Advanced Search (OLGA)

Gene: Gng5 (G protein subunit gamma 5) Rattus norvegicus

Analyze

Symbol:

Gng5

Name:

G protein subunit gamma 5

RGD ID:

620807

Description:

Predicted to enable G-protein beta-subunit binding activity and PDZ domain binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Predicted to act upstream of or within positive regulation of neural precursor cell proliferation and positive regulation of secondary heart field cardioblast proliferation. Part of G-protein beta/gamma-subunit complex. Orthologous to human GNG5 (G protein subunit gamma 5); PARTICIPATES IN chemokine mediated signaling pathway; glutamate signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

G protein gamma-5 subunit; guanine nucleotide binding protein (G protein), gamma 5; guanine nucleotide binding protein (G protein), gamma 5 subunit; guanine nucleotide binding protein gamma 5; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GNG5 (G protein subunit gamma 5)	RGD	RGD
Mus musculus (house mouse):	Gng5 (G protein subunit gamma 5)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Gng5 (G protein subunit gamma 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GNG5 (G protein subunit gamma 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GNG5 (G protein subunit gamma 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gng5 (G protein subunit gamma 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GNG5 (G protein subunit gamma 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103236336 (guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gng5 (G protein subunit gamma 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gng5 (G protein subunit gamma 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GNG5B (G protein subunit gamma 5B)	HGNC	Ensembl
Alliance orthologs ³
Homo sapiens (human):	GNG5 (G protein subunit gamma 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	GNG5 (G protein subunit gamma 5)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gng5 (G protein subunit gamma 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Gng5 (G protein subunit gamma 5)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gng5 (guanine nucleotide binding protein (G protein), gamma 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gng5 (guanine nucleotide binding protein (G protein), gamma 5)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gpc-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gpc-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ggamma1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	Ggamma1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG43324	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	gng5	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	gng5	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Related Pseudogenes:

Gng5-ps3 Gng5-ps4 Gng5-ps5

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	238,054,954 - 238,063,451 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	238,054,858 - 238,064,196 (+)	Ensembl				GRCr8
GRCr8 Ensembl	11	58,096,362 - 58,096,565 (+)	Ensembl				GRCr8
mRatBN7.2	2	235,394,680 - 235,403,177 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	77,292,043 - 77,292,513 (+)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	11	44,627,300 - 44,627,503 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	243,190,418 - 243,198,920 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	241,081,826 - 241,090,324 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	235,948,055 - 235,956,557 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	252,359,976 - 252,368,473 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	252,359,976 - 252,368,473 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	270,886,941 - 270,895,438 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	244,702,876 - 244,711,373 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	227,374,391 - 227,382,888 (+)	NCBI		Celera
RGSC_v3.1	2	244,689,615 - 244,698,113 (+)	NCBI
Cytogenetic Map	2	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

atrazine (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (EXP)

cadmium dichloride (EXP)

caffeine (ISO)

chlormequat chloride (EXP)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (ISO)

daidzein (ISO)

daidzein 7-O-beta-D-glucoside (ISO)

dexamethasone (ISO)

dibutyl phthalate (EXP,ISO)

diethylstilbestrol (ISO)

dimethylarsinic acid (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (EXP)

folic acid (ISO)

FR900359 (ISO)

genistein (EXP,ISO)

genistein 7-O-beta-D-glucoside (ISO)

glycitein (ISO)

glycitin (ISO)

hydrazine (ISO)

indometacin (ISO)

ivermectin (ISO)

lead diacetate (ISO)

maneb (ISO)

methidathion (ISO)

ochratoxin A (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenethyl isothiocyanate (EXP)

pirinixic acid (ISO)

potassium dichromate (ISO)

procymidone (EXP)

sodium arsenite (ISO)

Soman (EXP)

thiram (ISO)

tolcapone (EXP)

toluene (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

G protein-coupled receptor signaling pathway (IBA,IEA)

positive regulation of neural precursor cell proliferation (ISO)

positive regulation of secondary heart field cardioblast proliferation (ISO)

signal transduction (IEA)

Cellular Component

G-protein beta/gamma-subunit complex (IDA)

heterotrimeric G-protein complex (IBA,IEA)

plasma membrane (IEA)

Molecular Function

G-protein beta-subunit binding (IBA,IEA)

PDZ domain binding (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

glutamate signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	The heterotrimeric G protein subunits Galpha(q) and Gbeta(1) have lysophospholipase D activity.	Aoyama C, etal., Biochem J. 2011 Dec 1;440(2):241-50. doi: 10.1042/BJ20110545.
2.	Characterization of the cDNA and genomic sequence of a G protein gamma subunit (gamma 5).	Fisher KJ and Aronson NN Jr, Mol Cell Biol 1992 Apr;12(4):1585-91.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Information Derived from GenBank Report	RGD, Sept. 2003
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:18614015	PMID:19056867	PMID:19946888	PMID:20458337	PMID:23209302	PMID:23376485	PMID:24599258

Genomics

Comparative Map Data

Gng5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	238,054,954 - 238,063,451 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	238,054,858 - 238,064,196 (+)	Ensembl				GRCr8
GRCr8 Ensembl	11	58,096,362 - 58,096,565 (+)	Ensembl				GRCr8
mRatBN7.2	2	235,394,680 - 235,403,177 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	77,292,043 - 77,292,513 (+)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	11	44,627,300 - 44,627,503 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	243,190,418 - 243,198,920 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	241,081,826 - 241,090,324 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	235,948,055 - 235,956,557 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	252,359,976 - 252,368,473 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	252,359,976 - 252,368,473 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	270,886,941 - 270,895,438 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	244,702,876 - 244,711,373 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	227,374,391 - 227,382,888 (+)	NCBI		Celera
RGSC_v3.1	2	244,689,615 - 244,698,113 (+)	NCBI
Cytogenetic Map	2	q44	NCBI

GNG5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	84,498,325 - 84,506,581 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	84,498,284 - 84,507,237 (-)	Ensembl			hg38	GRCh38
GRCh37	1	84,964,008 - 84,972,264 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	84,736,680 - 84,744,831 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	84,676,112 - 84,684,264	NCBI
Celera	1	83,208,179 - 83,216,434 (-)	NCBI		Celera
Cytogenetic Map	1	p22.3	NCBI
HuRef	1	83,074,217 - 83,082,472 (-)	NCBI		HuRef
CHM1_1	1	85,078,836 - 85,087,091 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	84,338,707 - 84,346,962 (-)	NCBI		T2T-CHM13v2.0

Gng5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	146,205,591 - 146,211,298 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	146,205,562 - 146,211,327 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	146,499,836 - 146,505,543 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	146,499,807 - 146,505,572 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	146,162,800 - 146,168,507 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	146,437,222 - 146,442,929 (+)	NCBI		MGSCv36	mm8
MGSCv36	2	22,592,270 - 22,592,755 (-)	NCBI		MGSCv36	mm8
Celera	3	152,950,022 - 152,955,729 (+)	NCBI		Celera
Cytogenetic Map	3	H2	NCBI
cM Map	3	71.54	NCBI

Gng5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955423	9,388,501 - 9,393,287 (+)	NCBI	ChiLan1.0	ChiLan1.0

GNG5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	142,436,269 - 142,444,205 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	141,590,701 - 141,598,635 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	117,046,699 - 117,055,097 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	85,907,523 - 85,915,899 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2

GNG5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	63,389,991 - 63,398,797 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	3,966,947 - 3,967,377 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	66,036,986 - 66,045,291 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	63,928,353 - 63,936,839 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	63,846,818 - 63,936,830 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	63,456,623 - 63,464,915 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	63,425,333 - 63,433,644 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	63,931,297 - 63,939,608 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gng5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	95,195,921 - 95,203,713 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936608	1,102,140 - 1,110,116 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936608	1,102,140 - 1,110,116 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNG5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	129,247,405 - 129,250,957 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	129,247,324 - 129,254,973 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

LOC103236336
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	92,726,766 - 92,728,028 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	72,407,737 - 72,408,252 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gng5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624742	12,969,251 - 12,977,417 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624742	12,969,229 - 12,977,367 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gng5
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	14,397,679 - 14,405,311 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gng5
47 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	314
Count of miRNA genes:	179
Interacting mature miRNAs:	210
Transcripts:	ENSRNOT00000021358
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
1331767	Hrtrt12	Heart rate QTL 12	3.373		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	221088977	243501206	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	210956252	251712708	Rat
8693697	Alc36	Alcohol consumption QTL 36	2	0.592	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	219814164	239320906	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
1298075	Scl17	Serum cholesterol level QTL 17	3.4		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	214404877	251712708	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
2293833	Kiddil8	Kidney dilation QTL 8	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	220274283	249795005	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	203664411	248664411	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	204795005	249795005	Rat
7207490	Bss111	Bone structure and strength QTL 111	6.4		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	2	214404877	251712708	Rat
7207484	Bss108	Bone structure and strength QTL 108	5.3		femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	2	214404877	251712708	Rat
2313073	Bmd75	Bone mineral density QTL 75	4.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	2	218051934	251712708	Rat
8693622	Alc26	Alcohol consumption QTL 26	2.4	0.667	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	223810546	243965570	Rat
7207482	Bss107	Bone structure and strength QTL 107	7		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	2	214404877	251712708	Rat
2293844	Kiddil7	Kidney dilation QTL 7	3.5		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	220274283	249795005	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	196140964	251540988	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
1549836	Bss2	Bone structure and strength QTL 2	7.5		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	2	214404877	251712708	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	205135267	250135267	Rat

Markers in Region

AA859354

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	44,627,255 - 44,627,438 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	47,090,201 - 47,090,383	NCBI	Rnor6.0
Rnor_5.0	11	50,272,091 - 50,272,273	UniSTS	Rnor5.0
RGSC_v3.4	11	45,602,158 - 45,602,340	UniSTS	RGSC3.4
Celera	11	44,377,761 - 44,377,943	UniSTS
RH 3.4 Map	11	332.4	UniSTS
Cytogenetic Map	2	q44	UniSTS
Cytogenetic Map	11	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
18	19	77	183	118	118	67	112	67	6	424	235	11	153	91	102	51	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_024377	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098557	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC058469	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120494	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M95780	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000060645 ⟹ ENSRNOP00000057378

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	58,096,362 - 58,096,565 (+)	Ensembl
mRatBN7.2 Ensembl	11	44,627,300 - 44,627,503 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105080 ⟹ ENSRNOP00000087679

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	77,292,043 - 77,292,513 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000162197 ⟹ ENSRNOP00000098897

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	238,054,858 - 238,064,196 (+)	Ensembl

RefSeq Acc Id:

NM_024377 ⟹ NP_077353

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	238,054,954 - 238,063,451 (+)	NCBI
mRatBN7.2	2	235,394,680 - 235,403,177 (+)	NCBI
Rnor_6.0	2	252,359,976 - 252,368,473 (+)	NCBI
Rnor_5.0	2	270,886,941 - 270,895,438 (+)	NCBI
RGSC_v3.4	2	244,702,876 - 244,711,373 (+)	RGD
Celera	2	227,374,391 - 227,382,888 (+)	RGD

Sequence:

show sequence

AGTTGGCCCGGCTGTCCCGAGCGCCATGTCGGGTTCTTCTAGCGTCGCCGCCATGAAGAAGGTG
GTTCAGCAACTCCGGCTGGAGGCCGGGCTCAACCGCGTGAAGGTTTCCCAGGCAGCTGCAGACT
TGAAACAGTTCTGTCTGCAGAATGCTCAACATGACCCTCTGCTGACTGGAGTGTCTTCAAGTAC
AAATCCCTTCAGACCCCAGAAAGTCTGCTCCTTTTTGTAGTCATATATCTCGAGGTTTCTCAAA
CTACTTTTCATGAACCAGTGAATATTCACGAGAACTAAGTTCGAAGTCACTAAGTTTGAAGTCT
GTACAGAAGCTTCTCTTTAACACGTGCCATACACATAATCTTCTACTCGTCAGTCCTTAACATC
TACCTCTCTGGATTTTCATGGATCTCTGTTTCACAAGGTTTAACTGTTTTATATACACTGGCTG
TAGCATACAATAAAGCAGCATACAAACTTTTGGCCTTGTTATTGATATGAAATGTGCTGTATAC
TAATTTTTTCAACATCAGGACTCACTGCCTTATTGGCAAGGCTTCTAGGAATTTACAGAACAAC
TGCAAATCTTTGTTCAAAGGCCGGAAGACTTAAGAGTTTCTAATCCTTCAGTCAGTTATGGGAA
TTATCTTAAATATCCCAAATATAGGTAGGGAGATGGCTCGGTGGCTAAGAGCACTTGCTCTGCA
GTTAGTTATGCTGAGTTCAGATCCTGCCACCCATGTAAAAAGCTGGGCGTGGCTGTACATGCCC
GTGGCCACAGCTTCGGGGAGATGGTTTGTTGGCTGCCAGCGAGGGTAAGGTTGTAATTAGCTCC
GTGAGAACGAGGCAGAAAGGGATACAGGTGCCTGACACTGCCATGTGGGCTCACACAGGCAACA
AACAACTCTAGTGGCGTCAGCAGTTAGTGCTACCAAGAAGGTGGCTGCTTCCATCTGGAAAAAG
AGTTAAAGATTCACAGAATCAAGACCTTGAGGACTTACGACAATGCCTCAAGTAGGCAAGTGGA
GGTAATTAGGTAGAAAGGAACAAGAAAACAGGTTAACCTCTGTGACCTGTAACTTTGCTCCAAG
TCCCAATAACCTGTCCTTTAGAACTGGTATATTAAATCAGGGTCATACACTATCTACCAACAAG
CCTTTTTTCTAGCCTACAAGTTCTTTGGGAATGAAAATTATAAAGTTTGAATCGTCATTCCTAA
GAAATTATTACAACTAATCCAAAATGACAACAGCTTTTATGACTTTCATACATAATTTTTCAGA
CAAAAATAAAATTATATTTATTTATATTTACTATATGCAGTGGAAACTCATAGCACTTGGTCAT
TTCTTCAAACACAGGATTTATAAAATAAAATCCCATTTTGAAAAGTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_077353	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41188	(Get FASTA)	NCBI Sequence Viewer
	AAH58469	(Get FASTA)	NCBI Sequence Viewer
	AAZ23832	(Get FASTA)	NCBI Sequence Viewer
	AAZ23833	(Get FASTA)	NCBI Sequence Viewer
	EDL82425	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000087679.1
	ENSRNOP00000098897
GenBank Protein	P63219	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_077353 ⟸ NM_024377
- UniProtKB:	P63219 (UniProtKB/Swiss-Prot), F2Z3T8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKV CSFL hide sequence

Ensembl Acc Id:

ENSRNOP00000087679 ⟸ ENSRNOT00000105080

Ensembl Acc Id:

ENSRNOP00000057378 ⟸ ENSRNOT00000060645

Ensembl Acc Id:

ENSRNOP00000098897 ⟸ ENSRNOT00000162197

Protein Domains

G protein gamma

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P63219-F1-model_v2	AlphaFold	P63219	1-68	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691815

Promoter ID:

EPDNEW_R2340

Type:

initiation region

Name:

LOC108349548_1

Description:

guanine nucleotide-binding protein G/G/G subunit gamma-5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	252,359,976 - 252,360,036	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620807	AgrOrtholog
BioCyc Gene	G2FUF-50900	BioCyc
Ensembl Genes	ENSRNOG00000015936	Ensembl
	ENSRNOG00000039562	Ensembl
	ENSRNOG00000063636	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000084618	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000105080.1	UniProtKB/Swiss-Prot
	ENSRNOT00000162197	ENTREZGENE
Gene3D-CATH	4.10.260.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6918279	IMAGE-MGC_LOAD
InterPro	G-protein_gamma-like_dom	UniProtKB/Swiss-Prot
	GGL_sf	UniProtKB/Swiss-Prot
	Gprotein-gamma	UniProtKB/Swiss-Prot
KEGG Report	rno:79218	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72806	IMAGE-MGC_LOAD
NCBI Gene	79218	ENTREZGENE
PANTHER	PTHR13809	UniProtKB/Swiss-Prot
Pfam	G-gamma	UniProtKB/Swiss-Prot
PhenoGen	Gng5	PhenoGen
PRINTS	GPROTEING	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_GAMMA	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000015936	RatGTEx
	ENSRNOG00000039562	RatGTEx
	ENSRNOG00000063636	RatGTEx
	ENSRNOG00000084618	RatGTEx
SMART	G_gamma	UniProtKB/Swiss-Prot
	GGL	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48670	UniProtKB/Swiss-Prot
UniProt	A6HWD9_RAT	UniProtKB/TrEMBL
	F2Z3T8	ENTREZGENE, UniProtKB/TrEMBL
	GBG5_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q45QK8_RAT	UniProtKB/TrEMBL
UniProt Secondary	P30670	UniProtKB/Swiss-Prot
	Q61015	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-15	Gng5	G protein subunit gamma 5	Gng5	guanine nucleotide binding protein (G protein), gamma 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-31	Gng5	guanine nucleotide binding protein (G protein), gamma 5	Gng5	guanine nucleotide binding protein (G protein), gamma 5 subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Gng5	guanine nucleotide binding protein (G protein), gamma 5 subunit		G protein gamma-5 subunit	Name updated	1299863	APPROVED
2002-08-07	Gng5	G protein gamma-5 subunit			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)