transport (IEA)

Cellular Component

cytoplasmic vesicle (IDA)

dendrite (IDA)

glutamatergic synapse (IEA,ISO)

lamellar body (IDA)

membrane (IEA)

mitochondrion (IDA)

neuromuscular junction (IDA)

perikaryon (IDA)

plasma membrane (IDA,IEA)

postsynapse (IDA,IEP)

postsynaptic membrane (IDA)

presynapse (IDA,IEA,IEP)

presynaptic active zone membrane (IDA)

presynaptic membrane (IDA)

synaptic membrane (IDA)

synaptic vesicle (IDA)

synaptobrevin 2-SNAP-25-syntaxin-1a complex (IBA,IDA,IEA,ISO)

terminal bouton (HDA,IBA)

Molecular Function

protein binding (IPI,ISO)

protein-containing complex binding (IDA)

SNARE binding (IDA,IPI)

soluble NSF attachment protein activity (IBA)

syntaxin binding (IBA,IDA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Characterization of alpha-soluble N-ethylmaleimide-sensitive fusion attachment protein in alveolar type II cells: implications in lung surfactant secretion.	Abonyo BO, etal., Am J Respir Cell Mol Biol. 2003 Sep;29(3 Pt 1):273-82. doi: 10.1165/rcmb.2002-0189OC. Epub 2003 Mar 27.
2.	Syntaxin 6 functions in trans-Golgi network vesicle trafficking.	Bock JB, etal., Mol Biol Cell. 1997 Jul;8(7):1261-71.
3.	Mapping of the mouse hyh gene to a YAC/BAC contig on proximal Chromosome 7.	Chae TH, etal., Mamm Genome 2002 May;13(5):239-44.
4.	The hyh mutation uncovers roles for alpha Snap in apical protein localization and control of neural cell fate.	Chae TH, etal., Nat Genet 2004 Mar;36(3):264-70. Epub 2004 Feb 1.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	NSF ATPase and alpha-/beta-SNAPs disassemble the AMPA receptor-PICK1 complex.	Hanley JG, etal., Neuron 2002 Mar 28;34(1):53-67.
8.	Structure and conformational changes in NSF and its membrane receptor complexes visualized by quick-freeze/deep-etch electron microscopy.	Hanson PI, etal., Cell 1997 Aug 8;90(3):523-35.
9.	A programmed ependymal denudation precedes congenital hydrocephalus in the hyh mutant mouse.	Jimenez AJ, etal., J Neuropathol Exp Neurol 2001 Nov;60(11):1105-19.
10.	Vitamin E prevents hyperoxia-induced loss of soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor proteins in the rat neuronal cytoplasm.	Kaneai N, etal., Biol Pharm Bull. 2013;36(9):1500-2. doi: 10.1248/bpb.b13-00147.
11.	Association of N-ethylmaleimide sensitive fusion (NSF) protein and soluble NSF attachment proteins-alpha and -gamma with glucose transporter-4-containing vesicles in primary rat adipocytes.	Mastick CC and Falick AL, Endocrinology. 1997 Jun;138(6):2391-7. doi: 10.1210/endo.138.6.5166.
12.	Complexins: cytosolic proteins that regulate SNAP receptor function.	McMahon HT, etal., Cell 1995 Oct 6;83(1):111-9.
13.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
14.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.	Distribution of soluble N-ethylmaleimide fusion protein attachment proteins (SNAPs) in the rat nervous system.	Nishiki T, etal., Neuroscience. 2001;107(3):363-71.
16.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
17.	The AMPA receptor GluR2 C terminus can mediate a reversible, ATP-dependent interaction with NSF and alpha- and beta-SNAPs.	Osten P, etal., Neuron. 1998 Jul;21(1):99-110. doi: 10.1016/s0896-6273(00)80518-8.
18.	GOA pipeline	RGD automated data pipeline
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	The female hysterical personality disorder.	Schmidt DD and Messner E, J Fam Pract 1977 Mar;4(3):573-7.
21.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
22.	Disassembly of all SNARE complexes by N-ethylmaleimide-sensitive factor (NSF) is initiated by a conserved 1:1 interaction between alpha-soluble NSF attachment protein (SNAP) and SNARE complex.	Vivona S, etal., J Biol Chem. 2013 Aug 23;288(34):24984-91. doi: 10.1074/jbc.M113.489807. Epub 2013 Jul 8.
23.	Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.	Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.
24.	Association of Alpha-Soluble NSF Attachment Protein with Epileptic Seizure.	Xi Z, etal., J Mol Neurosci. 2015 Nov;57(3):417-25. doi: 10.1007/s12031-015-0596-4. Epub 2015 Jul 9.

Additional References at PubMed

PMID:9614193	PMID:11707603	PMID:14755058	PMID:15489334	PMID:16751776	PMID:16795052	PMID:17634366	PMID:18094056	PMID:18385322	PMID:19056867	PMID:19946888	PMID:21040848
PMID:21700703	PMID:23376485	PMID:23533145	PMID:25278303	PMID:29476059	PMID:32357304	PMID:37979021

Genomics

Comparative Map Data

Napa
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	85,915,088 - 85,934,054 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	85,915,119 - 85,934,053 (+)	Ensembl				GRCr8
mRatBN7.2	1	76,787,036 - 76,805,869 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	76,786,932 - 76,805,869 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	82,161,106 - 82,179,706 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	90,725,130 - 90,743,730 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	83,916,205 - 83,934,791 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	77,994,227 - 78,012,846 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	77,994,203 - 78,012,845 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	79,261,024 - 79,279,633 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	76,438,616 - 76,457,225 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	71,277,383 - 71,295,992 (+)	NCBI		Celera
RGSC_v3.1	1	76,516,726 - 76,535,336 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

NAPA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	47,484,530 - 47,515,063 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	47,487,637 - 47,515,091 (-)	Ensembl			hg38	GRCh38
GRCh37	19	47,990,894 - 48,018,320 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	52,682,703 - 52,710,309 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	52,682,702 - 52,710,309	NCBI
Celera	19	44,796,651 - 44,824,202 (-)	NCBI		Celera
Cytogenetic Map	19	q13.32-q13.33	NCBI
HuRef	19	44,419,062 - 44,446,529 (-)	NCBI		HuRef
CHM1_1	19	47,993,097 - 48,020,681 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	50,317,289 - 50,345,867 (-)	NCBI		T2T-CHM13v2.0

Napa
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	15,832,127 - 15,851,907 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	15,832,383 - 15,851,900 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	16,098,202 - 16,117,982 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	16,098,458 - 16,117,975 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	16,683,992 - 16,703,324 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	15,257,165 - 15,276,497 (+)	NCBI		MGSCv36	mm8
Celera	7	13,297,223 - 13,316,561 (+)	NCBI		Celera
Cytogenetic Map	7	A2	NCBI
cM Map	7	8.74	NCBI

Napa
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955574	1,330,300 - 1,353,576 (-)	Ensembl
ChiLan1.0	NW_004955574	1,330,911 - 1,353,392 (-)	NCBI	ChiLan1.0	ChiLan1.0

NAPA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	53,638,906 - 53,667,351 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	55,508,898 - 55,536,526 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	44,479,871 - 44,507,315 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	53,135,166 - 53,162,757 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	53,135,166 - 53,162,757 (-)	Ensembl			panPan2	panpan1.1

NAPA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	108,510,920 - 108,533,317 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	108,510,931 - 108,532,881 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	107,992,649 - 108,015,048 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	109,036,933 - 109,059,339 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	109,036,946 - 109,059,336 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	108,703,923 - 108,726,316 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	108,348,707 - 108,371,092 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	109,217,202 - 109,239,603 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Napa
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	19,537,428 - 19,560,366 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936664	1,155,557 - 1,178,631 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936664	1,155,557 - 1,178,626 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NAPA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	53,246,968 - 53,275,265 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	53,249,330 - 53,275,304 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	48,743,003 - 48,768,919 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NAPA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	40,818,490 - 40,845,661 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	40,818,175 - 40,845,470 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	20,553,773 - 20,581,195 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Napa
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624832	6,301,251 - 6,323,445 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Napa
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	172,961,726 - 172,980,674 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Napa
120 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	102
Count of miRNA genes:	76
Interacting mature miRNAs:	91
Transcripts:	ENSRNOT00000002044
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	43457837	87558729	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	46302615	91302615	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	43457837	87558729	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	46302615	91302615	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	42122968	87122968	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	46302615	91302615	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	43457837	87558729	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	46302615	91302615	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	30708375	87558729	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	51909206	91302615	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	46302615	91302615	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	43509952	88509952	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	42122968	87122968	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	46302615	91302615	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat

Markers in Region

D1Rat317

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	85,916,761 - 85,916,987 (+)	Marker Load Pipeline
mRatBN7.2	1	76,788,574 - 76,788,802 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	77,995,554 - 77,995,779	NCBI	Rnor6.0
Rnor_5.0	1	79,262,351 - 79,262,576	UniSTS	Rnor5.0
RGSC_v3.4	1	76,439,943 - 76,440,168	UniSTS	RGSC3.4
RGSC_v3.4	1	76,439,942 - 76,440,168	RGD	RGSC3.4
Celera	1	71,278,710 - 71,278,935	UniSTS
RGSC_v3.1	1	76,518,053 - 76,518,279	RGD
FHH x ACI Map	1	37.93	RGD
FHH x ACI Map	1	37.93	UniSTS
Cytogenetic Map	1	q21	UniSTS

PMC341847P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	76,805,220 - 76,805,729 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	78,012,198 - 78,012,706	NCBI	Rnor6.0
Rnor_5.0	1	79,278,995 - 79,279,503	UniSTS	Rnor5.0
RGSC_v3.4	1	76,456,587 - 76,457,095	UniSTS	RGSC3.4
Celera	1	71,295,354 - 71,295,862	UniSTS
Cytogenetic Map	1	q21	UniSTS

RH128512

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	76,805,544 - 76,805,725 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	78,012,522 - 78,012,702	NCBI	Rnor6.0
Rnor_5.0	1	79,279,319 - 79,279,499	UniSTS	Rnor5.0
RGSC_v3.4	1	76,456,911 - 76,457,091	UniSTS	RGSC3.4
Celera	1	71,295,678 - 71,295,858	UniSTS
RH 3.4 Map	1	778.6	UniSTS
Cytogenetic Map	1	q21	UniSTS

RH138028

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	76,800,389 - 76,800,567 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	78,007,367 - 78,007,544	NCBI	Rnor6.0
Rnor_5.0	1	79,274,164 - 79,274,341	UniSTS	Rnor5.0
RGSC_v3.4	1	76,451,756 - 76,451,933	UniSTS	RGSC3.4
Celera	1	71,290,523 - 71,290,700	UniSTS
RH 3.4 Map	1	777.4	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_080585	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017588706	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081799	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270674	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270700	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC063156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ602961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213217	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216375	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234471	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X89968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002044 ⟹ ENSRNOP00000002044

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	85,915,119 - 85,934,053 (+)	Ensembl
mRatBN7.2 Ensembl	1	76,787,184 - 76,805,869 (+)	Ensembl
Rnor_6.0 Ensembl	1	77,994,203 - 78,012,845 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093819 ⟹ ENSRNOP00000077298

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	76,786,932 - 76,805,866 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103865 ⟹ ENSRNOP00000081324

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	85,915,119 - 85,934,053 (+)	Ensembl
mRatBN7.2 Ensembl	1	76,786,932 - 76,805,866 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116376 ⟹ ENSRNOP00000080631

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	76,795,726 - 76,805,866 (+)	Ensembl

RefSeq Acc Id:

NM_080585 ⟹ NP_542152

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	85,915,435 - 85,934,044 (+)	NCBI
mRatBN7.2	1	76,787,248 - 76,805,859 (+)	NCBI
Rnor_6.0	1	77,994,227 - 78,012,836 (+)	NCBI
Rnor_5.0	1	79,261,024 - 79,279,633 (+)	NCBI
RGSC_v3.4	1	76,438,616 - 76,457,225 (+)	RGD
Celera	1	71,277,383 - 71,295,992 (+)	RGD

Sequence:

show sequence

GTAGCTTGGCTGTGTCGGGCCTGAACCGAGCAGCTGCGCGACGTCATGGACACCTCCGGGAAGC
AGGCTGAGGCTATGGCGCTGCTGGCTGAAGCGGAGCGCAAGGTGAAGAACTCGCAGTCCTTCTT
CTCCGGCCTCTTTGGAGGTTCATCCAAAATAGAGGAAGCATGCGAGATCTATGCCAGAGCTGCG
AACATGTTCAAGATGGCCAAGAACTGGAGCGCTGCTGGGAACGCTTTCTGCCAGGCTGCCCAAC
TGCACCTACAGCTCCAGAGCAAGCACGATGCAGCCACCTGCTTTGTGGACGCCGGCAACGCTTT
CAAGAAAGCTGACCCCCAAGAGGCCATTAACTGTCTGATGAGAGCAATTGAGATCTATACAGAC
ATGGGCAGATTCACAATCGCAGCCAAGCACCACATCTCCATTGCTGAGATCTATGAGACAGAAC
TGGTGGATGTAGAGAAGGCCATTGCCCACTACGAGCAATCTGCAGACTACTACAAAGGAGAAGA
GTCCAACAGCTCAGCCAACAAGTGTCTGCTGAAGGTGGCTGGCTACGCCGCACAGCTGGAGCAG
TACCAGAAGGCTATCGACATCTATGAGCAGGTGGGGACCAGCGCCATGGACAGTCCCCTCCTCA
AGTACAGCGCCAAAGACTACTTCTTCAAGGCGGCCCTTTGCCACTTCTGCATCGACATGCTGAA
CGCCAAGCTTGCTGTTCAGAAGTATGAGGAGCTGTTCCCTGCCTTCTCGGATTCCCGGGAATGC
AAGCTGATGAAAAAGCTGCTGGAAGCCCATGAGGAACAGAATGTGGACAGCTACACAGAGTCGG
TGAAGGAATATGACTCCATCTCCAGACTGGACCAGTGGCTTACCACCATGCTTCTACGAATCAA
GAAGACCATTCAGGGTGATGAGGAAGACCTGCGCTAGGCCTCCAGCCACTGCCTTCCACCCATC
TGTCTGTCACAGAGGTGGAGCCAACACCTCCACCAGGAGTCTGAAGGAGTGGGTNCAATGTAGG
CCTCATCCTCCAGGGCACCAGGCAAGCTCTCCTGGATGGCTGGTCACCCTATGCCCACTGCGTC
CTTCACCCCGCCATTTATTTAAGCTCCCAAAGGTGTCCTCCTGCTCTGGAAAACCCACCTGGAC
AGATTCTCCAATACAGACTTCTCTGTGTGCTTCAGGAACCTGGAGTCAGCATCCAGTCCCATCT
CCTGACCAGCAGTGTACTAAGGCTATTTCCATATCTCCTACCTTGTACCCTAGCAGAGATAAGA
ACACAGGTAGTTCGTGAGACTTGCTCTCCCTGGCTGGGGGTAGCCTCTGCCCCTGGAGCTTTCC
CTTGTTCCTACAATGCCAACCTCTCAGGTTAGACCCAGCCCTGGAGCTCACAGGGTGCCTTGGC
CCTGCCCTGCCCTGCACCTGCTTCTCTCGCTGCATCCAGGTCTGTCTGTCGACNTGAAGCTGCG
GCTGGCCCAAGAAAGACAANNACCTGCCACNNG

hide sequence

RefSeq Acc Id:

XM_039081759 ⟹ XP_038937687

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	85,915,088 - 85,934,054 (+)	NCBI
mRatBN7.2	1	76,787,036 - 76,805,869 (+)	NCBI

RefSeq Acc Id:

XM_039081799 ⟹ XP_038937727

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	85,915,270 - 85,934,054 (+)	NCBI
mRatBN7.2	1	76,787,055 - 76,805,869 (+)	NCBI

RefSeq Acc Id:

XM_063270674 ⟹ XP_063126744

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	85,915,258 - 85,934,054 (+)	NCBI

RefSeq Acc Id:

XM_063270700 ⟹ XP_063126770

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	85,915,509 - 85,934,054 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_542152	(Get FASTA)	NCBI Sequence Viewer
	XP_038937687	(Get FASTA)	NCBI Sequence Viewer
	XP_038937727	(Get FASTA)	NCBI Sequence Viewer
	XP_063126744	(Get FASTA)	NCBI Sequence Viewer
	XP_063126770	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH63156	(Get FASTA)	NCBI Sequence Viewer
	CAA62005	(Get FASTA)	NCBI Sequence Viewer
	EDM08339	(Get FASTA)	NCBI Sequence Viewer
	EDM08340	(Get FASTA)	NCBI Sequence Viewer
	EDM08341	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002044
	ENSRNOP00000081324
GenBank Protein	P54921	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_542152 ⟸ NM_080585

- UniProtKB:

P54921 (UniProtKB/Swiss-Prot), A6J895 (UniProtKB/TrEMBL), A0A8L2PZF0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDTSGKQAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAAGNA
FCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIA
EIYETELVDVEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAAQLEQYQKAIDIYEQVGTSA
MDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNV
DSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR

hide sequence

Ensembl Acc Id:

ENSRNOP00000002044 ⟸ ENSRNOT00000002044

RefSeq Acc Id:	XP_038937687 ⟸ XM_039081759
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2PZF0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038937727 ⟸ XM_039081799
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I5ZQH1 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000081324 ⟸ ENSRNOT00000103865

Ensembl Acc Id:

ENSRNOP00000080631 ⟸ ENSRNOT00000116376

Ensembl Acc Id:

ENSRNOP00000077298 ⟸ ENSRNOT00000093819

RefSeq Acc Id:	XP_063126744 ⟸ XM_063270674
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063126770 ⟸ XM_063270700
- Peptide Label:	isoform X3

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P54921-F1-model_v2	AlphaFold	P54921	1-295	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689724

Promoter ID:

EPDNEW_R248

Type:

initiation region

Name:

Napa_1

Description:

NSF attachment protein alpha

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	77,994,198 - 77,994,258	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620855	AgrOrtholog
BioCyc Gene	G2FUF-60624	BioCyc
Ensembl Genes	ENSRNOG00000001494	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000002044	ENTREZGENE
	ENSRNOT00000103865	ENTREZGENE
Gene3D-CATH	1.25.40.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6921187	IMAGE-MGC_LOAD
InterPro	NSF_attach	UniProtKB/Swiss-Prot
	TPR-like_helical_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:140673	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72716	IMAGE-MGC_LOAD
NCBI Gene	140673	ENTREZGENE
PANTHER	ALPHA-SOLUBLE NSF ATTACHMENT PROTEIN	UniProtKB/Swiss-Prot
	PTHR13768	UniProtKB/Swiss-Prot
Pfam	SNAP	UniProtKB/Swiss-Prot
PhenoGen	Napa	PhenoGen
PRINTS	NSFATTACHMNT	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001494	RatGTEx
Superfamily-SCOP	SSF48452	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZQH1	ENTREZGENE
	A0A8I5ZSQ9_RAT	UniProtKB/TrEMBL
	A0A8L2PZF0	ENTREZGENE, UniProtKB/TrEMBL
	A6J893_RAT	UniProtKB/TrEMBL
	A6J894_RAT	UniProtKB/TrEMBL
	A6J895	ENTREZGENE, UniProtKB/TrEMBL
	P54921	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-23	Napa	NSF attachment protein alpha	Napa	N-ethylmaleimide-sensitive factor attachment protein, alpha	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-11	Napa	N-ethylmaleimide-sensitive factor attachment protein, alpha	Napa	N-ethylmaleimide sensitive fusion protein attachment protein alpha	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Napa	N-ethylmaleimide sensitive fusion protein attachment protein alpha			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Napa	N-ethylmaleimide sensitive fusion protein attachment protein alpha			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message